Query         gi|254780660|ref|YP_003065073.1| hypothetical protein CLIBASIA_02735 [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 244
No_of_seqs    153 out of 2227
Neff          6.6 
Searched_HMMs 13730
Date          Wed Jun  1 09:14:06 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780660.hhm -d /home/congqian_1/database/scop/scop70_1_75.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 d1kona_ e.39.1.1 (A:) Hypothet 100.0       0       0  638.8  15.2  239    3-244     1-241 (244)
  2 d1lfpa_ e.39.1.1 (A:) Hypothet 100.0       0       0  628.7  21.0  240    5-244     1-241 (243)
  3 d1mw7a_ e.39.1.1 (A:) Hypothet 100.0       0       0  532.1  18.7  214   23-238     1-220 (220)
  4 d1vi7a2 d.58.11.2 (A:138-208)   48.0     5.9 0.00043   17.9   2.6   48  169-219     4-53  (71)
  5 d2o35a1 a.293.1.1 (A:2-80) Hyp  46.7     4.9 0.00036   18.4   2.1   21  214-234    13-33  (79)
  6 d1ewqa2 c.37.1.12 (A:542-765)   39.3      10 0.00074   16.1   2.8   15  211-225   208-222 (224)
  7 d1wb9a2 c.37.1.12 (A:567-800)   34.9      13 0.00094   15.4   2.8   19  208-227   215-233 (234)
  8 d1i1ga2 d.58.4.2 (A:62-141) Lp  34.3      13 0.00093   15.5   2.6   67  170-240     7-77  (80)
  9 d1qmha1 c.47.2.1 (A:185-279) R  32.5      14   0.001   15.2   2.9   46   58-105    14-62  (95)
 10 d2cyya2 d.58.4.2 (A:65-150) Pu  25.7      18  0.0013   14.4   2.9   66  170-239     7-75  (86)
 11 d1t95a2 d.235.1.2 (A:11-86) Hy  23.6      17  0.0013   14.5   1.7   53  165-217    10-62  (76)
 12 d1gh8a_ d.58.12.1 (A:) aEF-1be  21.4      15  0.0011   15.0   1.0   27  206-234    55-81  (89)
 13 d1lxja_ d.58.48.1 (A:) Hypothe  20.8     4.1  0.0003   19.0  -1.9   38  200-241    42-83  (104)

No 1  
>d1kona_ e.39.1.1 (A:) Hypothetical protein YebC {Escherichia coli [TaxId: 562]}
Probab=100.00  E-value=0  Score=638.83  Aligned_cols=239  Identities=39%  Similarity=0.633  Sum_probs=229.0

Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-CCCCC
Q ss_conf             74112655646775578889799999999999998189994148999999999996688878999999850377-66664
Q gi|254780660|r    3 GHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSD-DLGNY   81 (244)
Q Consensus         3 GHsKW~nIkh~K~~~D~~k~k~f~k~~keI~~A~k~gG~dp~~N~~L~~ai~~Ak~~~mPk~~Ie~aIkk~~~~-~~~~~   81 (244)
                      ||||||||||+|+++|++||++|+||+|+|++|||+|||||+.|+|||+||++||++||||++|||||+||.|. ...+|
T Consensus         1 GHsKW~nIkh~K~a~D~~k~k~f~k~~k~I~~A~k~GG~DP~~N~~L~~ai~~Ak~~nmPkd~IeraIkk~~g~~~~~~~   80 (244)
T d1kona_           1 GHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNNMTRDTLNRAIARGVGGDDDANM   80 (244)
T ss_dssp             CCCSGGGTSSSTTTTTSCHHHHHHHHHHHHHHHHHC-----CCSTTTHHHHHHHHHTTCCHHHHHHHHSCC------CCC
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCE
T ss_conf             98556666678899889999999999999999998179997619999999999988279657999999834587777743


Q ss_pred             CEEEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEECCCCCCCHHHHHHHHCCCCC
Q ss_conf             02367865059939999994463023589989876425683147886045686447279706775301366775126875
Q gi|254780660|r   82 TNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAF  161 (244)
Q Consensus        82 ~~~~yEg~gP~gvaiiVe~lTDN~nRt~~~vr~~f~K~gG~lg~~Gsv~~~F~~~G~i~~~~~~~d~d~~~e~aie~ga~  161 (244)
                      ++++|||||||||+|||||||||+|||+++||++|+|+||+||++|||+|||+|+|+|.++..  ++|.+++++||+||+
T Consensus        81 ~e~~yEg~gp~gvaiiVe~lTDN~nRt~~~vR~~f~K~gG~lg~~GsV~~~F~~kG~i~~~~~--~~d~l~e~aie~gAe  158 (244)
T d1kona_          81 ETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKCGGNLGTDGSVAYLFSKKGVISFEKG--DEDTIMEAALEAGAE  158 (244)
T ss_dssp             EEEEEEEEETTTEEEEEEEEESCHHHHHHHHHHHHHTTTCEECCTTSSGGGEEEEEEEEESSS--CHHHHHHHHHHHTCS
T ss_pred             EEEEEEEECCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCEECCCCCHHHHHHEECEECCCCC--CHHHHHHHHHHHCCC
T ss_conf             799998886986389999962747779999999999749956788507456421010044789--989999999985042


Q ss_pred             CCCC-CCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCC
Q ss_conf             2234-688259996432013456654202567422217860376102489899999999998752388813110256266
Q gi|254780660|r  162 EVLF-EDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA  240 (244)
Q Consensus       162 Dv~~-~d~~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~~i~  240 (244)
                      |++. +++.++|+|+|++|.+|+++|++.++.+.+++|+|+|+++|+|++ |+++++.+|+|.|||+||||+||||++|+
T Consensus       159 Dv~~~d~~~~~i~~~~~dl~~v~~~Le~~g~~~~~aei~~~P~~~v~l~~-e~~~k~~kLid~Led~DDVq~Vy~N~~i~  237 (244)
T d1kona_         159 DVVTYDDGAIDVYTAWEEMGKVRDALEAAGLKADSAEVSMIPSTKADMDA-ETAPKLMRLIDMLEDCDDVQEVYHNGEIS  237 (244)
T ss_dssp             EEEECTTSCEEEEEEGGGHHHHHHHHHHTTCCCSEEEEEEEESSCCCCCT-TTSHHHHHHHHHHHHSSSEEEEEECCCCC
T ss_pred             HHCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCEEEEEEEEECCCCCCCH-HHHHHHHHHHHHHHCCCCCCEEEECCCCC
T ss_conf             00025777369994304399999999755887224369997688414399-99999999999874434734387888529


Q ss_pred             CCCC
Q ss_conf             2439
Q gi|254780660|r  241 DDII  244 (244)
Q Consensus       241 eeil  244 (244)
                      ||+|
T Consensus       238 ee~l  241 (244)
T d1kona_         238 DEVA  241 (244)
T ss_dssp             HHHH
T ss_pred             HHHH
T ss_conf             9998


No 2  
>d1lfpa_ e.39.1.1 (A:) Hypothetical protein aq1575 {Aquifex aeolicus [TaxId: 63363]}
Probab=100.00  E-value=0  Score=628.73  Aligned_cols=240  Identities=39%  Similarity=0.621  Sum_probs=234.4

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCC-CCCCCCE
Q ss_conf             112655646775578889799999999999998189994148999999999996688878999999850377-6666402
Q gi|254780660|r    5 SQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSD-DLGNYTN   83 (244)
Q Consensus         5 sKW~nIkh~K~~~D~~k~k~f~k~~keI~~A~k~gG~dp~~N~~L~~ai~~Ak~~~mPk~~Ie~aIkk~~~~-~~~~~~~   83 (244)
                      ||||||||+||++|++|||+|+||+|+|++|||+|||||+.|||||+||++||++||||++|||||+||.|. +..+|++
T Consensus         1 SkW~nIkh~K~~~D~~r~k~f~k~~r~I~~A~k~GG~DP~~N~~L~~ai~~Ak~~nmPk~~Ie~AIkk~~g~~~~~~~~~   80 (243)
T d1lfpa_           1 SHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANMPWENIERAIKKGAGELEGEQFEE   80 (243)
T ss_dssp             CCSCCSSSSSSCTTTSHHHHHHHHHHHHHHHHHHHCSCGGGCHHHHHHHHHHHHTTCCHHHHHHHHHHHHSCSSSCCCEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCHHHHHHHHHHCCCCCCCCCCEE
T ss_conf             97324666888988999999999999999999807999760999999999998807968899999985333456566569


Q ss_pred             EEEEEECCCCEEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHCCEEEECCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             36786505993999999446302358998987642568314788604568644727970677530136677512687522
Q gi|254780660|r   84 IRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV  163 (244)
Q Consensus        84 ~~yEg~gP~gvaiiVe~lTDN~nRt~~~vr~~f~K~gG~lg~~Gsv~~~F~~~G~i~~~~~~~d~d~~~e~aie~ga~Dv  163 (244)
                      ++|||||||||+|||||||||+|||+++|||+|+|+||+||++|||+|||+|+|+|.++.+..++|.+++.++|+||+|+
T Consensus        81 ~~yEg~gP~GvaiiVe~lTDN~nRt~~~vr~~f~K~gG~l~~~GsV~~~F~~kG~i~~~~~~~~ed~l~~~~ie~gaed~  160 (243)
T d1lfpa_          81 VIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKHGGNLGASGCVSYLFERKGYIEVPAKEVSEEELLEKAIEVGAEDV  160 (243)
T ss_dssp             EEEEEEETTTEEEEEEEEESCHHHHHHHHHHHHHHTTCEECCTTSSGGGEEEEEEEEEEGGGSCHHHHHHHHHHHTCSEE
T ss_pred             EEEEEEECCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCEEEEECCCCEECCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             99988846984899998424156568999999976388464354103465120101246676436777777764020000


Q ss_pred             CCCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC
Q ss_conf             34688259996432013456654202567422217860376102489899999999998752388813110256266243
Q gi|254780660|r  164 LFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDI  243 (244)
Q Consensus       164 ~~~d~~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~~i~eei  243 (244)
                      +.+++.++|+|+|++|.+|+++|++.++++.+++|+|+|+++|+|+++|+++++.+|++.|||+||||+||||++|+||+
T Consensus       161 e~~~~~~~i~~~~~~l~~v~~~Le~~g~~i~~sei~~~P~~~v~l~dee~~~kv~kLid~Led~DDVq~Vy~N~ei~de~  240 (243)
T d1lfpa_         161 QPGEEVHIIYTVPEELYEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEIPEEI  240 (243)
T ss_dssp             ECCSSEEEEEECGGGHHHHHHHHHTTTCCCSEEEEEEEESSCEECCCHHHHHHHHHHHHHHHTSTTEEEEEECEECCSCC
T ss_pred             CCCCCCCCEECCHHHHHHHHHHHHHCCCCHHHCCEEEECCCCEECCCHHHHHHHHHHHHHHHCCCCCCCEEECCCCCHHH
T ss_conf             02555541011678889999889863887100220584378341587999999999999864422700154768549888


Q ss_pred             C
Q ss_conf             9
Q gi|254780660|r  244 I  244 (244)
Q Consensus       244 l  244 (244)
                      |
T Consensus       241 l  241 (243)
T d1lfpa_         241 L  241 (243)
T ss_dssp             S
T ss_pred             H
T ss_conf             6


No 3  
>d1mw7a_ e.39.1.1 (A:) Hypothetical protein HP0162 {Helicobacter pylori [TaxId: 210]}
Probab=100.00  E-value=0  Score=532.07  Aligned_cols=214  Identities=34%  Similarity=0.458  Sum_probs=202.9

Q ss_pred             HHHHHHHHHHHHHHHHCCCCHHHCHHHHHHHHHHHHCCCCHHHHHHHHHHHCCCCCCCCCEEEEEEECCCCEEEEEEEEC
Q ss_conf             79999999999999818999414899999999999668887899999985037766664023678650599399999944
Q gi|254780660|r   23 KIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALT  102 (244)
Q Consensus        23 k~f~k~~keI~~A~k~gG~dp~~N~~L~~ai~~Ak~~~mPk~~Ie~aIkk~~~~~~~~~~~~~yEg~gP~gvaiiVe~lT  102 (244)
                      |+|+||+|+|++|||+|||||++|||||+||++||++||||++||||||||++++ ++|++++|||||||||+|||||||
T Consensus         1 k~f~kl~reI~vAak~GG~Dp~~N~~L~~ai~~Ak~~nmPkd~IerAIkk~~~~~-~~~~e~~YEg~gp~gvaiiVe~lT   79 (220)
T d1mw7a_           1 KVFPKLAKAITLAAKDGGSEPDTNAKLRTAILNAKAQNMPKDNIDAAIKRASSKE-GNLSEITYEGKANFGVLIIMECMT   79 (220)
T ss_dssp             CCHHHHHHHHHHHHHTTCSCGGGCHHHHHHHHHHHHHTCCHHHHHHHHHHTTSTT-CCCEEEEEEEEETTTEEEEEEEEE
T ss_pred             CHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHCCCC-CCCEEEEEEEECCCCEEEEEEEEC
T ss_conf             9268999999999970799966099999999999983799428999997404567-884699999861895599999963


Q ss_pred             CCCHHHHHHHHHHHHHC-CCCCCCCCCCHHHHHHCCEEEECCCC-----CCCHHHHHHHHCCCCCCCCCCCCCEEEEECC
Q ss_conf             63023589989876425-68314788604568644727970677-----5301366775126875223468825999643
Q gi|254780660|r  103 DNRNRTASSIRSIFTKA-NGSLGSTGSTTRFFEQIGEIIYHSNI-----GDSNLAMEVAIESDAFEVLFEDQEYIFYCDF  176 (244)
Q Consensus       103 DN~nRt~~~vr~~f~K~-gG~lg~~Gsv~~~F~~~G~i~~~~~~-----~d~d~~~e~aie~ga~Dv~~~d~~~~i~~~~  176 (244)
                      ||+|||+++||++|+|+ ||+||++|||+|||+|+|+|.+.++.     .++|.+++.+||+||+|++.+++.++|+|+|
T Consensus        80 DN~nRt~~~vr~~f~K~~Gg~lg~~GsV~~~F~~kG~i~~~~~~~~~~~~~~d~~~~~aie~GaeDve~~ed~~~i~t~~  159 (220)
T d1mw7a_          80 DNPTRTIANLKSYFNKTQGASIVPNGSLEFMFNRKSVFECLKNEVENLKLSLEDLEFALIDYGLEELEEVEDKIIIRGDY  159 (220)
T ss_dssp             SCHHHHHHHHHHHHTTSTTCEEECTTTTTTSEEEEEEEEEEHHHHHHTTCCHHHHHHHHGGGTEEEEEEETTEEEEEEEG
T ss_pred             CCHHHHHHHHHHHHHHCCCCCCCCCCCCHHHHEEEEEEEECCCCCCHHHCCHHHHHHHHHHCCCCCCCCCCCCCEEECCH
T ss_conf             83666788899998541245646887515440224556606775321113655666776533521000247751552202


Q ss_pred             CCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCC
Q ss_conf             20134566542025674222178603761024898999999999987523888131102562
Q gi|254780660|r  177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE  238 (244)
Q Consensus       177 ~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~~  238 (244)
                      ++|..|+++|++.++.+.+++++|+|+++|+|++ ++++++.+|+|.|||+||||+||||++
T Consensus       160 ~~~~~v~~aL~~~~~~~~~aei~~~p~~~v~l~~-e~~~~~~kLid~LEd~DDVq~Vy~N~e  220 (220)
T d1mw7a_         160 NSFKLLNEGFESLKLPILKASLQRIATTPIELND-EQMELTEKLLDRIEDDDDVVALYTNIE  220 (220)
T ss_dssp             GGHHHHHHHHHHTTCCCSEEEEEEEESSCBCCCH-HHHHHHHHHHHHHHTSTTEEEEEESBC
T ss_pred             HHHHHHHHHHHHHCCCCCEEEEEEECCCCEECCH-HHHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             3455566777750666312257994488452499-999999999998744058360501789


No 4  
>d1vi7a2 d.58.11.2 (A:138-208) Hypothetical protein YigZ, C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=48.03  E-value=5.9  Score=17.86  Aligned_cols=48  Identities=17%  Similarity=0.272  Sum_probs=32.3

Q ss_pred             CEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCC--CCEECCCHHHHHHHHH
Q ss_conf             25999643201345665420256742221786037--6102489899999999
Q gi|254780660|r  169 EYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPL--NYIRLSNADKVKSIIK  219 (244)
Q Consensus       169 ~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~--~~V~l~d~e~~~~~~k  219 (244)
                      .+.+.|++..+..++..|++.++.+.+.  .|-..  -.+.++. ++.+.+.+
T Consensus         4 ~~~l~~dY~~~~~v~~~L~~~~~~i~~~--~y~~~V~l~v~vp~-~~~~~f~~   53 (71)
T d1vi7a2           4 EYTLQCEYHQLTGIEALLGQCDGKIINS--DYQAFVLLRVALPA-AKVAEFSA   53 (71)
T ss_dssp             EEEEEECTTTHHHHHHHHHHTTCEEEEE--EESSSEEEEEEECS-STHHHHHH
T ss_pred             EEEEEECCCCHHHHHHHHHHCCCEEEEE--EECCEEEEEEEECH-HHHHHHHH
T ss_conf             7999952445799999999879899954--62537999999779-99999999


No 5  
>d2o35a1 a.293.1.1 (A:2-80) Hypothetical protein SMc04008 {Rhizobium meliloti [TaxId: 382]}
Probab=46.70  E-value=4.9  Score=18.43  Aligned_cols=21  Identities=24%  Similarity=0.472  Sum_probs=18.1

Q ss_pred             HHHHHHHHHHHHCCCCCCCCC
Q ss_conf             999999998752388813110
Q gi|254780660|r  214 VKSIIKMIENLEDDDDVQSVY  234 (244)
Q Consensus       214 ~~~~~klie~Led~DDVq~Vy  234 (244)
                      +..+-+|+.-|.+.-|||||-
T Consensus        13 AaaFrrL~~HL~~r~dVQNID   33 (79)
T d2o35a1          13 AAVFRRLLEHLRERSDVQNID   33 (79)
T ss_dssp             HHHHHHHHHHHHHTTTSCHHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHH
T ss_conf             999999999987376420369


No 6  
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]}
Probab=39.28  E-value=10  Score=16.13  Aligned_cols=15  Identities=7%  Similarity=0.215  Sum_probs=7.8

Q ss_pred             HHHHHHHHHHHHHHH
Q ss_conf             899999999998752
Q gi|254780660|r  211 ADKVKSIIKMIENLE  225 (244)
Q Consensus       211 ~e~~~~~~klie~Le  225 (244)
                      ++-.++...+++.|+
T Consensus       208 ~~II~rA~~i~~~l~  222 (224)
T d1ewqa2         208 KEVVARARALLQAMA  222 (224)
T ss_dssp             HHHHHHHHHHHHHHT
T ss_pred             HHHHHHHHHHHHHHH
T ss_conf             999999999999986


No 7  
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]}
Probab=34.89  E-value=13  Score=15.41  Aligned_cols=19  Identities=16%  Similarity=0.251  Sum_probs=11.6

Q ss_pred             CCCHHHHHHHHHHHHHHHCC
Q ss_conf             48989999999999875238
Q gi|254780660|r  208 LSNADKVKSIIKMIENLEDD  227 (244)
Q Consensus       208 l~d~e~~~~~~klie~Led~  227 (244)
                      ++ ++-.++..++++.||..
T Consensus       215 lp-~~ii~~A~~i~~~lE~~  233 (234)
T d1wb9a2         215 VP-KEVIKRARQKLRELESI  233 (234)
T ss_dssp             CC-HHHHHHHHHHHHHHHTC
T ss_pred             CC-HHHHHHHHHHHHHHHCC
T ss_conf             69-99999999999987635


No 8  
>d1i1ga2 d.58.4.2 (A:62-141) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]}
Probab=34.34  E-value=13  Score=15.46  Aligned_cols=67  Identities=10%  Similarity=0.048  Sum_probs=42.4

Q ss_pred             EEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCC---CCEECCCHHHHHHHHHHH-HHHHCCCCCCCCCCCCCCC
Q ss_conf             5999643201345665420256742221786037---610248989999999999-8752388813110256266
Q gi|254780660|r  170 YIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPL---NYIRLSNADKVKSIIKMI-ENLEDDDDVQSVYSNLEIA  240 (244)
Q Consensus       170 ~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~---~~V~l~d~e~~~~~~kli-e~Led~DDVq~VytN~~i~  240 (244)
                      +.+-++|..+..+...|.+.. ++.+.-.+.=+-   -.+...+.   +.+.+|+ +.|..++.|+++.|.+-+.
T Consensus         7 i~i~v~~~~~~~v~~~l~~~p-eV~~~~~vtG~~D~~~~v~~~d~---~~l~~~l~~~i~~~~gV~~~~t~ivl~   77 (80)
T d1i1ga2           7 TGVDTKPEKLFEVAEKLKEYD-FVKELYLSSGDHMIMAVIWAKDG---EDLAEIISNKIGKIEGVTKVCPAIILE   77 (80)
T ss_dssp             EEEEECGGGHHHHHHHHHHST-TEEEECCCSSSSSEEEEEEESSH---HHHHHHHHHTTTTSTTEEEEEEEECSC
T ss_pred             EEEEECCCCHHHHHHHHHCCC-CEEEEEEECCCCCEEEEEEECCH---HHHHHHHHHHHCCCCCEEEEEEEEEEE
T ss_conf             999987175999999987699-98689989799989999997999---999999986641599977999999998


No 9  
>d1qmha1 c.47.2.1 (A:185-279) RNA 3'-terminal phosphate cyclase, RPTC, insert domain {Escherichia coli [TaxId: 562]}
Probab=32.51  E-value=14  Score=15.15  Aligned_cols=46  Identities=24%  Similarity=0.299  Sum_probs=28.6

Q ss_pred             HCCCCHHHHHHHHHHHCCCCC---CCCCEEEEEEECCCCEEEEEEEECCCC
Q ss_conf             668887899999985037766---664023678650599399999944630
Q gi|254780660|r   58 NQSMPKENIERAIKKAGSDDL---GNYTNIRYEGYGPEGVAIIIEALTDNR  105 (244)
Q Consensus        58 ~~~mPk~~Ie~aIkk~~~~~~---~~~~~~~yEg~gP~gvaiiVe~lTDN~  105 (244)
                      ..++|.+.-+|.++.+...-.   .+.++ ..+++|| |.++++.+-|+|.
T Consensus        14 va~LP~~Va~R~~~~a~~~L~~~~~~v~~-~~~~~gp-G~gi~l~a~~e~~   62 (95)
T d1qmha1          14 LAGVPRHVAEREIATLAGSFSLHEQNIHN-LPRDQGP-GNTVSLEVESENI   62 (95)
T ss_dssp             EESSCHHHHHHHHHHHHHHSCCSEEEEEE-ECGGGCS-EEEEEEEEEESSC
T ss_pred             ECCCCHHHHHHHHHHHHHHHCCCCCCEEE-CCCCCCC-CEEEEEEEEECCC
T ss_conf             82699689999999999871867763277-3368899-7389999997783


No 10 
>d2cyya2 d.58.4.2 (A:65-150) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
Probab=25.72  E-value=18  Score=14.35  Aligned_cols=66  Identities=9%  Similarity=0.063  Sum_probs=41.5

Q ss_pred             EEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCC---CCEECCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCC
Q ss_conf             5999643201345665420256742221786037---610248989999999999875238881311025626
Q gi|254780660|r  170 YIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPL---NYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI  239 (244)
Q Consensus       170 ~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~---~~V~l~d~e~~~~~~klie~Led~DDVq~VytN~~i  239 (244)
                      +.+.|++..+..+...|.+.- ++.++...-=+-   -.+...+.   +.+..|++.|...+.|+++-|.+-+
T Consensus         7 i~i~~~~~~~~~v~~~l~~~p-eV~~~~~~tG~~D~~~~v~~~~~---~~l~~~~~~l~~~~gV~~~~T~ivl   75 (86)
T d2cyya2           7 ILVKVKAGKYSEVASNLAKYP-EIVEVYETTGDYDMVVKIRTKNS---EELNNFLDLIGSIPGVEGTHTMIVL   75 (86)
T ss_dssp             EEEEECTTCHHHHHHHHHTCT-TEEEEEECSSSSSEEEEEEESSH---HHHHHHHHHHHTSTTEEEEEEEECC
T ss_pred             EEEEECCCCHHHHHHHHHCCC-CEEEEEEECCCCCEEEEEEECCH---HHHHHHHHHHHCCCCEEEEEEEEEE
T ss_conf             999987899999999997797-86799997489989999998999---9999999998479997179999999


No 11 
>d1t95a2 d.235.1.2 (A:11-86) Hypothetical protein AF0491, N-terminal domain {Archaeon Archaeoglobus fulgidus [TaxId: 2234]}
Probab=23.62  E-value=17  Score=14.51  Aligned_cols=53  Identities=11%  Similarity=0.074  Sum_probs=32.8

Q ss_pred             CCCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEECCCCCEECCCHHHHHHH
Q ss_conf             46882599964320134566542025674222178603761024898999999
Q gi|254780660|r  165 FEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSI  217 (244)
Q Consensus       165 ~~d~~~~i~~~~~~~~~v~~~Le~~~~~~~~sei~~~P~~~V~l~d~e~~~~~  217 (244)
                      .....|+|.|+|....+.++.-+...-++..++-+|.-...-+...++.+++.
T Consensus        10 ~~g~~FEI~vdp~~~~~~r~g~~~~l~dvl~~~~Vf~d~~kG~~As~~~L~~~   62 (76)
T d1t95a2          10 KGGEEFEVLVDPYLARDLKEGKEVNFEDLLAAEEVFKDAKKGERASVDELRKI   62 (76)
T ss_dssp             ETTEEEEEEECHHHHHHHHTTCCCCHHHHBSSSCCEEETTTTEECCHHHHHHH
T ss_pred             ECCEEEEEEECHHHHHHHHCCCCCCHHHHEEEEEEEECCCCCCCCCHHHHHHH
T ss_conf             18917999999789999887996435673565368861666765899999998


No 12 
>d1gh8a_ d.58.12.1 (A:) aEF-1beta {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]}
Probab=21.38  E-value=15  Score=15.04  Aligned_cols=27  Identities=15%  Similarity=0.193  Sum_probs=16.4

Q ss_pred             EECCCHHHHHHHHHHHHHHHCCCCCCCCC
Q ss_conf             02489899999999998752388813110
Q gi|254780660|r  206 IRLSNADKVKSIIKMIENLEDDDDVQSVY  234 (244)
Q Consensus       206 V~l~d~e~~~~~~klie~Led~DDVq~Vy  234 (244)
                      +-+.|.+  -....|.+.+...|+||+|=
T Consensus        55 ~vv~D~~--g~~D~lee~i~~ie~Vqsve   81 (89)
T d1gh8a_          55 VVVGDAE--GGTEAAEESLSGIEGVSNIE   81 (89)
T ss_dssp             EEESSSC--GGGGHHHHHHTTSCSSEEEE
T ss_pred             EEEECCC--CCHHHHHHHHHCCCCCCEEE
T ss_conf             9998188--37689999984558975898


No 13 
>d1lxja_ d.58.48.1 (A:) Hypothetical protein YB1001C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
Probab=20.80  E-value=4.1  Score=19.00  Aligned_cols=38  Identities=8%  Similarity=0.178  Sum_probs=21.3

Q ss_pred             ECCC-CCEECCCHHHHHHHHHHHHHHHCCC---CCCCCCCCCCCCC
Q ss_conf             6037-6102489899999999998752388---8131102562662
Q gi|254780660|r  200 WKPL-NYIRLSNADKVKSIIKMIENLEDDD---DVQSVYSNLEIAD  241 (244)
Q Consensus       200 ~~P~-~~V~l~d~e~~~~~~klie~Led~D---DVq~VytN~~i~e  241 (244)
                      .-|. |.++-+    .+.+..++..+.+.-   ++++||+++.|++
T Consensus        42 ~~pmgT~IEG~----~del~~~v~~~he~~~~~G~~RV~t~iKId~   83 (104)
T d1lxja_          42 LHSAGTTIEGP----WDDVMGLIGEIHEYGHEKGYVRVHTDIRVGT   83 (104)
T ss_dssp             EETTEEEEEEE----HHHHHHHHHHHHHHHHHTTCCEEEEEEEEEC
T ss_pred             ECCCCCEEECC----HHHHHHHHHHHHHHHHHCCCCEEEEEEEEEC
T ss_conf             65885367778----9999999999999999769985999999761


Done!