BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780660|ref|YP_003065073.1| hypothetical protein
CLIBASIA_02735 [Candidatus Liberibacter asiaticus str. psy62]
         (244 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780660|ref|YP_003065073.1| hypothetical protein CLIBASIA_02735 [Candidatus Liberibacter
           asiaticus str. psy62]
 gi|254040337|gb|ACT57133.1| hypothetical protein CLIBASIA_02735 [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 244

 Score =  497 bits (1280), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 244/244 (100%), Positives = 244/244 (100%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS
Sbjct: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN
Sbjct: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG
Sbjct: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
           LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA
Sbjct: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240

Query: 241 DDII 244
           DDII
Sbjct: 241 DDII 244


>gi|315122156|ref|YP_004062645.1| hypothetical protein CKC_02030 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495558|gb|ADR52157.1| hypothetical protein CKC_02030 [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 249

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 195/244 (79%), Positives = 222/244 (90%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRKERKDA++SKIFSKLSREITVSAKLSG NPLENPRLRLAIQNAK+QS
Sbjct: 1   MAGHSQFKNIMHRKERKDAMRSKIFSKLSREITVSAKLSGPNPLENPRLRLAIQNAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENIERAIKKAG++DL NYTNIRYEGYGPEG+AIIIE LTDNRNRTAS+IR+IFTKAN
Sbjct: 61  MPKENIERAIKKAGNNDLNNYTNIRYEGYGPEGIAIIIETLTDNRNRTASNIRAIFTKAN 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG+ GSTTRFFEQIGEIIYHS +GD + AME AIE  A E L ED+EYIF+CDF+NVG
Sbjct: 121 GSLGAIGSTTRFFEQIGEIIYHSTVGDPDTAMEAAIEVGANEFLDEDKEYIFHCDFSNVG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK+LE+K GEA+SIK+IWKPLN I++S+ +K KSIIKMI+N E+D+DVQ VYSNL+I 
Sbjct: 181 QISKQLEQKFGEAKSIKIIWKPLNLIQISDENKAKSIIKMIDNFENDEDVQDVYSNLDIP 240

Query: 241 DDII 244
           DDI+
Sbjct: 241 DDIM 244


>gi|150397839|ref|YP_001328306.1| hypothetical protein Smed_2641 [Sinorhizobium medicae WSM419]
 gi|166228418|sp|A6UCU1|Y2641_SINMW RecName: Full=UPF0082 protein Smed_2641
 gi|150029354|gb|ABR61471.1| protein of unknown function DUF28 [Sinorhizobium medicae WSM419]
          Length = 248

 Score =  308 bits (790), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 193/244 (79%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPAMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERA+KKA   D   Y  +RYEGYGP GVA+I+EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIERAVKKAAGGDAETYEEVRYEGYGPAGVAVIVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI Y  ++GD++  ME AIE+ A +V  +++ +   C F ++G
Sbjct: 121 GALGETGSVSFSFDRVGEITYKLSVGDADTVMEAAIEAGADDVETDEEGHTITCGFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+++K +WKP N + + + +K +S++K+I+NLEDDDDVQ+VYSN E++
Sbjct: 181 EVSKALEGALGEAETVKAVWKPQNTVPV-DEEKAQSLMKLIDNLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|15966506|ref|NP_386859.1| hypothetical protein SMc03969 [Sinorhizobium meliloti 1021]
 gi|307300457|ref|ZP_07580237.1| protein of unknown function DUF28 [Sinorhizobium meliloti BL225C]
 gi|307318322|ref|ZP_07597757.1| protein of unknown function DUF28 [Sinorhizobium meliloti AK83]
 gi|33517136|sp|Q92M88|Y2753_RHIME RecName: Full=UPF0082 protein R02753
 gi|15075777|emb|CAC47332.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021]
 gi|306896004|gb|EFN26755.1| protein of unknown function DUF28 [Sinorhizobium meliloti AK83]
 gi|306904623|gb|EFN35207.1| protein of unknown function DUF28 [Sinorhizobium meliloti BL225C]
          Length = 248

 Score =  308 bits (789), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 192/244 (78%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKTGLPDPTMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERA+KKA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS++RS FTKA 
Sbjct: 61  MPKDNIERAVKKAAGGDAENYEEVRYEGYGPGGVAVIVEALTDNRNRTASNVRSTFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI Y  + GD++  ME AIE+ A +V  +++ +   C F ++G
Sbjct: 121 GALGETGSVSFSFDRVGEITYKLSAGDADKVMEAAIEAGADDVETDEEGHTITCGFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+++K +WKP N + + + +K +S++K+I+NLEDDDDVQ+VYSN E++
Sbjct: 181 EVSKALEGALGEAETVKAVWKPQNTVPV-DEEKAQSLMKLIDNLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVL 243


>gi|227823323|ref|YP_002827295.1| hypothetical protein NGR_c27950 [Sinorhizobium fredii NGR234]
 gi|254801469|sp|C3MIH9|Y2795_RHISN RecName: Full=UPF0082 protein NGR_c27950
 gi|227342324|gb|ACP26542.1| UPF0082 protein [Sinorhizobium fredii NGR234]
          Length = 248

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 143/244 (58%), Positives = 191/244 (78%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGMPDPAMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERA+KKA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS++RS+FTKA 
Sbjct: 61  MPKDNIERAVKKAAGGDAENYEEVRYEGYGPGGVAVIVEALTDNRNRTASNVRSMFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI Y  + GD++  ME AIES A +V  ++  +   C F  +G
Sbjct: 121 GALGETGSVSFSFDRVGEITYTLSAGDADKVMEAAIESGADDVTTDEDGHTILCGFEEIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+++K IWKP N + + + +K +S++K+I+NLEDDDDVQ+VYSN E++
Sbjct: 181 DVSKALEGVLGEAETVKAIWKPQNTVPV-DEEKAQSLMKLIDNLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|163758808|ref|ZP_02165895.1| hypothetical protein HPDFL43_15332 [Hoeflea phototrophica DFL-43]
 gi|162284098|gb|EDQ34382.1| hypothetical protein HPDFL43_15332 [Hoeflea phototrophica DFL-43]
          Length = 248

 Score =  305 bits (781), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK+   +P  NPRLRLAIQNAK+QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKMGAPDPAMNPRLRLAIQNAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIQRAVNKASGGDSENYEEVRYEGYGPGGVAVIVEALTDNRNRTASTVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F+++GEIIY    GD++  ME AI + A +V   + E++  C F ++G
Sbjct: 121 GALGETGSVGFMFDRVGEIIYAPEAGDADAIMEAAIMAGAEDVTSSEDEHVIICAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LEE +GEAQSIK IWKP     + + DK +S++K+I  L+DDDDVQ+VY+N E++
Sbjct: 181 EVSNALEEALGEAQSIKAIWKPQTSAPV-DEDKAQSVLKLIATLDDDDDVQNVYANFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|239832805|ref|ZP_04681134.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
 gi|239825072|gb|EEQ96640.1| conserved hypothetical protein [Ochrobactrum intermedium LMG 3301]
          Length = 248

 Score =  303 bits (776), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 191/244 (78%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLGREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEIIY S++GD++  ME AIE+ A +V   ++E++  C F ++G
Sbjct: 121 GALGETGSVSFMFDRVGEIIYKSSVGDADKVMEAAIEAGADDVQSGEEEHVIICAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 181 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLNVLEDDDDVQNVYTNFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|153008531|ref|YP_001369746.1| hypothetical protein Oant_1200 [Ochrobactrum anthropi ATCC 49188]
 gi|166228915|sp|A6WY63|Y1200_OCHA4 RecName: Full=UPF0082 protein Oant_1200
 gi|151560419|gb|ABS13917.1| protein of unknown function DUF28 [Ochrobactrum anthropi ATCC
           49188]
          Length = 248

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 191/244 (78%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLGREITVAAKQGLPDPTMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI+Y S++GD++  ME AIE+ A +V   ++E++  C F ++G
Sbjct: 121 GALGETGSVSFMFDRVGEIVYKSSVGDADKVMEAAIEAGADDVQSGEEEHVIICAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 181 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLNVLEDDDDVQNVYTNFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|222149669|ref|YP_002550626.1| hypothetical protein Avi_3631 [Agrobacterium vitis S4]
 gi|254765087|sp|B9JRY6|Y3631_AGRVS RecName: Full=UPF0082 protein Avi_3631
 gi|221736651|gb|ACM37614.1| conserved hypothetical protein [Agrobacterium vitis S4]
          Length = 248

 Score =  299 bits (765), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 139/244 (56%), Positives = 190/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++D+++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGKQDSVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERA+KKA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS++RS F+KA 
Sbjct: 61  MPKDNIERAVKKASGVDGENYEEVRYEGYGPGGVAVIVEALTDNRNRTASNVRSTFSKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI Y +++GD++  ME AIE+ A +V  ++  +   C F ++ 
Sbjct: 121 GALGETGSVSFSFDKVGEITYKASVGDADAVMEAAIEAGAEDVTSDEDGHTIICGFEDMN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+S+K IWKP N + + + DK +S++K+IE LEDDDDVQ+VYSN E++
Sbjct: 181 EVSKALEATLGEAESVKAIWKPQNTVPV-DEDKAQSLMKLIETLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVM 243


>gi|260167930|ref|ZP_05754741.1| hypothetical protein BruF5_06092 [Brucella sp. F5/99]
 gi|261757369|ref|ZP_06001078.1| conserved hypothetical protein [Brucella sp. F5/99]
 gi|261737353|gb|EEY25349.1| conserved hypothetical protein [Brucella sp. F5/99]
          Length = 248

 Score =  298 bits (764), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEIIY    GD++  ME AIE+ A +V   +  ++  C F ++G
Sbjct: 121 GSLGETGSVSFMFDRVGEIIYKPEAGDADKVMEAAIEAGAEDVQSGEDGHVILCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 181 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|121602842|ref|YP_988501.1| hypothetical protein BARBAKC583_0163 [Bartonella bacilliformis
           KC583]
 gi|166231438|sp|A1UR98|Y163_BARBK RecName: Full=UPF0082 protein BARBAKC583_0163
 gi|120615019|gb|ABM45620.1| conserved hypothetical protein [Bartonella bacilliformis KC583]
          Length = 248

 Score =  298 bits (764), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 184/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLA+QNAK+QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKVFSKLAREITVAAKQGSPDPAMNPRLRLAVQNAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVAII+EALTDNRNRTAS++R+ FTKA 
Sbjct: 61  MPKDNIERAIKKASGGDVENYDEVRYEGYGPGGVAIIVEALTDNRNRTASNVRAAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F +IGEIIY    G +   ME AIE+ A +V  E+  +   C F ++G
Sbjct: 121 GALGETGSVGFMFNRIGEIIYKPEAGTAESVMEAAIEAGAEDVQSEETGHHITCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     + + +K  SI+++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKMLEATLGEAESIKTIWKPTTLAPV-DEEKAMSILRLISTLEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVL 243


>gi|17982216|gb|AAL51502.1| hypothetical cytosolic protein [Brucella melitensis bv. 1 str. 16M]
          Length = 255

 Score =  298 bits (763), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 8   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 67

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 68  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 127

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEI+Y    GD++  ME AIE+ A +V   +  ++  C F ++G
Sbjct: 128 GSLGETGSVSFMFDRVGEIVYKPEAGDADKVMEAAIEAGAEDVQSGEDGHVILCAFEDIG 187

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 188 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVS 246

Query: 241 DDII 244
           D+++
Sbjct: 247 DEVM 250


>gi|332716457|ref|YP_004443923.1| hypothetical protein AGROH133_12039 [Agrobacterium sp. H13-3]
 gi|325063142|gb|ADY66832.1| hypothetical protein AGROH133_12039 [Agrobacterium sp. H13-3]
          Length = 248

 Score =  298 bits (762), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 189/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++D+++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGKQDSVRSKMFSKLAREITVAAKAGMPDPNMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGYGP GVA+++EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIERAIKKASGADSENYDEVRYEGYGPGGVAVVVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI Y + +GD++  ME AIE+ A +V   +  +   C F  + 
Sbjct: 121 GALGETGSVSFSFDRVGEITYKAEVGDADKVMEAAIEAGADDVESSEDGHTIICGFEAMN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+S+K IWKP N + + + +K +S++K+I+NLEDDDDVQSVYSN E++
Sbjct: 181 EVSKALEGVLGEAESVKAIWKPQNTVPV-DEEKAQSLMKLIDNLEDDDDVQSVYSNFEVS 239

Query: 241 DDII 244
           ++I+
Sbjct: 240 EEIL 243


>gi|225628286|ref|ZP_03786320.1| conserved hypothetical protein [Brucella ceti str. Cudo]
 gi|225616132|gb|EEH13180.1| conserved hypothetical protein [Brucella ceti str. Cudo]
          Length = 265

 Score =  298 bits (762), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 18  MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 77

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 78  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 137

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEIIY    GD++  ME AIE+ A +V   +  ++  C F ++G
Sbjct: 138 GSLGETGSVSFMFDRVGEIIYKPEAGDADKVMEAAIEAGAEDVQSGEDGHVILCAFEDIG 197

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 198 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVS 256

Query: 241 DDII 244
           D+++
Sbjct: 257 DEVM 260


>gi|23502575|ref|NP_698702.1| hypothetical protein BR1717 [Brucella suis 1330]
 gi|62290589|ref|YP_222382.1| hypothetical protein BruAb1_1702 [Brucella abortus bv. 1 str.
           9-941]
 gi|82700505|ref|YP_415079.1| hypothetical protein BAB1_1729 [Brucella melitensis biovar Abortus
           2308]
 gi|148558985|ref|YP_001259569.1| hypothetical protein BOV_1660 [Brucella ovis ATCC 25840]
 gi|161511160|ref|NP_539238.2| hypothetical protein BMEI0321 [Brucella melitensis bv. 1 str. 16M]
 gi|161619645|ref|YP_001593532.1| hypothetical protein BCAN_A1755 [Brucella canis ATCC 23365]
 gi|163845296|ref|YP_001622951.1| hypothetical protein BSUIS_B1192 [Brucella suis ATCC 23445]
 gi|189024806|ref|YP_001935574.1| hypothetical protein BAbS19_I16160 [Brucella abortus S19]
 gi|225853172|ref|YP_002733405.1| hypothetical protein BMEA_A1769 [Brucella melitensis ATCC 23457]
 gi|254689884|ref|ZP_05153138.1| hypothetical protein Babob68_06894 [Brucella abortus bv. 6 str.
           870]
 gi|254694376|ref|ZP_05156204.1| hypothetical protein Babob3T_06897 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254698034|ref|ZP_05159862.1| hypothetical protein Babob28_10083 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700376|ref|ZP_05162204.1| hypothetical protein Bsuib55_05899 [Brucella suis bv. 5 str. 513]
 gi|254703494|ref|ZP_05165322.1| hypothetical protein Bsuib36_06134 [Brucella suis bv. 3 str. 686]
 gi|254708417|ref|ZP_05170245.1| hypothetical protein BpinM_16060 [Brucella pinnipedialis
           M163/99/10]
 gi|254708730|ref|ZP_05170541.1| hypothetical protein BpinB_00426 [Brucella pinnipedialis B2/94]
 gi|254714575|ref|ZP_05176386.1| hypothetical protein BcetM6_14802 [Brucella ceti M644/93/1]
 gi|254717472|ref|ZP_05179283.1| hypothetical protein BcetM_13926 [Brucella ceti M13/05/1]
 gi|254719718|ref|ZP_05181529.1| hypothetical protein Bru83_09273 [Brucella sp. 83/13]
 gi|254730918|ref|ZP_05189496.1| hypothetical protein Babob42_06922 [Brucella abortus bv. 4 str.
           292]
 gi|256030255|ref|ZP_05443869.1| hypothetical protein BpinM2_06341 [Brucella pinnipedialis
           M292/94/1]
 gi|256045325|ref|ZP_05448219.1| hypothetical protein Bmelb1R_12597 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061754|ref|ZP_05451889.1| hypothetical protein Bneo5_15533 [Brucella neotomae 5K33]
 gi|256114283|ref|ZP_05455028.1| hypothetical protein Bmelb3E_15818 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256160430|ref|ZP_05458119.1| hypothetical protein BcetM4_15589 [Brucella ceti M490/95/1]
 gi|256255636|ref|ZP_05461172.1| hypothetical protein BcetB_15408 [Brucella ceti B1/94]
 gi|256258137|ref|ZP_05463673.1| hypothetical protein Babob9C_12491 [Brucella abortus bv. 9 str.
           C68]
 gi|256263338|ref|ZP_05465870.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|260547169|ref|ZP_05822907.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260565783|ref|ZP_05836266.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260568800|ref|ZP_05839268.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260755416|ref|ZP_05867764.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260758638|ref|ZP_05870986.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260762470|ref|ZP_05874807.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260884431|ref|ZP_05896045.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|261214686|ref|ZP_05928967.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|261219305|ref|ZP_05933586.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261222839|ref|ZP_05937120.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|261315916|ref|ZP_05955113.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261316222|ref|ZP_05955419.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261322366|ref|ZP_05961563.1| hypothetical protein BAIG_02940 [Brucella ceti M644/93/1]
 gi|261325756|ref|ZP_05964953.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261750872|ref|ZP_05994581.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261754125|ref|ZP_05997834.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|265984733|ref|ZP_06097468.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|265987283|ref|ZP_06099840.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|265991750|ref|ZP_06104307.1| hypothetical protein BAMG_03049 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995588|ref|ZP_06108145.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|265998798|ref|ZP_06111355.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|306839911|ref|ZP_07472707.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|306841437|ref|ZP_07474138.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306844708|ref|ZP_07477293.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|54040269|sp|P67174|Y1717_BRUSU RecName: Full=UPF0082 protein BR1717
 gi|54042646|sp|P67173|Y321_BRUME RecName: Full=UPF0082 protein BMEI0321
 gi|75496331|sp|Q57BG3|Y1702_BRUAB RecName: Full=UPF0082 protein BruAb1_1702
 gi|119391283|sp|Q2YRF2|Y1729_BRUA2 RecName: Full=UPF0082 protein BAB1_1729
 gi|166234699|sp|A5VS72|Y1660_BRUO2 RecName: Full=UPF0082 protein BOV_1660
 gi|189039000|sp|A9M7L4|Y1755_BRUC2 RecName: Full=UPF0082 protein BCAN_A1755
 gi|189040292|sp|A9WWJ3|Y3692_BRUSI RecName: Full=UPF0082 protein BSUIS_B1192
 gi|254800621|sp|C0REX9|Y1769_BRUMB RecName: Full=UPF0082 protein BMEA_A1769
 gi|23348577|gb|AAN30617.1| conserved hypothetical protein TIGR01033 [Brucella suis 1330]
 gi|62196721|gb|AAX75021.1| conserved hypothetical protein TIGR01033 [Brucella abortus bv. 1
           str. 9-941]
 gi|82616606|emb|CAJ11685.1| Protein of unknown function DUF28 [Brucella melitensis biovar
           Abortus 2308]
 gi|148370242|gb|ABQ60221.1| conserved hypothetical protein TIGR01033 [Brucella ovis ATCC 25840]
 gi|161336456|gb|ABX62761.1| conserved hypothetical protein [Brucella canis ATCC 23365]
 gi|163676019|gb|ABY40129.1| conserved hypothetical protein [Brucella suis ATCC 23445]
 gi|189020378|gb|ACD73100.1| Protein of unknown function DUF28 [Brucella abortus S19]
 gi|225641537|gb|ACO01451.1| conserved hypothetical protein [Brucella melitensis ATCC 23457]
 gi|260095534|gb|EEW79412.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260151156|gb|EEW86251.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|260154184|gb|EEW89266.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|260668956|gb|EEX55896.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292]
 gi|260672896|gb|EEX59717.1| conserved hypothetical protein [Brucella abortus bv. 2 str.
           86/8/59]
 gi|260675524|gb|EEX62345.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870]
 gi|260873959|gb|EEX81028.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68]
 gi|260916293|gb|EEX83154.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya]
 gi|260921423|gb|EEX88076.1| conserved hypothetical protein [Brucella ceti B1/94]
 gi|260924394|gb|EEX90962.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gi|261295056|gb|EEX98552.1| hypothetical protein BAIG_02940 [Brucella ceti M644/93/1]
 gi|261295445|gb|EEX98941.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gi|261301736|gb|EEY05233.1| conserved hypothetical protein [Brucella neotomae 5K33]
 gi|261304942|gb|EEY08439.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gi|261740625|gb|EEY28551.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513]
 gi|261743878|gb|EEY31804.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686]
 gi|262553487|gb|EEZ09256.1| conserved hypothetical protein [Brucella ceti M490/95/1]
 gi|262766872|gb|EEZ12490.1| conserved hypothetical protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002706|gb|EEZ15109.1| hypothetical protein BAMG_03049 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093337|gb|EEZ17406.1| conserved hypothetical protein [Brucella melitensis bv. 2 str.
           63/9]
 gi|264659480|gb|EEZ29741.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1]
 gi|264663325|gb|EEZ33586.1| conserved hypothetical protein [Brucella sp. 83/13]
 gi|306274880|gb|EFM56650.1| conserved hypothetical protein [Brucella sp. BO1]
 gi|306288475|gb|EFM59830.1| conserved hypothetical protein [Brucella sp. BO2]
 gi|306404978|gb|EFM61261.1| conserved hypothetical protein [Brucella sp. NF 2653]
 gi|326409728|gb|ADZ66793.1| conserved hypothetical protein [Brucella melitensis M28]
 gi|326539438|gb|ADZ87653.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 248

 Score =  298 bits (762), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEI+Y    GD++  ME AIE+ A +V   +  ++  C F ++G
Sbjct: 121 GSLGETGSVSFMFDRVGEIVYKPEAGDADKVMEAAIEAGAEDVQSGEDGHVILCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 181 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|319409317|emb|CBI82961.1| conserved hypothetical protein [Bartonella schoenbuchensis R1]
          Length = 257

 Score =  298 bits (762), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 143/244 (58%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK+QS
Sbjct: 10  MAGHSQFKNIMHRKGRQDAIRSKMFSKLAREITVAAKQGAPDPAMNPRLRLAIQNAKSQS 69

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVAII+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 70  MPKDNIERAIKKASGGDVENYDEVRYEGYGPGGVAIIVEALTDNRNRTASNVRAAFTKSG 129

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F +IGEIIY+   G  +  ME AIE+ A +V  E+  +   C F N+G
Sbjct: 130 GALGETGSVSFMFNRIGEIIYNLEAGTPDTIMEAAIEAGAEDVQTEETGHHILCAFENIG 189

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEAQSIK +WK      + + +K  SI++++  LEDDDDVQ+VY+N +++
Sbjct: 190 EVSKMLEATLGEAQSIKTVWKATTLAPV-DEEKALSILRLLTTLEDDDDVQNVYANFDVS 248

Query: 241 DDII 244
           D+I+
Sbjct: 249 DEIL 252


>gi|237816093|ref|ZP_04595089.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297248987|ref|ZP_06932695.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
 gi|237788756|gb|EEP62968.1| conserved hypothetical protein [Brucella abortus str. 2308 A]
 gi|297174120|gb|EFH33477.1| conserved hypothetical protein [Brucella abortus bv. 5 str. B3196]
          Length = 265

 Score =  298 bits (762), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 18  MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 77

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 78  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 137

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEI+Y    GD++  ME AIE+ A +V   +  ++  C F ++G
Sbjct: 138 GSLGETGSVSFMFDRVGEIVYKPEAGDADKVMEAAIEAGAEDVQSGEDGHVILCAFEDIG 197

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 198 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVS 256

Query: 241 DDII 244
           D+++
Sbjct: 257 DEVM 260


>gi|256370124|ref|YP_003107635.1| hypothetical protein BMI_I1736 [Brucella microti CCM 4915]
 gi|256000287|gb|ACU48686.1| hypothetical protein BMI_I1736 [Brucella microti CCM 4915]
          Length = 248

 Score =  297 bits (761), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEI+Y    GD++  ME AIE+ A +V   +  ++  C F ++G
Sbjct: 121 GSLGETGSVSFMFDRVGEIVYKPEAGDADNVMEAAIEAGAEDVQSGEDGHVILCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++
Sbjct: 181 EVSKALEAALGEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|15891221|ref|NP_356893.1| hypothetical protein Atu3727 [Agrobacterium tumefaciens str. C58]
 gi|33517060|sp|Q8U9K1|Y3727_AGRT5 RecName: Full=UPF0082 protein Atu3727
 gi|15159582|gb|AAK89678.1| conserved hypothetical protein [Agrobacterium tumefaciens str. C58]
          Length = 248

 Score =  296 bits (758), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 189/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++D+++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGKQDSVRSKMFSKLAREITVAAKTGMPDPNMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGYGP GVA+++EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIERAIKKASGADSENYDEVRYEGYGPGGVAVVVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI Y + +GD++  ME AIE+ A +V   +  +   C F  + 
Sbjct: 121 GALGETGSVSFSFDRVGEITYKAEVGDADKVMEAAIEAGADDVESSEDGHTIICGFEAMN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+S+K IWKP N + + + +K +S++K+I+NLEDDDDVQ+VYSN E++
Sbjct: 181 EVSKALEGVLGEAESVKAIWKPQNTVPV-DEEKAQSLMKLIDNLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++I+
Sbjct: 240 EEIL 243


>gi|49474670|ref|YP_032712.1| hypothetical protein BQ11790 [Bartonella quintana str. Toulouse]
 gi|67462041|sp|Q6FYQ2|Y1179_BARQU RecName: Full=UPF0082 protein BQ11790
 gi|49240174|emb|CAF26638.1| hypothetical protein BQ11790 [Bartonella quintana str. Toulouse]
          Length = 248

 Score =  295 bits (756), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 186/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGAPDPAMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D+ +Y  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGNDVEHYDEVRYEGYGPGGVAVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F +IGEIIY    G ++  M+ AIE+ A +V  E+  +   C F N+G
Sbjct: 121 GALGETGSVSFMFHRIGEIIYKPAAGTADSIMDAAIEAGAEDVQSEETGHSITCAFENLG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE K+GEA+SIK +WK      + + +K  SI+++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKMLEAKLGEAESIKTVWKATTLAPV-DEEKALSILRLISTLEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+I+
Sbjct: 240 DEIL 243


>gi|319899365|ref|YP_004159462.1| hypothetical protein BARCL_1220 [Bartonella clarridgeiae 73]
 gi|319403333|emb|CBI76892.1| conserved protein of unknown function [Bartonella clarridgeiae 73]
          Length = 248

 Score =  295 bits (756), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 186/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGSPDPTMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGGDVENYDEVRYEGYGPGGVAVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F +IGEIIY S  G  +  M+ AIE+ A +V  E+  +  +C F ++G
Sbjct: 121 GALGETGSVSFMFNRIGEIIYKSEAGTPDTIMDAAIEAGAEDVQSEEMGHHIFCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWK +    + + +K  S++++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKILETTLGEAESIKTIWKAITLAPI-DEEKALSVLRLIATLEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+I+
Sbjct: 240 DEIL 243


>gi|163869127|ref|YP_001610366.1| hypothetical protein Btr_2363 [Bartonella tribocorum CIP 105476]
 gi|189039731|sp|A9IYI8|Y2363_BART1 RecName: Full=UPF0082 protein BT_2363
 gi|161018813|emb|CAK02371.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476]
          Length = 248

 Score =  295 bits (754), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKIFSKLAREITVAAKQGAPDPAMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGTDVENYDEVRYEGYGPGGVAVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F +IGEIIY    G ++  M+ AIE+ A +V  E+  +   C F ++G
Sbjct: 121 GALGETGSVSFMFNRIGEIIYKPEAGTADHIMDAAIEAGAEDVQSEESGHHITCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE K+GEA+SIK IWK      + + +K  S++++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKTLESKLGEAESIKTIWKATTLAPI-DEEKALSVLRLISTLEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+I+
Sbjct: 240 DEIL 243


>gi|209550790|ref|YP_002282707.1| hypothetical protein Rleg2_3214 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|226703757|sp|B5ZP73|Y3214_RHILW RecName: Full=UPF0082 protein Rleg2_3214
 gi|209536546|gb|ACI56481.1| protein of unknown function DUF28 [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 248

 Score =  294 bits (753), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 190/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P+ N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPMMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIDRAIKKAAGADGENYDEVRYEGYGPGGTAIIVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y  ++GD++  ME AIE+ A +V  +++ +   C F  +G
Sbjct: 121 GALGETGSVSFSFDHVGEITYKLSVGDADKVMEAAIEAGADDVETDEEGHYITCAFEALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+++K +W+  N + + + +K +S++K+I++LEDDDDVQ+VYSN E++
Sbjct: 181 EVSKALESGLGEAETVKAVWRAQNNVPV-DEEKAQSLMKLIDSLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|110635521|ref|YP_675729.1| hypothetical protein Meso_3192 [Mesorhizobium sp. BNC1]
 gi|118574342|sp|Q11DG1|Y3192_MESSB RecName: Full=UPF0082 protein Meso_3192
 gi|110286505|gb|ABG64564.1| protein of unknown function DUF28 [Chelativorans sp. BNC1]
          Length = 249

 Score =  294 bits (753), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 185/241 (76%), Gaps = 1/241 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA+KSK+FSKL+REITV+AK    +P  NPRLRLA+QNA+ QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVKSKMFSKLAREITVAAKAGLPDPAMNPRLRLAVQNARAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D   Y  IRYEGY P GVA+I+EALTDNRNRTAS++R+ FTKA 
Sbjct: 61  MPKDNIERAIKKAQGNDAETYEEIRYEGYAPGGVAVIVEALTDNRNRTASNVRAAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GEI+Y ++ GD++  ME AIE+ A +V  ++  ++  C F ++G
Sbjct: 121 GALGETGSVSFMFDRVGEIVYPASAGDADKVMEAAIEAGAEDVQSDENGHVIICAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LEE +GEA+S+K +W+P     + + ++ +SI+K+I  LEDDDDVQ+VY+N E+ 
Sbjct: 181 EVTSALEEALGEAESVKTVWRPQTSTPV-DEERAQSILKLIAVLEDDDDVQNVYANFEVD 239

Query: 241 D 241
           D
Sbjct: 240 D 240


>gi|49476139|ref|YP_034180.1| hypothetical protein BH14810 [Bartonella henselae str. Houston-1]
 gi|67462042|sp|Q6G5P2|Y1481_BARHE RecName: Full=UPF0082 protein BH14810
 gi|49238947|emb|CAF28244.1| hypothetical protein BH14810 [Bartonella henselae str. Houston-1]
          Length = 248

 Score =  294 bits (752), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 141/244 (57%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGSPDPAMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVA+I+EALTDNRNRTAS+IR+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGSDVENYDEVRYEGYGPGGVAVIVEALTDNRNRTASNIRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F +IGEIIY    G ++  M+ AIE+ A +V  E+  +   C F ++G
Sbjct: 121 GALGETGSVSFMFNRIGEIIYKPEAGTTDNIMDAAIEAGAEDVQSEETGHHIICTFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE K+GEA+SIK +WK      + + +K  SI+++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKMLEAKLGEAESIKTVWKATTLTPV-DEEKALSILRLISTLEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+I+
Sbjct: 240 DEIL 243


>gi|190893288|ref|YP_001979830.1| hypothetical protein RHECIAT_CH0003714 [Rhizobium etli CIAT 652]
 gi|226705838|sp|B3PYY8|Y3714_RHIE6 RecName: Full=UPF0082 protein RHECIAT_CH0003714
 gi|190698567|gb|ACE92652.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 248

 Score =  293 bits (749), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 189/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIDRAIKKAAGADGENYDEVRYEGYGPGGTAIIVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y  ++GD++  ME AIE+ A +V  +++ +   C F  +G
Sbjct: 121 GALGETGSVSFSFDHVGEITYKLSVGDADKVMEAAIEAGADDVETDEEGHYITCAFEALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+++K +W+  N + + + +K +S++K+I++LEDDDDVQ+VYSN E++
Sbjct: 181 DVSKALESGLGEAETVKAVWRAQNNVPV-DEEKAQSLMKLIDSLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|13473370|ref|NP_104937.1| hypothetical protein mll3945 [Mesorhizobium loti MAFF303099]
 gi|33517090|sp|Q98F44|Y3945_RHILO RecName: Full=UPF0082 protein mll3945
 gi|14024119|dbj|BAB50723.1| mll3945 [Mesorhizobium loti MAFF303099]
          Length = 249

 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 188/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK  S
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGTPDPSMNPRLRLAIQNAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D  NY  +RYEGYGP GVA+I+EALTDNRNR+AS++R+ FTKA 
Sbjct: 61  MPKDNIQRAINKASMGDAENYEAVRYEGYGPGGVAVIVEALTDNRNRSASNVRAAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G++G TGS +  ++++GEI Y ++ G ++  ME AIE+ A +V  +++ +  YC F N+G
Sbjct: 121 GAMGETGSVSFMWDRVGEIYYPASAGSADKVMEAAIEAGADDVESDEEGHTIYCAFENLG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+S+K+IW+P N + + + ++ +S++K++  LEDDDDVQSVY+N E+ 
Sbjct: 181 EVSKALEAALGEAESVKLIWRPQNNVPV-DEERAQSLMKLVATLEDDDDVQSVYANFEVD 239

Query: 241 DDII 244
           D+ +
Sbjct: 240 DETL 243


>gi|319780992|ref|YP_004140468.1| hypothetical protein Mesci_1257 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
 gi|317166880|gb|ADV10418.1| protein of unknown function DUF28 [Mesorhizobium ciceri biovar
           biserrulae WSM1271]
          Length = 249

 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 134/244 (54%), Positives = 188/244 (77%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK  S
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGTPDPSMNPRLRLAIQNAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   D  NY  +RYEGYGP GVA+I+EALTDNRNR+AS++R+ FTKA 
Sbjct: 61  MPKDNIQRAVNKASMGDAENYEAVRYEGYGPGGVAVIVEALTDNRNRSASNVRAAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G++G TGS +  ++++GEI Y ++ G ++  ME AIE+ A +V  +++ +  YC F N+G
Sbjct: 121 GAMGETGSVSFMWDRVGEIYYPASAGSADKVMEAAIEAGADDVETDEEGHTIYCAFENLG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+S+K+IW+P N + + + ++ +S++K++  LEDDDDVQSVY+N E+ 
Sbjct: 181 EVSKALETSLGEAESVKLIWRPQNNVPV-DEERAQSLMKLVATLEDDDDVQSVYANFEVD 239

Query: 241 DDII 244
           D+ +
Sbjct: 240 DETM 243


>gi|240851218|ref|YP_002972621.1| hypothetical protein Bgr_18220 [Bartonella grahamii as4aup]
 gi|240268341|gb|ACS51929.1| hypothetical protein Bgr_18220 [Bartonella grahamii as4aup]
          Length = 248

 Score =  292 bits (748), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGAPDPAMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGTDVENYDEVRYEGYGPGGVAVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F +IGEIIY    G ++  M+ AIE+ A +V  E+  +   C F ++G
Sbjct: 121 GALGETGSVSFMFNRIGEIIYKPEAGTADNIMDAAIEAGAEDVQSEETGHHITCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE K+GEA+SIK IWK      + + +K  S++++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKTLEAKLGEAESIKTIWKATTLAPI-DEEKALSVLRLISILEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+I+
Sbjct: 240 DEIL 243


>gi|319406246|emb|CBI79883.1| conserved hypothetical protein [Bartonella sp. AR 15-3]
          Length = 248

 Score =  291 bits (745), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 183/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGSPDPTMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGGDAENYDEVRYEGYGPGGVAVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F +IGEIIY    G ++  ME AIE+ A +V  E+  +  +C F ++G
Sbjct: 121 GALGETGSVGFMFNRIGEIIYKLESGTADTIMEAAIEAGAEDVQSEETGHHIFCAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+SIK IWK      + + +K  S++++I  LE+DDDVQ+VY+N +++
Sbjct: 181 EVSKILENTLGEAESIKTIWKATTLAPI-DEEKALSVLRLISTLEEDDDVQNVYANFDVS 239

Query: 241 DDII 244
           D+I+
Sbjct: 240 DEIL 243


>gi|86359066|ref|YP_470958.1| hypothetical protein RHE_CH03475 [Rhizobium etli CFN 42]
 gi|119391969|sp|Q2K4K5|Y3475_RHIEC RecName: Full=UPF0082 protein RHE_CH03475
 gi|86283168|gb|ABC92231.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 248

 Score =  291 bits (745), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIDRAIKKAAGADGENYDEVRYEGYGPGGTAIIVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y    GD++  ME AIE+ A +V  +++ +   C F  +G
Sbjct: 121 GALGETGSVSFSFDHVGEITYKLAAGDADKVMEAAIEAGADDVETDEEGHYITCAFEALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+++K +W+  N + + + +K +S++K+I++LEDDDDVQ+VYSN E++
Sbjct: 181 EVSKALEASLGEAETVKAVWRAQNNVPV-DEEKAQSLMKLIDSLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|319404759|emb|CBI78360.1| conserved hypothetical protein [Bartonella rochalimae ATCC
           BAA-1498]
 gi|319407722|emb|CBI81370.1| conserved hypothetical protein [Bartonella sp. 1-1C]
          Length = 249

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 186/245 (75%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SKIFSKL+REITV+AK    +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKIFSKLAREITVAAKQGSPDPTMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  +RYEGYGP GVA+I+EALTDNRNRTAS++R+ FTK+ 
Sbjct: 61  MPKDNIERAIKKASGSDVENYDEVRYEGYGPGGVAVIVEALTDNRNRTASNVRAAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ-EYIFYCDFNNV 179
           G+LG TGS +  F +IGEIIY    G ++  ME AIE+ A +V  E++  +  +C F ++
Sbjct: 121 GALGETGSVSFMFNRIGEIIYKFESGTADTIMEAAIEAGAEDVQSEEEGGHHIFCAFEDI 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G  SK LE  +GEA+SIK IWK      + + +K  S++++I  LE+DDDVQ+VY+N ++
Sbjct: 181 GEVSKILETTLGEAESIKTIWKATTLAPI-DEEKALSVLRLIATLEEDDDVQNVYANFDV 239

Query: 240 ADDII 244
           +D+I+
Sbjct: 240 SDEIL 244


>gi|260466776|ref|ZP_05812962.1| protein of unknown function DUF28 [Mesorhizobium opportunistum
           WSM2075]
 gi|259029506|gb|EEW30796.1| protein of unknown function DUF28 [Mesorhizobium opportunistum
           WSM2075]
          Length = 249

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 184/239 (76%), Gaps = 1/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK  S
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKSGTPDPSMNPRLRLAIQNAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D  NY  +RYEGYGP GVA+I+EALTDNRNR+AS++R+ FTKA 
Sbjct: 61  MPKDNIQRAINKASMGDAENYEAVRYEGYGPGGVAVIVEALTDNRNRSASNVRAAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G++G TGS +  +++ GEI Y ++ G ++  M+ AIE+ A +V  +++ +  YC F N+G
Sbjct: 121 GAMGETGSVSFMWDRAGEIYYPASAGSADKVMDAAIEAGADDVESDEEGHTIYCAFENLG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
             SK LE  +GEA+S+K+IWKP N + + + ++ +S++K++  LEDDDDVQSVY+N E+
Sbjct: 181 EVSKALEASLGEAESVKLIWKPQNTVPV-DEERAQSLMKLVATLEDDDDVQSVYANFEV 238


>gi|241206198|ref|YP_002977294.1| hypothetical protein Rleg_3509 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860088|gb|ACS57755.1| protein of unknown function DUF28 [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 248

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 187/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RS FTKA 
Sbjct: 61  MPKDNIDRAIKKAAGADGENYDAVRYEGYGPGGTAIIVEALTDNRNRTASNVRSSFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y  ++GD++  ME AIE+ A +V  ++  +   C F  +G
Sbjct: 121 GALGETGSVSFSFDHVGEITYKLSVGDADKVMEAAIEAGADDVETDEDGHYITCGFEALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE  +GEA+++K +W+  N + + + +K +S++K+I++LEDDDDVQ+VYSN E++
Sbjct: 181 EVAKALESSLGEAETVKAVWRAQNNVPV-DEEKAQSLLKLIDSLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|118588338|ref|ZP_01545747.1| hypothetical protein SIAM614_23692 [Stappia aggregata IAM 12614]
 gi|118439044|gb|EAV45676.1| hypothetical protein SIAM614_23692 [Stappia aggregata IAM 12614]
          Length = 248

 Score =  289 bits (740), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R+DA +SK+FSKLS+EITV+AK+   +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSKFKNIMHRKGRQDAARSKMFSKLSKEITVAAKMGDPDPDSNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENI+RAI K+ S D  NY  +RYEGYGP GVA+++EALTDNRNR+AS+IRS FTK  
Sbjct: 61  MPKENIQRAINKSQSGDDDNYEEVRYEGYGPAGVAVVVEALTDNRNRSASNIRSYFTKCG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEIIY    G+++  +E AIE+ A +V  ++  +  Y  F ++ 
Sbjct: 121 GSLGETGSVSFMFDRVGEIIYKPEAGEADAVLEAAIEAGAEDVQSDESGHTIYTAFEDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE+ +GEA S K+IWKP N   + NADK ++++K+I+ LEDDDDVQ+VYSN ++ 
Sbjct: 181 DVSAALEKALGEADSTKIIWKPQNLTPV-NADKAQTMMKLIDMLEDDDDVQNVYSNFDVD 239

Query: 241 DDII 244
           ++ +
Sbjct: 240 EETM 243


>gi|307944534|ref|ZP_07659874.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
 gi|307772283|gb|EFO31504.1| conserved hypothetical protein [Roseibium sp. TrichSKD4]
          Length = 248

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R+DA++SK+FSKLS+EITV+AK+   +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSKFKNIMHRKGRQDAVRSKMFSKLSKEITVAAKMGDPDPDSNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI K+ S D  NY  IRYEGYGP GVAI++EALTDNRNR+AS+IRS FTK  
Sbjct: 61  MPKDNIQRAINKSQSGDAENYEEIRYEGYGPAGVAIVVEALTDNRNRSASNIRSYFTKCG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++GEI Y    G+++  +E AIE+ A +VL +D  +  Y  F ++ 
Sbjct: 121 GSLGETGSVSFMFDRVGEITYKPEAGEADAVLEAAIEAGAEDVLSDDSGHTVYTAFEDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              K LEE +GEA S K+IWKP N   + + DK ++++K+I+ LE+DDDVQ+V+SN ++ 
Sbjct: 181 EVGKALEEALGEADSTKIIWKPQNLTPV-DGDKAQTLMKLIDMLEEDDDVQNVFSNFDVD 239

Query: 241 DDII 244
           ++ +
Sbjct: 240 EETM 243


>gi|116253722|ref|YP_769560.1| hypothetical protein RL3983 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|118574360|sp|Q1MC59|Y3983_RHIL3 RecName: Full=UPF0082 protein RL3983
 gi|115258370|emb|CAK09473.1| conserved hypothetical protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 248

 Score =  288 bits (738), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 186/244 (76%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RS FTKA 
Sbjct: 61  MPKDNIDRAIKKAAGADGENYDEVRYEGYGPGGTAIIVEALTDNRNRTASNVRSSFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y  ++GD +  ME AIE+ A +V  ++  +   C F  +G
Sbjct: 121 GALGETGSVSFSFDHVGEITYKLSVGDGDKVMEAAIEAGADDVESDEDGHYITCAFEALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE  +GEA+++K +W+  N + + + +K +S++K+I++LEDDDDVQ+VYSN E++
Sbjct: 181 EVAKALESSLGEAETVKAVWRAQNNVPV-DEEKAQSLLKLIDSLEDDDDVQNVYSNFEVS 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVL 243


>gi|300023948|ref|YP_003756559.1| hypothetical protein Hden_2441 [Hyphomicrobium denitrificans ATCC
           51888]
 gi|299525769|gb|ADJ24238.1| protein of unknown function DUF28 [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 249

 Score =  287 bits (735), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 178/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++DA++SK+F+KL+REITV+AK    +P  NPRLRLAIQ A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGKQDAMRSKLFAKLAREITVAAKSGTPDPDMNPRLRLAIQEARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+N+ERAIKKA   DL NY  +RYEGY P GVAII EALTDNRNRT   +RS+FTK N
Sbjct: 61  MPKDNVERAIKKAAGGDLANYEAVRYEGYAPGGVAIICEALTDNRNRTGGVVRSVFTKYN 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LGSTGS +  F  IGEI Y    G +   ++ AIE+ A +V  +   ++  C F  +G
Sbjct: 121 GNLGSTGSVSHMFNHIGEITYKPETGSAEAVLDAAIEAGADDVQSDANGHVIVCAFETLG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
            T+  LE+ +GEAQS+K +WKP N     + D  ++I+KM+  LEDDDDVQ+V++N EI+
Sbjct: 181 STAAALEKALGEAQSVKAVWKP-NLTTQVDEDNAQAIMKMLAALEDDDDVQNVFANFEIS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVL 243


>gi|254473217|ref|ZP_05086615.1| conserved hypothetical protein TIGR01033 [Pseudovibrio sp. JE062]
 gi|211957938|gb|EEA93140.1| conserved hypothetical protein TIGR01033 [Pseudovibrio sp. JE062]
          Length = 247

 Score =  285 bits (730), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 130/244 (53%), Positives = 185/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R+DA++SK+FS+LS+EITV+AK+   +P +NPRLRLA+QNAK QS
Sbjct: 1   MAGHSKFKNIMHRKGRQDAVRSKLFSRLSKEITVAAKMGDPDPDKNPRLRLAVQNAKGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI RAI K+   +  +YT IRYEGYGP G AII+E LTDN+NR+A+++RS FTK  
Sbjct: 61  MPKDNIARAIAKSQGGEGADYTEIRYEGYGPGGTAIIVEVLTDNKNRSAANVRSYFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GS+G TGS +  F+++GE++Y    GD++  ME  IE+ A +V  +D+ +   C F ++ 
Sbjct: 121 GSMGETGSVSFMFDRVGELVYKPEAGDADTVMEAGIEAGADDVESDDEAHTIICAFEDLS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GEA+S+K IWKP N + + N +K  +I+K+++ LEDDDDVQ+V+SN +I 
Sbjct: 181 EVSKALEAALGEAESVKTIWKPQNLVEV-NEEKAGTIMKLMDALEDDDDVQNVFSNFDIP 239

Query: 241 DDII 244
           +D++
Sbjct: 240 EDVL 243


>gi|222086992|ref|YP_002545526.1| hypothetical protein Arad_3703 [Agrobacterium radiobacter K84]
 gi|221724440|gb|ACM27596.1| conserved hypothetical protein [Agrobacterium radiobacter K84]
          Length = 253

 Score =  285 bits (728), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 135/244 (55%), Positives = 184/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+D+++SK+FSKL+REITV+AK    +P  N  LRLAIQNAK QS
Sbjct: 6   MAGHSQFKNIMHRKGRQDSVRSKMFSKLAREITVAAKAGLPDPTMNASLRLAIQNAKAQS 65

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RSIFTKA 
Sbjct: 66  MPKDNIDRAIKKAAGSDGENYDAVRYEGYGPGGTAIIVEALTDNRNRTASNVRSIFTKAG 125

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y   +GD++  ME AIE+ A +V  ++  +   C F  + 
Sbjct: 126 GALGETGSVSFSFDHVGEITYKPTVGDADKVMEAAIEAGADDVESDEDGHTIICGFEAMN 185

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE  +GEA+++K IW+  N + + + +K +S++K+I +LEDDDDVQ+VYSN E++
Sbjct: 186 EVAKALEATLGEAETVKAIWRAQNNVPV-DEEKAQSLMKLIGSLEDDDDVQNVYSNFEVS 244

Query: 241 DDII 244
           ++++
Sbjct: 245 EEVM 248


>gi|90418962|ref|ZP_01226873.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337042|gb|EAS50747.1| conserved hypothetical protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 249

 Score =  282 bits (722), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 134/244 (54%), Positives = 182/244 (74%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REI V+AK    +P  N RLRLAI NAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREIVVAAKSGLPDPSMNARLRLAINNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP GVAII+EALTDNRNRTAS++RS FTKA 
Sbjct: 61  MPKDNIDRAIKKASGGDSENYDEVRYEGYGPGGVAIIVEALTDNRNRTASNVRSCFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GS+G TGS +  F+ +GEI+Y  + GD++  ME AI + A +V+ ++  +     F ++G
Sbjct: 121 GSMGETGSVSFMFDHVGEIVYPLSAGDADTVMEAAILAGADDVISDENGHTIVTAFEDIG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LEE +GEA+S++  W+P     + + DK +S++++I NL+DDDDVQ+VY+N E+ 
Sbjct: 181 DVSTALEESLGEAESVRPTWRPQTGTPV-DEDKAESVMRLIGNLDDDDDVQNVYANFEVD 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|328542534|ref|YP_004302643.1| hypothetical protein SL003B_0914 [polymorphum gilvum SL003B-26A1]
 gi|326412280|gb|ADZ69343.1| hypothetical protein SL003B_0914 [Polymorphum gilvum SL003B-26A1]
          Length = 248

 Score =  280 bits (716), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 181/244 (74%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKLS+EITV+AK    +P  NPRLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKLFSKLSKEITVAAKHGDPDPASNPRLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENI+RAI K+   D  +Y  IRYEGYGP GVA+I+EALTDNRNRTAS++RS FTK  
Sbjct: 61  MPKENIQRAINKSQGGDAESYDEIRYEGYGPGGVAVIVEALTDNRNRTASNVRSYFTKCG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G++G TGS +  F+++GEI+Y    G +   +E AIE+ A +V  +   +   C F ++G
Sbjct: 121 GAMGETGSVSFMFDRVGEILYPGKAGGAETVLEAAIEAGAEDVQSDADTHTIICAFEDLG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE  +GE +S+K++WKP     + +++K ++++K++  LEDDDDVQ+VY+N +I 
Sbjct: 181 DVSKALEGALGEPESVKIVWKPQTLTPV-DSEKAQTLMKLVGLLEDDDDVQNVYANFDID 239

Query: 241 DDII 244
           ++ +
Sbjct: 240 EETM 243


>gi|294850968|ref|ZP_06791644.1| hypothetical protein BAZG_03099 [Brucella sp. NVSL 07-0026]
 gi|294821611|gb|EFG38607.1| hypothetical protein BAZG_03099 [Brucella sp. NVSL 07-0026]
          Length = 238

 Score =  276 bits (706), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 130/234 (55%), Positives = 177/234 (75%), Gaps = 1/234 (0%)

Query: 11  MHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAI 70
           MHRK R+DA++SK+FSKL+REITV+AK    +P  NPRLRLAIQNAK QSMPK+NIERAI
Sbjct: 1   MHRKGRQDAVRSKMFSKLAREITVAAKQGLPDPAMNPRLRLAIQNAKAQSMPKDNIERAI 60

Query: 71  KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTT 130
           KKA  +D  NY  +RYEG GP GV++I+EALTDNRNRTAS++R+ FTK+ GSLG TGS +
Sbjct: 61  KKAAGNDGENYDEVRYEGRGPGGVSVIVEALTDNRNRTASNVRAAFTKSGGSLGETGSVS 120

Query: 131 RFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKI 190
             F+++GEI+Y    GD++  ME AIE+ A +V   +  ++  C F ++G  SK LE  +
Sbjct: 121 FMFDRVGEIVYKPEAGDADKVMEAAIEAGAEDVQSGEDGHVILCAFEDIGEVSKALEAAL 180

Query: 191 GEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII 244
           GEA+SIK IWKP     L + +K +S++K++  LEDDDDVQ+VY+N E++D+++
Sbjct: 181 GEAESIKTIWKPQTNTEL-DEEKARSVLKLLSVLEDDDDVQNVYTNFEVSDEVM 233


>gi|114762980|ref|ZP_01442410.1| hypothetical protein 1100011001344_R2601_20911 [Pelagibaca
           bermudensis HTCC2601]
 gi|114544304|gb|EAU47312.1| hypothetical protein R2601_20911 [Roseovarius sp. HTCC2601]
          Length = 246

 Score =  273 bits (697), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 183/244 (75%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+++K+FSK S+EITV+AK+   +P +NPRLRLAI+ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRAKLFSKFSKEITVAAKMGDPDPDKNPRLRLAIKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKASGGEGDDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASNVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GEI+Y ++ GD++  M  AIE+ A +V   D+ ++ YC  +++ 
Sbjct: 121 GNLGETGSVAFMFERKGEIVYPADAGDADTVMMAAIEAGAEDVESSDEGHVIYCADSDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE ++GE++S K+IWKP     L + D ++S++K+++ LEDDDDVQ V +N E +
Sbjct: 181 DVATGLEAELGESESTKLIWKPTTTTEL-DLDSMQSLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|327194141|gb|EGE61011.1| hypothetical protein RHECNPAF_13006 [Rhizobium etli CNPAF512]
          Length = 238

 Score =  271 bits (692), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 128/234 (54%), Positives = 179/234 (76%), Gaps = 1/234 (0%)

Query: 11  MHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAI 70
           MHRK R+DA++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QSMPK+NI+RAI
Sbjct: 1   MHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQSMPKDNIDRAI 60

Query: 71  KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTT 130
           KKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RSIFTKA G+LG TGS +
Sbjct: 61  KKAAGADGENYDEVRYEGYGPGGTAIIVEALTDNRNRTASNVRSIFTKAGGALGETGSVS 120

Query: 131 RFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKI 190
             F+ +GEI Y  ++GD++  ME AIE+ A +V  +++ +   C F  +G  SK LE  +
Sbjct: 121 FSFDHVGEITYKLSVGDADKVMEAAIEAGADDVETDEEGHYITCAFEALGDVSKALESGL 180

Query: 191 GEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDII 244
           GEA+++K +W+  N + + + +K +S++K+I++LEDDDDVQ+VYSN E++++++
Sbjct: 181 GEAETVKAVWRAQNNVPV-DEEKAQSLMKLIDSLEDDDDVQNVYSNFEVSEEVL 233


>gi|260425960|ref|ZP_05779939.1| conserved hypothetical protein [Citreicella sp. SE45]
 gi|260420452|gb|EEX13703.1| conserved hypothetical protein [Citreicella sp. SE45]
          Length = 246

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 181/244 (74%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+++K+FSK S+EIT++AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRAKLFSKFSKEITIAAKMGDPDPDKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  +Y  IRYEGYGP GVAII+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKAMGGDGDDYEEIRYEGYGPNGVAIIVEAMTDNRNRTASNVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GEIIY    GD++  M  AIE+ A +V  +++E++ YC   ++ 
Sbjct: 121 GNLGETGSVAFMFERKGEIIYKIAAGDADTIMMAAIEAGAEDVESDEEEHVIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE  +GE++S K+IWKP     L + D +++++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVATALETALGESESTKLIWKPTTTTEL-DLDSMQTLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|56695969|ref|YP_166323.1| hypothetical protein SPO1072 [Ruegeria pomeroyi DSS-3]
 gi|67462019|sp|Q5LUI2|Y1072_SILPO RecName: Full=UPF0082 protein SPO1072
 gi|56677706|gb|AAV94372.1| conserved hypothetical protein TIGR01033 [Ruegeria pomeroyi DSS-3]
          Length = 246

 Score =  265 bits (677), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSK S+EITV+AK+   +P +NPRLRLAI+ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKFSKEITVAAKMGDPDPDKNPRLRLAIKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D   Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKAIGGDGDAYEEIRYEGYGPNGVAVIVEAMTDNRNRTASNVRSTFTKHG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE++Y +++GD++  M  AIE+ A +V   ++ ++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEVVYPASVGDADTVMMAAIEAGAEDVESSEEGHVIWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE+ S K++WKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSTALEAELGESDSTKLVWKPSTTTEL-DLEAMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|85706421|ref|ZP_01037515.1| hypothetical protein ROS217_16040 [Roseovarius sp. 217]
 gi|85669194|gb|EAQ24061.1| hypothetical protein ROS217_16040 [Roseovarius sp. 217]
          Length = 246

 Score =  264 bits (675), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 176/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+++K+FSK S+EITV+AK+   +P +NPRLRLAI+ AK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRAKLFSKFSKEITVAAKMGDPDPDKNPRLRLAIKEAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  +Y  IRYEGYGP GVAII+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKAMGGDAEDYEEIRYEGYGPNGVAIIVEAMTDNRNRTASNVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE+ Y +++GD++  M  A+E+ A +V   +  +  +C   ++ 
Sbjct: 121 GNLGETGSVAFMFERKGEVTYPASVGDADTVMMAALEAGAEDVESGEDGHTIWCADTDLS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LEE +GE+ S K++WKP     + + + ++ ++K+IE LEDDDDVQ V +N E +
Sbjct: 181 EAASALEEALGESNSTKLVWKPTTTTEM-DLESMQKLMKLIEALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DAVM 243


>gi|254504912|ref|ZP_05117063.1| conserved hypothetical protein TIGR01033 [Labrenzia alexandrii
           DFL-11]
 gi|222440983|gb|EEE47662.1| conserved hypothetical protein TIGR01033 [Labrenzia alexandrii
           DFL-11]
          Length = 238

 Score =  264 bits (675), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 124/229 (54%), Positives = 173/229 (75%), Gaps = 1/229 (0%)

Query: 11  MHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAI 70
           MHRK R+DA++SK+FSKLS+EITV+AK+   +P  NPRLRLA+ NAK QSMPK+NI+RAI
Sbjct: 1   MHRKGRQDAVRSKMFSKLSKEITVAAKMGDPDPDSNPRLRLAVNNAKAQSMPKDNIQRAI 60

Query: 71  KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGSTGSTT 130
            K+ + D  +Y  IRYEGYGP GVA+++EALTDNRNR+AS+IRS FTK  GSLG TGS +
Sbjct: 61  NKSQAGDAESYDEIRYEGYGPAGVAVVVEALTDNRNRSASNIRSYFTKCGGSLGETGSVS 120

Query: 131 RFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKI 190
             F+++GEIIY    G+++  +E AIE+ A +V  ++  +  Y  F ++   +K LEE +
Sbjct: 121 FMFDRVGEIIYKPEAGEADAVLEAAIEAGAEDVQSDENGHTIYTAFEDLNDVAKALEEAL 180

Query: 191 GEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           GEA S K+IWKP N   + +ADK ++++K+I+ LEDDDDVQ+VY+N ++
Sbjct: 181 GEADSTKIIWKPQNLTPV-DADKAQTLMKLIDMLEDDDDVQNVYTNFDV 228


>gi|163745948|ref|ZP_02153307.1| hypothetical protein OIHEL45_10188 [Oceanibulbus indolifex HEL-45]
 gi|161380693|gb|EDQ05103.1| hypothetical protein OIHEL45_10188 [Oceanibulbus indolifex HEL-45]
          Length = 246

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 180/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L++K+FSKLS+EIT++AK+   +P +NPRLR+A++ AK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRAKVFSKLSKEITIAAKMGDPDPEKNPRLRMAVKEAKGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKAIGGEGEDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE+IY +++GD++  M  AIE+ A +V   +  ++ YC   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEVIYPASVGDADTVMMAAIEAGAEDVESSEDGHVIYCTDTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IW+P     + + + ++ ++K+++ LE+DDDVQ V +N E +
Sbjct: 181 DVSTALEAELGESESTKLIWRPTTTTEM-DLEAMEKLMKLVDALEEDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|126729301|ref|ZP_01745115.1| hypothetical protein SSE37_23914 [Sagittula stellata E-37]
 gi|126710291|gb|EBA09343.1| hypothetical protein SSE37_23914 [Sagittula stellata E-37]
          Length = 248

 Score =  262 bits (670), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 178/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L++K+FSKLS+EIT++AK+   +P +NPRLRLA++ A+ QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRAKVFSKLSKEITIAAKMGDPDPEKNPRLRLAVKEARGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  +Y  IRYEGYGP GVA+I+E +TDNRNRTAS++RS+F+K  
Sbjct: 61  MPKDNIERAIKKAVGGDAEDYEEIRYEGYGPNGVAVIVETMTDNRNRTASNVRSLFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GEI+Y ++ GD++  M  AIE+ A +V   +  ++ YC   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEIVYPASAGDADDVMMAAIEAGAEDVESSEDGHVIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE  +GE++S K++WKP     L + D + S++K+++ LE+DDDVQ V +N E +
Sbjct: 181 DVSSALEGALGESESTKLVWKPTTTTEL-DLDGMNSLMKLVDALEEDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254467141|ref|ZP_05080552.1| conserved hypothetical protein TIGR01033 [Rhodobacterales bacterium
           Y4I]
 gi|206688049|gb|EDZ48531.1| conserved hypothetical protein TIGR01033 [Rhodobacterales bacterium
           Y4I]
          Length = 268

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 23  MAGHSKWANIQHRKGRQDAARSKLFSKLAKEITVAAKMGDPDPDKNPRLRLAVKEAKSQS 82

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKKA   D  NY  IRYEGYGP GVA+I+EA+TDN+NRTAS++RSIF K  
Sbjct: 83  VPKDVIERAIKKAIGGDAENYDEIRYEGYGPAGVAVIVEAMTDNKNRTASNVRSIFGKNG 142

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y +++GD++  M  AIE+ A +V   +  +I YC   ++ 
Sbjct: 143 GNLGETGSVGFMFDRKGEVTYPASVGDADTVMMAAIEAGAEDVESSEDGHIIYCADTDLN 202

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K++WKP     L + D ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 203 DVSNALEAELGESESTKLVWKPTTTTEL-DLDGMQKLMKLVDALEDDDDVQRVTTNFEAS 261

Query: 241 DDII 244
           D+++
Sbjct: 262 DEVM 265


>gi|149201067|ref|ZP_01878042.1| hypothetical protein RTM1035_15617 [Roseovarius sp. TM1035]
 gi|149145400|gb|EDM33426.1| hypothetical protein RTM1035_15617 [Roseovarius sp. TM1035]
          Length = 246

 Score =  261 bits (667), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+++K+FSK S+EITV+AK+   +P +NPRLRLAI+ AK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRAKLFSKFSKEITVAAKMGDPDPDKNPRLRLAIKEAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  +Y  IRYEGYGP GVAII+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKAMGGDAEDYEEIRYEGYGPNGVAIIVEAMTDNRNRTASNVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE+ Y +++GD++  M  A+E+ A +V   +  +  +C   ++ 
Sbjct: 121 GNLGETGSVAFMFERKGEVTYAASVGDADTVMMAALEAGAEDVESGEDGHTIWCADTDLS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE  +GE+ S K++WKP     + + + ++ ++K+IE LEDDDDVQ V +N E +
Sbjct: 181 EVASGLEGALGESTSTKLVWKPTTTTEM-DLESMQKLMKLIEALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DAVM 243


>gi|126739230|ref|ZP_01754924.1| hypothetical protein RSK20926_22559 [Roseobacter sp. SK209-2-6]
 gi|126719847|gb|EBA16555.1| hypothetical protein RSK20926_22559 [Roseobacter sp. SK209-2-6]
          Length = 246

 Score =  261 bits (667), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLAKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKKA   D  NY  IRYEGYGP GVA+I+E +TDN+NRTAS++RS F+K  
Sbjct: 61  VPKDVIERAIKKAIGGDAENYDEIRYEGYGPSGVAVIVETMTDNKNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y +++GD++  M  AIE+ A +V   D  +I YC+  ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVSYPASVGDADTVMMAAIEAGAEDVESSDDGHIIYCEDTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IWKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSNALEAELGESESTKLIWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|83944535|ref|ZP_00956987.1| hypothetical protein EE36_11713 [Sulfitobacter sp. EE-36]
 gi|83955356|ref|ZP_00964011.1| hypothetical protein NAS141_16939 [Sulfitobacter sp. NAS-14.1]
 gi|83840349|gb|EAP79523.1| hypothetical protein NAS141_16939 [Sulfitobacter sp. NAS-14.1]
 gi|83844641|gb|EAP82526.1| hypothetical protein EE36_11713 [Sulfitobacter sp. EE-36]
          Length = 246

 Score =  261 bits (666), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 124/247 (50%), Positives = 180/247 (72%), Gaps = 7/247 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L++K+FSKLS+EIT++AK+   +P +NPRLRLA++ AK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRAKVFSKLSKEITIAAKMGEPDPDKNPRLRLAVKEAKGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIERAIKKAVGGEGEDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DFN 177
           G+LG TGS    F++ GEI Y +++GD++  M  AIE+ A +V   D  ++ +C   D N
Sbjct: 121 GNLGETGSVGFMFDRKGEITYPASVGDADTVMMAAIEAGAEDVESSDDGHVIWCMDTDLN 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +V   S  LE ++GE+ S K++W+P     + + + ++ ++K+I+ LEDDDDVQ V +N 
Sbjct: 181 DV---STALEAELGESDSTKLVWRPTTTTEM-DLEGMEKLMKLIDALEDDDDVQRVTANF 236

Query: 238 EIADDII 244
           E +D+++
Sbjct: 237 EASDEVM 243


>gi|114706863|ref|ZP_01439763.1| hypothetical protein FP2506_18644 [Fulvimarina pelagi HTCC2506]
 gi|114537811|gb|EAU40935.1| hypothetical protein FP2506_18644 [Fulvimarina pelagi HTCC2506]
          Length = 249

 Score =  259 bits (663), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 182/244 (74%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA +SK+FSKL+REITV+AK    +P  NPRLRLA+ NAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAARSKMFSKLAREITVAAKSGLPDPEMNPRLRLAVNNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS+IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKASGGDSENYEEVRYEGYGPAGVAVIVEALTDNRNRTASNIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS    F+ +GEI+Y ++ G+ +  +E AI +   +V+ +++ ++    F ++ 
Sbjct: 121 GSLGETGSVGFMFDHVGEIVYPASAGEPDAVLEAAILAGGDDVISDEENHVIITAFEDIN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LEE +GE QS+K IW+P     + + +K +S++++++NL+DDDDVQ+VY+N E+ 
Sbjct: 181 EVSTALEESLGEPQSVKAIWRPQTNTPV-DEEKAQSVMRLLDNLDDDDDVQNVYANYEVD 239

Query: 241 DDII 244
           ++ +
Sbjct: 240 EETM 243


>gi|94496897|ref|ZP_01303471.1| hypothetical protein SKA58_12612 [Sphingomonas sp. SKA58]
 gi|94423573|gb|EAT08600.1| hypothetical protein SKA58_12612 [Sphingomonas sp. SKA58]
          Length = 247

 Score =  259 bits (661), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLA+  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSSMFSKLSREITVAAKMGMPDPDMNPRLRLAVNAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D+ NY  +RYEGYGP GVAII+EALTDNRNRTA+++R+ F+K  
Sbjct: 61  MPKDNIQRAIDKASGGDMENYEEVRYEGYGPGGVAIIVEALTDNRNRTATNVRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++G+ +  FE +G I Y ++ GD++   E A+E+ A +V   + E+  +   + + 
Sbjct: 121 GNLGASGAVSHGFEHLGLITYPASAGDADAVFEAALEAGADDVSSNEDEHEIWTAMDALH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K+GEA   K+ W+P   + +  ++   +++K+++ LEDDDDVQ+V+ N E++
Sbjct: 181 EVAKALEAKLGEADGAKLAWRPTTTVEVDESN-AGTLMKLVDTLEDDDDVQTVWGNYEVS 239

Query: 241 DDII 244
           DD++
Sbjct: 240 DDVM 243


>gi|84501557|ref|ZP_00999729.1| hypothetical protein OB2597_15185 [Oceanicola batsensis HTCC2597]
 gi|84390178|gb|EAQ02737.1| hypothetical protein OB2597_15185 [Oceanicola batsensis HTCC2597]
          Length = 246

 Score =  258 bits (659), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 178/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKK+ + D  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIERAIKKSQAGDGDDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASNVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE+ Y + +GD++  +  AIE+ A +V   +  +  YC   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEVTYPAEVGDADTVLMAAIEAGAEDVESTEDGHYIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE ++GE++S K+IWKP     + + D ++ ++K+IE LEDDDDVQ V +N E +
Sbjct: 181 DVAGALETELGESESTKLIWKPTTTTEM-DLDGMQKLMKLIEALEDDDDVQRVTANFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|84686295|ref|ZP_01014190.1| hypothetical protein 1099457000256_RB2654_08827 [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84665822|gb|EAQ12297.1| hypothetical protein RB2654_08827 [Rhodobacterales bacterium
           HTCC2654]
          Length = 246

 Score =  258 bits (659), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 180/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLAKEITVAAKMGDPDPDKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+ + +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKSQAGEGDDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F+++GE++Y +++GD++  M  AIE+ A +V   +  +I YC   ++ 
Sbjct: 121 GNLGETGSVGFMFDRMGEVVYPASVGDADTVMMAAIEAGAMDVESSEDGHIIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IWKP     + + + ++ ++K+I+ LEDDDDVQ V +N E  
Sbjct: 181 EVSTALEAELGESESTKLIWKPTTTTEM-DLESMQKLMKLIDALEDDDDVQRVTTNFEAP 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|304393337|ref|ZP_07375265.1| conserved hypothetical protein [Ahrensia sp. R2A130]
 gi|303294344|gb|EFL88716.1| conserved hypothetical protein [Ahrensia sp. R2A130]
          Length = 256

 Score =  257 bits (657), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 129/252 (51%), Positives = 175/252 (69%), Gaps = 9/252 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R+DA++SK F+KLS+EITV++KL G +   NPRLRLAI NAK  S
Sbjct: 1   MAGHSKFKNIMHRKGRQDAVRSKQFAKLSKEITVASKLGGPDADGNPRLRLAIANAKGLS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ K    D+     IRYEGYGP GVA+I+EALTDN+NR+AS+IR+ FTK  
Sbjct: 61  MPKDNIKRAVDKGAGGDMEEMFEIRYEGYGPGGVAVIVEALTDNKNRSASNIRAAFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIES---DAFEVLFEDQ-----EYIF 172
           G +G TGS    F+++GEI Y +  GD +  ME AIE+   DA   L ED       +  
Sbjct: 121 GQMGETGSVGFMFDRVGEIKYPAAAGDEDTVMEAAIEAGAEDASSDLEEDDFNEAGGHTI 180

Query: 173 YCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
              F ++G  + +LE  +GE  S+ +IWKP N + + + DK  +++K+I+ LEDDDDVQ+
Sbjct: 181 ITGFEDLGAVAAELESALGEPASVNIIWKPQNTVPV-DEDKGGTLMKLIDTLEDDDDVQN 239

Query: 233 VYSNLEIADDII 244
           VYSN E+ D+ +
Sbjct: 240 VYSNFEMDDETM 251


>gi|110679300|ref|YP_682307.1| hypothetical protein RD1_2018 [Roseobacter denitrificans OCh 114]
 gi|118574108|sp|Q168H2|Y2018_ROSDO RecName: Full=UPF0082 protein RD1_2018
 gi|109455416|gb|ABG31621.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114]
          Length = 246

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+++K+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRAKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKK+ + D   Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIDRAIKKSQAGDGDEYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ G + Y +++GD++  +  AIE+ A +V   +  ++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGTVTYPADVGDADTVLMAAIEAGAEDVESSEDGHVIWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE ++GE++  K++W+P     L + + ++ ++++IE LEDDDDVQ V +N E +
Sbjct: 181 EVATALEAELGESEQTKLVWRPTTTTEL-DLEGMQKLMRLIEALEDDDDVQRVTANFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|304321098|ref|YP_003854741.1| hypothetical protein PB2503_07719 [Parvularcula bermudensis
           HTCC2503]
 gi|303300000|gb|ADM09599.1| hypothetical protein PB2503_07719 [Parvularcula bermudensis
           HTCC2503]
          Length = 248

 Score =  257 bits (656), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRSKLFSKLSKEITVAAKMGTPDPEMNPRLRLAVQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA S +  NY  IRYEG GPEGV +I+EALTDNRNRTAS +RS FTK  
Sbjct: 61  MPKDNIERAIKKAESGEGDNYEEIRYEGRGPEGVGVIVEALTDNRNRTASEVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSLG TGS +  F+++G I Y  +I   +  ME AIE+ A +V   +  +  YC   ++ 
Sbjct: 121 GSLGETGSVSFGFDRMGLIQYPVDITSEDGMMEAAIEAGAEDVESSEDGHAVYCALEDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE + GE +++   W+P   + +S+ +K ++++K+ E L+D DDVQ+VY+N E++
Sbjct: 181 DVSTALEARFGEPETVTPTWRPQITVPISD-EKAETMMKLYEALDDLDDVQNVYTNFEMS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|163733442|ref|ZP_02140885.1| hypothetical protein RLO149_17363 [Roseobacter litoralis Och 149]
 gi|161393230|gb|EDQ17556.1| hypothetical protein RLO149_17363 [Roseobacter litoralis Och 149]
          Length = 246

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 178/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+++K+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRAKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKK+   D   Y  IRYEGYGP GVA+I+E +TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIDRAIKKSQVGDGDEYEEIRYEGYGPNGVAVIVETMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y + +GD++  +  AIE+ A +V   +  +I +C   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVTYPAEVGDADTVLMAAIEAGAEDVESSEDGHIIWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE ++GE++S K++WKP     + + + ++ ++++I+ LEDDDDVQ V +N E +
Sbjct: 181 EVATALEAELGESESTKLVWKPTTTTEM-DLEGMQKLMRLIDALEDDDDVQRVTANFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|161899028|ref|YP_613888.2| hypothetical protein TM1040_1893 [Ruegeria sp. TM1040]
 gi|118574104|sp|Q1GFE0|Y1893_SILST RecName: Full=UPF0082 protein TM1040_1893
          Length = 246

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 177/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKKA   D  NY  IRYEGYGP GVA+I+E +TDN+NRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKATGGDAENYDEIRYEGYGPNGVAVIVETMTDNKNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE+ Y +++GD++  M  AIE+ A +V   +  ++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEVTYPASVGDADTVMMAAIEAGAEDVESSEDGHVIFCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IWKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSNALEAELGESESTKLIWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|218670979|ref|ZP_03520650.1| hypothetical protein RetlG_04613 [Rhizobium etli GR56]
          Length = 203

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 120/201 (59%), Positives = 154/201 (76%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK    +P  N RLRLAIQNAK QS
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKMFSKLAREITVAAKAGLPDPTMNARLRLAIQNAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGYGP G AII+EALTDNRNRTAS++RSIFTKA 
Sbjct: 61  MPKDNIDRAIKKAAGADGENYDEVRYEGYGPGGTAIIVEALTDNRNRTASNVRSIFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +GEI Y  ++GD++  ME AIE+ A +V  +++ +   C F  +G
Sbjct: 121 GALGETGSVSFSFDHVGEITYKLSVGDADKVMEAAIEAGADDVETDEEGHCITCAFEALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWK 201
             SK LE  +GEA+++K +W+
Sbjct: 181 EVSKALESGLGEAETVKAVWR 201


>gi|89071234|ref|ZP_01158415.1| hypothetical protein OG2516_04648 [Oceanicola granulosus HTCC2516]
 gi|89043247|gb|EAR49476.1| hypothetical protein OG2516_04648 [Oceanicola granulosus HTCC2516]
          Length = 249

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLAKEITVAAKMGDPDPDKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKKA   D  NY  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F K  
Sbjct: 61  VPKDVIDRAIKKAVGGDAENYEEIRYEGYGPGGVAVIVEAMTDNRNRTASTVRSTFGKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ G+++Y +  GD++  M  AIE+ A +V   ++E++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGQVVYPAAAGDADDIMMAAIEAGAEDVESGEKEHVIWCADTDLA 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K++W+P     L + + ++ ++K+++ LEDDDD+QSV +N E +
Sbjct: 181 EVSNALEAQLGESESTKLVWRPTTTAEL-DLEGLQKLMKLVDALEDDDDIQSVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|126735109|ref|ZP_01750855.1| hypothetical protein RCCS2_14569 [Roseobacter sp. CCS2]
 gi|126715664|gb|EBA12529.1| hypothetical protein RCCS2_14569 [Roseobacter sp. CCS2]
          Length = 249

 Score =  255 bits (652), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 177/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSKLAKEITVAAKMGDPDPDKNPRLRLAVKEAKSSS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+   D  NY  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKSQGGDAENYDEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE++Y +++ D++  M  AIE+ A +V  +D  ++ YC   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVVYPADVADADTVMMAAIEAGAEDVQSDDDNHVIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IWKP N     + + +  ++K+++ LE+DDDVQ V SN E +
Sbjct: 181 EVSTALEAELGESESTKLIWKP-NMTTELDVEGLTKLMKLLDTLEEDDDVQRVTSNFEAS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DAVM 243


>gi|259416989|ref|ZP_05740909.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
 gi|259348428|gb|EEW60205.1| conserved hypothetical protein [Silicibacter sp. TrichCH4B]
          Length = 246

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 176/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKKA   D  NY  IRYEGYGP GVA+I+E +TDN+NRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKATGGDAENYDEIRYEGYGPNGVAVIVETMTDNKNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GE+ Y + +GD++  M  AIE+ A +V   +  ++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEVTYPAEVGDADTVMMAAIEAGAEDVESSEDGHVIFCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IWKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSNALEGELGESESTKLIWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|83859818|ref|ZP_00953338.1| hypothetical protein OA2633_07454 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83852177|gb|EAP90031.1| hypothetical protein OA2633_07454 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 256

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 122/251 (48%), Positives = 174/251 (69%), Gaps = 10/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  ++K+FS+LS+EI V+ K+ G +P  NPRLRLA+QNAK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKARAKLFSRLSKEIMVAVKMGGPDPDMNPRLRLAVQNAKGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAI KA   D   Y  IRYEG+GP G+ +I+EA TDN+NR AS IR+ F+K  
Sbjct: 61  MPKDNIERAINKAAGGDAEEYFEIRYEGFGPAGIGLIVEASTDNKNRAASDIRAAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFED---------QEYI 171
           G++G TGS +  F+Q+GEI + +++ D     E AIE+ A +V+ ED          E++
Sbjct: 121 GNMGETGSVSFMFDQLGEIRFPASVADEEAIFEAAIEAGAEDVVQEDLVDDDGEPAPEHV 180

Query: 172 FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
            YC   ++   S  L+EK GEA+S  +IWKP N I ++  DKV +++K++E LED DDV 
Sbjct: 181 IYCAREDLAEVSSALQEKFGEAKSANIIWKPQNLIEVT-GDKVATVMKLMEALEDLDDVS 239

Query: 232 SVYSNLEIADD 242
           +V++N +I+D+
Sbjct: 240 TVFANFDISDE 250


>gi|254475462|ref|ZP_05088848.1| conserved hypothetical protein TIGR01033 [Ruegeria sp. R11]
 gi|214029705|gb|EEB70540.1| conserved hypothetical protein TIGR01033 [Ruegeria sp. R11]
          Length = 246

 Score =  255 bits (652), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+   D  +Y  IRYEGYGP GVA+I+E +TDN+NRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKSQGGDAESYDEIRYEGYGPNGVAVIVETMTDNKNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y +++GD++  M  AIE+ A +V   ++ ++ YC   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVTYPASVGDADTVMMAAIEAGAEDVESSEEGHLIYCADTDLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K++WKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSNALEAELGESESTKLVWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|197106529|ref|YP_002131906.1| hypothetical protein PHZ_c3068 [Phenylobacterium zucineum HLK1]
 gi|226703689|sp|B4R9L7|Y3068_PHEZH RecName: Full=UPF0082 protein PHZ_c3068
 gi|196479949|gb|ACG79477.1| conserved hypothetical protein [Phenylobacterium zucineum HLK1]
          Length = 248

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 121/240 (50%), Positives = 170/240 (70%), Gaps = 1/240 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA +SK+FSKLSREITV+AK    +P  NPRLRLA+QNAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGMPDPAMNPRLRLAVQNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D   Y  IRYEG+GP GV +I+EALTDNRNR A+++RSIFTK  
Sbjct: 61  MPKDNIDRAIKKAQGGDAETYEEIRYEGFGPGGVGVIVEALTDNRNRAAANVRSIFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG T S    ++++G+I+Y    G  +  ME AIE+ A +V  ++  +  +  ++ + 
Sbjct: 121 GNLGETNSVAFMWDRVGQIVYGPEAGSEDKVMEAAIEAGADDVESDEDGHTIWTAYDALN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE  +G A++ ++ W+P     +S  D   +++K+IE LED+DDVQ+VYSN +I+
Sbjct: 181 EVAQALEAALGAAKATRIAWRPKAMTPVSG-DAAATLMKLIEALEDEDDVQNVYSNADIS 239


>gi|163740866|ref|ZP_02148259.1| hypothetical protein RG210_13536 [Phaeobacter gallaeciensis 2.10]
 gi|161385857|gb|EDQ10233.1| hypothetical protein RG210_13536 [Phaeobacter gallaeciensis 2.10]
          Length = 246

 Score =  255 bits (651), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 178/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+ + +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKSTAGEGDDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y + +GD++  M  AIE+ A +V   +  +I YC   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVTYPAAVGDADTVMMAAIEAGAEDVDSSEDGHIIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE+ S K++WKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSNALEGELGESDSTKLVWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|83952635|ref|ZP_00961365.1| hypothetical protein ISM_10795 [Roseovarius nubinhibens ISM]
 gi|83835770|gb|EAP75069.1| hypothetical protein ISM_10795 [Roseovarius nubinhibens ISM]
          Length = 246

 Score =  254 bits (650), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 176/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLAKEITVAAKMGDPDPEKNPRLRLAVKEAKSSS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKKA   +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIERAIKKAIGGEAEDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASNVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GEI Y + IGD++  M  AIE+ A +V   +  +I +C   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGEISYAAEIGDADTVMMAAIEAGAEDVESSEDGHIIWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE ++GE+ S K++WKP     + + D ++ ++K+IE LEDDDDVQ V +N E +
Sbjct: 181 EVAGALEGELGESDSTKLVWKPTTTTEM-DLDGMQKLMKLIEALEDDDDVQRVTANFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|163737452|ref|ZP_02144869.1| hypothetical protein RGBS107_18013 [Phaeobacter gallaeciensis
           BS107]
 gi|161388978|gb|EDQ13330.1| hypothetical protein RGBS107_18013 [Phaeobacter gallaeciensis
           BS107]
          Length = 246

 Score =  254 bits (650), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 178/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+ + +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKSTAGEGDDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y + +GD++  M  AI++ A +V   +  ++ YC   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVTYSATVGDADTVMMAAIDAGAEDVDSSEDGHVIYCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE+ S K++WKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSNALEGELGESDSTKLVWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|86140043|ref|ZP_01058607.1| hypothetical protein MED193_21641 [Roseobacter sp. MED193]
 gi|85823293|gb|EAQ43504.1| hypothetical protein MED193_21641 [Roseobacter sp. MED193]
          Length = 246

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA++SK+FSKL++EITV+AK+   +  +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAVRSKLFSKLAKEITVAAKMGDPDVDKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKKA   D  NY  IRYEGYGP GVA+I+E +TDN+NRTAS++RS F+K  
Sbjct: 61  VPKDVIERAIKKAIGGDAENYDEIRYEGYGPNGVAVIVETMTDNKNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE+ Y + +GD++  M  AIE+ A +V   +  +  YC+ +++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVTYKAEVGDADTVMMAAIEAGAEDVESTEDGHTIYCEDSDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE+++GE++S K++WKP     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 DVSNALEKELGESESTKLVWKPTTTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254441031|ref|ZP_05054524.1| conserved hypothetical protein TIGR01033 [Octadecabacter
           antarcticus 307]
 gi|198251109|gb|EDY75424.1| conserved hypothetical protein TIGR01033 [Octadecabacter
           antarcticus 307]
          Length = 251

 Score =  254 bits (648), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 179/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+ K+FSKLS+EIT++AK+   +P  NPRLR+AI+ AK  S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRGKLFSKLSKEITIAAKMGDPDPDHNPRLRMAIKEAKGLS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  IRYEGYGP GVA+I+EA+TDN+NRTAS++RS F+KA 
Sbjct: 61  MPKDNIDRAIKKAIGGDAENYDEIRYEGYGPGGVAVIVEAMTDNKNRTASTVRSTFSKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ G+++Y +  GD++  M  AIE+ A +   ++  ++  C  +++ 
Sbjct: 121 GNLGETGSVGFMFERKGQVLYLATAGDADTVMMAAIEAGAEDAQSDEDNHVIICADSDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K+IW+P  +  L + + V+ +++++E LEDDDD+QSV +N++ +
Sbjct: 181 DVSNALEAELGESESTKLIWQPNIHSDL-DLEGVEKLMRLVEALEDDDDIQSVTTNMDAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|294676441|ref|YP_003577056.1| hypothetical protein RCAP_rcc00884 [Rhodobacter capsulatus SB 1003]
 gi|294475261|gb|ADE84649.1| protein of unknown function DUF28 [Rhodobacter capsulatus SB 1003]
          Length = 246

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 116/243 (47%), Positives = 178/243 (73%), Gaps = 1/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA++SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK QS
Sbjct: 1   MAGHSKWANIQHRKGKQDAIRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ I+RAIKK+   D  +YT IRYEGYGP G+AII+EA+TDN NRTAS++RS FTK+ 
Sbjct: 61  MPKDVIDRAIKKSQMGDAADYTEIRYEGYGPNGIAIIVEAMTDNLNRTASNVRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G++G TGS +  F+++GEI Y + +GD++  M  A+E+ A +V  +++ +  YC    + 
Sbjct: 121 GNMGQTGSVSHGFDRVGEISYPAAVGDADAVMMAALEAGADDVESDEEGHWIYCSVEALS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S+ LE+ +GE+   K+IWKP     + + +  + ++K+I+ LE+DDDVQ+V  N ++ 
Sbjct: 181 EVSEALEKALGESTESKLIWKPQTTTEV-DLETAQKLMKLIDALEEDDDVQTVTHNFDVP 239

Query: 241 DDI 243
           +D+
Sbjct: 240 EDV 242


>gi|307294018|ref|ZP_07573862.1| protein of unknown function DUF28 [Sphingobium chlorophenolicum
           L-1]
 gi|306880169|gb|EFN11386.1| protein of unknown function DUF28 [Sphingobium chlorophenolicum
           L-1]
          Length = 247

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLAI  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSSMFSKLSREITVAAKMGMPDPDMNPRLRLAINAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D  NY  IRYEGYGP GVAII+EALTDNRNRTA+++R+ F+K  
Sbjct: 61  MPKDNIQRAIDKAIGGDTENYEEIRYEGYGPGGVAIIVEALTDNRNRTATNVRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++G+ +  F+++G I Y ++ GD++   E A+E+ A +V   + E+  +   + + 
Sbjct: 121 GNLGASGAVSHGFDRMGLITYPASAGDADAVFEAALEAGAEDVSSNEDEHEIWTAMDALH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K+G A+  K+ WKP   + +  ++   +++K+++ LEDDDDVQ+V+ N E++
Sbjct: 181 EVAKALESKLGPAEGAKLAWKPQTTVEVDESN-AATLMKLVDTLEDDDDVQTVWGNYEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254462000|ref|ZP_05075416.1| conserved hypothetical protein TIGR01033 [Rhodobacterales bacterium
           HTCC2083]
 gi|206678589|gb|EDZ43076.1| conserved hypothetical protein TIGR01033 [Rhodobacteraceae
           bacterium HTCC2083]
          Length = 246

 Score =  252 bits (644), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FSK S+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSKFSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   +  +Y  IRYEGYGP GVAII+E +TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDNIDRAIKKAIGGEGDDYEEIRYEGYGPNGVAIIVETMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ G+I Y ++ GD++  ME AIE+ A +    ++ +I  C+  ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGQITYDADAGDADKVMEAAIEAGAEDCESSEEGHIILCEDTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE  +GE+ S K+IW+P N     + + +  ++K+I+ LEDDDD+Q V +N E +
Sbjct: 181 EVSTALETALGESDSAKLIWQP-NISTEMDLEGMTKLMKLIDALEDDDDIQRVTANFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|255262233|ref|ZP_05341575.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
 gi|255104568|gb|EET47242.1| conserved hypothetical protein [Thalassiobium sp. R2A62]
          Length = 246

 Score =  252 bits (643), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 177/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FSKL++EITV+AK+   +P  NPRLR+A++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSKLAKEITVAAKMGDPDPDNNPRLRMAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+ + +  NY  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  VPKDVIDRAIKKSQAGEGDNYDEIRYEGYGPSGVAVIVEAMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ G + Y + +GD +  M  AIE+ A +V   +  ++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFERKGTVSYPAAVGDDDTVMMAAIEAGAEDVESGEDGHVVWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE+++GE+ S K++W+P     L + + ++ ++K+++ LEDDDD+Q+V +N E +
Sbjct: 181 DVSTALEQELGESDSTKLVWRPTTTTEL-DLEGMQKLMKLVDALEDDDDIQTVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|114771672|ref|ZP_01449076.1| hypothetical protein OM2255_13329 [alpha proteobacterium HTCC2255]
 gi|114547744|gb|EAU50634.1| hypothetical protein OM2255_13329 [alpha proteobacterium HTCC2255]
          Length = 246

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 122/246 (49%), Positives = 181/246 (73%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAI KA   D  NY  IRYEGYGP GVA+I+EA+TDN+NRTASS+RS+FTK+ 
Sbjct: 61  VPKDVIDRAIGKATGGDDENYDEIRYEGYGPNGVAVIVEAMTDNKNRTASSVRSLFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+L  TG+ +  FE+ G ++Y +  G+ +   E AI++ A +V   +  +  YC   ++ 
Sbjct: 121 GNLAETGAVSFMFERKGLVVYGAEAGNVDAMFEHAIDAGAEDVESTEDGHDIYCASTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKP--LNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
             SK LE  +GE+++ K+IWKP  +  + LS A+K   I+++IENLEDDDD+Q+V +N++
Sbjct: 181 DVSKALELALGESETTKLIWKPTTMTELDLSGAEK---IMRLIENLEDDDDIQNVTTNMD 237

Query: 239 IADDII 244
           ++D+I+
Sbjct: 238 VSDEIM 243


>gi|294013342|ref|YP_003546802.1| hypothetical protein SJA_C1-33560 [Sphingobium japonicum UT26S]
 gi|292676672|dbj|BAI98190.1| conserved hypothetical protein [Sphingobium japonicum UT26S]
          Length = 247

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 176/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLA+  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSSMFSKLSREITVAAKMGMPDPDMNPRLRLAVNAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D+ NY  IRYEGYGP GVAII+EALTDNRNRTA+++R+ F+K  
Sbjct: 61  MPKDNIQRAIDKAIGGDMENYEEIRYEGYGPGGVAIIVEALTDNRNRTATNVRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++G+ +  F+++G I Y ++ GD++   E A+E+ A +V   + E+  +   + + 
Sbjct: 121 GNLGASGAVSHGFDRMGLITYPASAGDADAIFEAALEAGADDVSSNEDEHEIWTAMDALH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE K+G A+  K+ WKP   + +  ++   +++K+++ LEDDDDVQ+V+ N E++
Sbjct: 181 EVARGLEAKLGPAEGAKLAWKPQTTVEVDESN-AATLMKLVDTLEDDDDVQTVWGNYEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|85714398|ref|ZP_01045386.1| hypothetical protein NB311A_15642 [Nitrobacter sp. Nb-311A]
 gi|85698845|gb|EAQ36714.1| hypothetical protein NB311A_15642 [Nitrobacter sp. Nb-311A]
          Length = 248

 Score =  251 bits (641), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA KSK+FSKL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  +RYEGYGP GVA+I+E LTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKASGNDAENYDELRYEGYGPGGVAVIMEVLTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++G I Y  + G ++  +E AIE+ A +V+  +  +  Y    +  
Sbjct: 121 GNLGETGSVSFMFDRLGVIEYDPDKGSADDMLEAAIEAGADDVVSGEGGHEIYASQESFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE+K GEA+ + +IWKP N + + + +  + ++K+I+ L + DDVQ+VY+N E++
Sbjct: 181 DVAKALEDKFGEARKVALIWKPQNTLAVDD-NTGEKLLKLIDQLNEHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|310816667|ref|YP_003964631.1| hypothetical protein EIO_2235 [Ketogulonicigenium vulgare Y25]
 gi|308755402|gb|ADO43331.1| conserved hypothetical protein [Ketogulonicigenium vulgare Y25]
          Length = 250

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 176/244 (72%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D ++SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGKQDGIRSKLFSKLAKEITVAAKMGDPDPDKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+   D   Y  IRYEGYGP GVA+I+EALTDNRNRTAS++RS FTK  
Sbjct: 61  VPKDVIDRAIKKSQGGDAETYDAIRYEGYGPNGVAVIVEALTDNRNRTASNVRSFFTKTG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG + S    F++ GEI Y +  GD++  M  A+E+ A +V  +D+ +  YC    + 
Sbjct: 121 GNLGESNSVAFMFDRKGEIAYKAEAGDADTVMMAALEAGADDVESDDEGHWIYCGDTALN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE  +GE+++ K +W+P     +++ + ++ +++++E LEDDDDVQ+V +N+E++
Sbjct: 181 EVSTALEAALGESETAKFVWQPQTTAPVTDLETLQKVMRLVELLEDDDDVQNVTTNMEVS 240

Query: 241 DDII 244
           D+++
Sbjct: 241 DELM 244


>gi|85709537|ref|ZP_01040602.1| glucose-1-phosphate adenylyl transferase [Erythrobacter sp. NAP1]
 gi|85688247|gb|EAQ28251.1| glucose-1-phosphate adenylyl transferase [Erythrobacter sp. NAP1]
          Length = 248

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLAI  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSNLFSKLSREITVAAKMGAPDPDMNPRLRLAINTAKGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA + D  NY  +RYEGYGP G AII+EALTDNRNRTA+++R+ F+K  
Sbjct: 61  MPKDNIQRAIDKASAADGENYEEVRYEGYGPGGSAIIVEALTDNRNRTATAVRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ GS    FE++G I Y ++ GD    +E A+E+ A ++   D  +  +    ++ 
Sbjct: 121 GNLGTEGSVAHGFERVGYIEYGADAGDEEKVLEAALEAGAEDIASSDDGHEIWTAAEDLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE+ +GEA+ +K+ WKP N     +     +++K+I+ LEDDDDVQ+V+ N EI+
Sbjct: 181 EVSSNLEKALGEAKEVKLAWKP-NLTVEMDEKGAGTLLKLIDALEDDDDVQTVWGNYEIS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254454053|ref|ZP_05067490.1| conserved hypothetical protein TIGR01033 [Octadecabacter
           antarcticus 238]
 gi|198268459|gb|EDY92729.1| conserved hypothetical protein TIGR01033 [Octadecabacter
           antarcticus 238]
          Length = 251

 Score =  250 bits (638), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 177/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+ K+FSKLS+EIT++AK+   +P  NPRLR+AI+ AK  S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRGKLFSKLSKEITIAAKMGDPDPDHNPRLRMAIKEAKVLS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  IRYEGYGP GVA+I+EA+TDN+NRTAS++RS F+KA 
Sbjct: 61  MPKDNIDRAIKKAIGGDAENYDEIRYEGYGPGGVAVIVEAMTDNKNRTASTVRSTFSKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ G++IY +++GD +  M  AIE+ A +   ++  ++  C  +++ 
Sbjct: 121 GNLGETGSVGFMFDRKGQVIYPASVGDDDTVMMAAIEAGAEDAQSDEDGHVIICADSDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE  +GE+ S K+IW+P N     + + V+ +++++E LEDDDD+QSV +N++ +
Sbjct: 181 DVSNALEANLGESFSTKLIWQP-NIQSELDLEGVEKLMRLVEALEDDDDIQSVTTNMDAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254511970|ref|ZP_05124037.1| conserved hypothetical protein TIGR01033 [Rhodobacteraceae
           bacterium KLH11]
 gi|221535681|gb|EEE38669.1| conserved hypothetical protein TIGR01033 [Rhodobacteraceae
           bacterium KLH11]
          Length = 246

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 174/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+ + +   Y  IRYEGYGP GVA+I+E +TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIDRAIKKSVAGEGDEYEEIRYEGYGPNGVAVIVETMTDNRNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GE++Y ++ GD++   E AIE+ A +V   +  +I +C   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEVVYQADAGDADTIFEAAIEAGAEDVESSEDGHIIWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE  +GE++S K++WKP     L   D ++ ++K+++ LEDDDDVQ V +N E  
Sbjct: 181 DVSNALEGALGESESTKLVWKPTTTTELGLED-MQKLMKLVDALEDDDDVQRVTTNFEAT 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|115526759|ref|YP_783670.1| hypothetical protein RPE_4771 [Rhodopseudomonas palustris BisA53]
 gi|122294482|sp|Q07H94|Y4771_RHOP5 RecName: Full=UPF0082 protein RPE_4771
 gi|115520706|gb|ABJ08690.1| protein of unknown function DUF28 [Rhodopseudomonas palustris
           BisA53]
          Length = 248

 Score =  249 bits (637), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/244 (51%), Positives = 169/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA KSK+FSKL+REITV+AKL   +P  N RLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGAPDPAMNARLRSAIIAARQEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGSDGDNYDEMRYEGYGPGGVAVIVEALTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F+  G I Y + +  ++  ++ AIE+ A +VL  D  +  Y   +   
Sbjct: 121 GNLGETGSVAFMFDHTGLIEYDAGVASADDVLDAAIEAGADDVLSSDTGHEVYASHDTFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GEA+   +IWKP N + + + +  + ++K+I+ L + DDVQ+VY+N EI+
Sbjct: 181 EVAKALEAKFGEARKAALIWKPQNTVPVDD-ETGEKLLKLIDLLNEHDDVQNVYANFEIS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|221640111|ref|YP_002526373.1| hypothetical protein RSKD131_2012 [Rhodobacter sphaeroides KD131]
 gi|254801523|sp|B9KL75|Y2012_RHOSK RecName: Full=UPF0082 protein RSKD131_2012
 gi|221160892|gb|ACM01872.1| Hypothetical Protein RSKD131_2012 [Rhodobacter sphaeroides KD131]
          Length = 248

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 176/243 (72%), Gaps = 1/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK  S
Sbjct: 1   MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ IERAIKK+   D  +Y+ IRYEGYGP G+AII+E +TDN NRTAS++RS FTK  
Sbjct: 61  MPKDVIERAIKKSQGGDAEDYSEIRYEGYGPNGIAIIVETMTDNVNRTASNVRSYFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+TGS +  F+++GEI Y    GD++  M  AIE+ A +V  +++ +  YC   ++ 
Sbjct: 121 GNLGTTGSVSFMFDRVGEITYKPEAGDADTVMMAAIEAGAEDVESDEEGHWIYCGDTSLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S+ LE+ +GE++  K++WKP N   + + +  + ++K+I+ LE+DDDVQ+V  N +I 
Sbjct: 181 EVSEALEKVLGESEEAKLVWKPQNRTNV-DLETAQKLMKLIDALEEDDDVQTVTGNFDIP 239

Query: 241 DDI 243
           +D+
Sbjct: 240 EDV 242


>gi|149914396|ref|ZP_01902927.1| hypothetical protein RAZWK3B_20386 [Roseobacter sp. AzwK-3b]
 gi|149811915|gb|EDM71748.1| hypothetical protein RAZWK3B_20386 [Roseobacter sp. AzwK-3b]
          Length = 249

 Score =  248 bits (634), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 174/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLR+A++ AK  S
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRMAVKEAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKK+ + +  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  VPKDVIERAIKKSQAGEGDDYEEIRYEGYGPGGVAVIVEAMTDNRNRTASNVRSTFTKHG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    FE+ GEI Y +  GD++  M  AIE+ A +V   ++ +  +C   ++ 
Sbjct: 121 GNLGETGSVAFMFERKGEISYPAEAGDADTVMMAAIEAGAEDVESSEEGHTVWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE+ S ++ W+P     L + + ++ ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 DVSTALEAELGESASTRLAWRPATTTEL-DLEGMQKLMKLVDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|126463068|ref|YP_001044182.1| hypothetical protein Rsph17029_2308 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332559115|ref|ZP_08413437.1| hypothetical protein RSWS8N_08670 [Rhodobacter sphaeroides WS8N]
 gi|166227725|sp|A3PM44|Y2308_RHOS1 RecName: Full=UPF0082 protein Rsph17029_2308
 gi|126104732|gb|ABN77410.1| protein of unknown function DUF28 [Rhodobacter sphaeroides ATCC
           17029]
 gi|332276827|gb|EGJ22142.1| hypothetical protein RSWS8N_08670 [Rhodobacter sphaeroides WS8N]
          Length = 248

 Score =  248 bits (633), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 176/243 (72%), Gaps = 1/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK  S
Sbjct: 1   MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ IERAIKK+   D  +Y+ IRYEGYGP G+AII+E +TDN NRTAS++RS FTK  
Sbjct: 61  MPKDVIERAIKKSQGGDAEDYSEIRYEGYGPNGIAIIVETMTDNVNRTASNVRSYFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+TGS +  F+++GEI Y    GD++  M  AIE+ A +V  +++ +  YC   ++ 
Sbjct: 121 GNLGTTGSVSFMFDRVGEITYKPEAGDADTVMMAAIEAGADDVESDEEGHWIYCGDTSLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S+ LE+ +GE++  K++WKP N   + + +  + ++K+I+ LE+DDDVQ+V  N +I 
Sbjct: 181 EVSEALEKVLGESEEAKLVWKPQNRTNV-DLETAQKLMKLIDALEEDDDVQTVTGNFDIP 239

Query: 241 DDI 243
           +D+
Sbjct: 240 EDV 242


>gi|77464226|ref|YP_353730.1| hypothetical protein RSP_0655 [Rhodobacter sphaeroides 2.4.1]
 gi|119391299|sp|Q3J055|Y2261_RHOS4 RecName: Full=UPF0082 protein RHOS4_22610
 gi|77388644|gb|ABA79829.1| Conserved hypothetical [Rhodobacter sphaeroides 2.4.1]
          Length = 248

 Score =  248 bits (633), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 176/243 (72%), Gaps = 1/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK  S
Sbjct: 1   MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ IERAIKK+   D  +Y+ IRYEGYGP G+AII+E +TDN NRTAS++RS FTK  
Sbjct: 61  MPKDVIERAIKKSQGGDAEDYSEIRYEGYGPNGIAIIVETMTDNVNRTASNVRSYFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+TGS +  F+++GEI Y    GD++  M  AIE+ A +V  +++ +  YC   ++ 
Sbjct: 121 GNLGTTGSVSFMFDRVGEITYKPAAGDADTVMMAAIEAGADDVESDEEGHWIYCGDTSLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S+ LE+ +GE++  K++WKP N   + + +  + ++K+I+ LE+DDDVQ+V  N +I 
Sbjct: 181 EVSEALEKVLGESEEAKLVWKPQNRTNV-DLETAQKLMKLIDALEEDDDVQTVTGNFDIP 239

Query: 241 DDI 243
           +D+
Sbjct: 240 EDV 242


>gi|149184939|ref|ZP_01863256.1| glucose-1-phosphate adenylyl transferase [Erythrobacter sp. SD-21]
 gi|148831050|gb|EDL49484.1| glucose-1-phosphate adenylyl transferase [Erythrobacter sp. SD-21]
          Length = 248

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 174/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLA+  AK+QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSNLFSKLSREITVAAKMGMPDPDMNPRLRLAVNAAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA + D  NY  +RYEGYGP G AII+EALTDNRNRTA+++R+ F+K  
Sbjct: 61  MPKDNIQRAIDKASASDAENYEEVRYEGYGPGGSAIIVEALTDNRNRTATAVRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ GS    FE++G I Y ++ GD +  +E A+E+ A ++   +  +  +   +++ 
Sbjct: 121 GNLGTEGSVQHGFERLGLIEYPASAGDEDKVLEAAMEAGAEDIESSEDGHTIWTAADDLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE+ +GEA+++K+ WKP N     +     ++IK+I+ LEDDDDVQ+V+ N EI+
Sbjct: 181 QVAGDLEKALGEAENVKLAWKP-NLTVDMDEKGAGTLIKLIDALEDDDDVQTVWGNYEIS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254485951|ref|ZP_05099156.1| conserved hypothetical protein TIGR01033 [Roseobacter sp. GAI101]
 gi|214042820|gb|EEB83458.1| conserved hypothetical protein TIGR01033 [Roseobacter sp. GAI101]
          Length = 247

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 177/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L++K+FSK+S+EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRAKVFSKMSKEITVAAKMGDPDPDKNPRLRLAVKEAKSVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+ + D  +Y  IRYEGYGP GVA+I+EA+TDNRNRTAS +RS FTK  
Sbjct: 61  VPKDVIDRAIKKSQAGDGEDYEEIRYEGYGPNGVAVIVEAMTDNRNRTASVVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ GEI Y +++GD++  M  AIE+ A +V   +  ++ +C   ++ 
Sbjct: 121 GNLGETGSVGFMFDRKGEITYPASVGDADTVMMAAIEAGAEDVESSEDGHVIWCLDTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE ++GE+ S K++WKP     + + + ++ ++K+I+ LEDDDDVQ V +N E +
Sbjct: 181 EVATALEAELGESDSTKLVWKPSITTEM-DLESMQKLMKLIDALEDDDDVQRVTTNFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|146276629|ref|YP_001166788.1| hypothetical protein Rsph17025_0577 [Rhodobacter sphaeroides ATCC
           17025]
 gi|166229072|sp|A4WQ19|Y577_RHOS5 RecName: Full=UPF0082 protein Rsph17025_0577
 gi|145554870|gb|ABP69483.1| protein of unknown function DUF28 [Rhodobacter sphaeroides ATCC
           17025]
          Length = 248

 Score =  247 bits (631), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 117/243 (48%), Positives = 176/243 (72%), Gaps = 1/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK  S
Sbjct: 1   MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGDPDPDKNPRLRLAVKAAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ IERAIKK+   D  +Y+ IRYEGYGP G+AII+E +TDN NRTAS++RS FTK  
Sbjct: 61  MPKDVIERAIKKSQGGDAEDYSEIRYEGYGPNGIAIIVETMTDNVNRTASNVRSYFTKFG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+TGS +  F+++GEI Y    GD++  M  AIE+ A +V  ++  +  YC   ++ 
Sbjct: 121 GNLGTTGSVSFMFDRVGEITYKPAAGDADTVMMAAIEAGADDVESDEDGHWIYCGDTSLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S+ LE+ +GE++  K++WKP N   + + +  + ++K+I+ LE+DDDVQ+V +N +I 
Sbjct: 181 EVSEALEKVLGESEEAKLVWKPQNRTNV-DLETAQKLMKLIDALEEDDDVQTVTANFDIP 239

Query: 241 DDI 243
           +D+
Sbjct: 240 EDV 242


>gi|86751376|ref|YP_487872.1| hypothetical protein RPB_4273 [Rhodopseudomonas palustris HaA2]
 gi|119391999|sp|Q2IS49|Y4273_RHOP2 RecName: Full=UPF0082 protein RPB_4273
 gi|86574404|gb|ABD08961.1| Protein of unknown function DUF28 [Rhodopseudomonas palustris HaA2]
          Length = 248

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++DA +SK FSKL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGKQDAQRSKAFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGGDSENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSFFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F++ G I Y ++   ++  +E AIE+ A +V   +  +  Y   +   
Sbjct: 121 GNLGETGSVSFMFDRTGVIEYDADKASADDMLEAAIEAGADDVASSESGHEVYASQDTFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GEA+   +IWKP N + + + +  + + K++++L D DDVQ+VY+N E++
Sbjct: 181 DVAKALEAKFGEARKAALIWKPQNTVAVDD-ETGEKLFKLMDHLNDHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|90426278|ref|YP_534648.1| hypothetical protein RPC_4807 [Rhodopseudomonas palustris BisB18]
 gi|119372137|sp|Q20X07|Y4807_RHOPB RecName: Full=UPF0082 protein RPC_4807
 gi|90108292|gb|ABD90329.1| protein of unknown function DUF28 [Rhodopseudomonas palustris
           BisB18]
          Length = 248

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 172/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA KSK+FSKL+REITV+AKL   +P  N RLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPAMNARLRSAIIAARQEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGSDGENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++ G I + + +  ++  ++ AIE+ A +VL  D  +  Y   ++  
Sbjct: 121 GNLGETGSVAFMFDRTGIIEFDAKVASADDMLDAAIEAGADDVLSSDSGHEVYASQDSFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE+K GEA+   + WKP N + + + +  + ++K+I+ L++ DDVQ+VY+N E++
Sbjct: 181 EVAKALEQKFGEARKAALTWKPQNTVPVDD-ETGEKLLKLIDLLQEHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|126727914|ref|ZP_01743741.1| hypothetical protein RB2150_16669 [Rhodobacterales bacterium
           HTCC2150]
 gi|126702806|gb|EBA01912.1| hypothetical protein RB2150_16669 [Rhodobacterales bacterium
           HTCC2150]
          Length = 247

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 175/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSKLAKEITVAAKMGDPDPDKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+   D   Y  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  VPKDVIDRAIKKSVGGDAETYDEIRYEGYGPGGVAVIVEAMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F++IG++IY + +GD +  M  AIE+ A +     + +I  C   ++ 
Sbjct: 121 GNLGETGSVGFMFDRIGQVIYPAAVGDDDTVMMAAIEAGANDCESSVEGHIITCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE+ S K+IW+P N     + + ++ ++K+I+ LEDDDD+Q + +N E++
Sbjct: 181 EVSTALEAELGESDSTKLIWQP-NISTELDLEGMEKLMKLIDALEDDDDIQRITANFEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|75676913|ref|YP_319334.1| hypothetical protein Nwi_2729 [Nitrobacter winogradskyi Nb-255]
 gi|119391327|sp|Q3SP09|Y2729_NITWN RecName: Full=UPF0082 protein Nwi_2729
 gi|74421783|gb|ABA05982.1| Protein of unknown function DUF28 [Nitrobacter winogradskyi Nb-255]
          Length = 248

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 123/244 (50%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA KSK+FSKL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  +Y  +RYEGYGP GVA+I+E LTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKASGNDAESYDELRYEGYGPGGVAVIMEVLTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++G I Y ++    +  +E AIE+ A +V+ ++  +  Y   +   
Sbjct: 121 GNLGETGSVSFMFDRLGVIEYDADKASVDDMLEAAIEAGADDVVSDEGGHEIYASQDTFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE   GEA+ + +IWKP N I + + +  + ++K+I+ L + DDVQ+VY+N E++
Sbjct: 181 DVAKALESTFGEARKVALIWKPQNTIAVDD-NTGEKLLKLIDLLNEHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D +I
Sbjct: 240 DALI 243


>gi|299134167|ref|ZP_07027360.1| protein of unknown function DUF28 [Afipia sp. 1NLS2]
 gi|298590914|gb|EFI51116.1| protein of unknown function DUF28 [Afipia sp. 1NLS2]
          Length = 248

 Score =  244 bits (623), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 123/242 (50%), Positives = 170/242 (70%), Gaps = 3/242 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++DA++SKIF KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGKQDAMRSKIFGKLAREITVAAKLGTPDPAMNPRLRAAVIAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  +Y  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGGEGESYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+ +G I Y +   D+   +E AI++ A +V+  +  +  Y    ++ 
Sbjct: 121 GNLGETGSVSFMFDHVGVIEYDAAKADAETMLEAAIDAGADDVVSSEDGHEIYTSQASLS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKV-KSIIKMIENLEDDDDVQSVYSNLEI 239
             +K LE K GE +   +IWKP N I +S  D+V + + K+++ L + DDVQ+VY+N E+
Sbjct: 181 EAAKALEAKFGEPRKAALIWKPQNNIAVS--DEVGEKLFKLLDQLNEHDDVQNVYANFEV 238

Query: 240 AD 241
           +D
Sbjct: 239 SD 240


>gi|119384640|ref|YP_915696.1| hypothetical protein Pden_1905 [Paracoccus denitrificans PD1222]
 gi|166227488|sp|A1B3A6|Y1905_PARDP RecName: Full=UPF0082 protein Pden_1905
 gi|119374407|gb|ABL70000.1| protein of unknown function DUF28 [Paracoccus denitrificans PD1222]
          Length = 246

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 172/245 (70%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGKQDKLRSKLFSKLAKEITVAAKMGDPDPEKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ I+RAIKK+   D  NY  IRYEGYGP G+AII+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  MPKDVIDRAIKKSQGGDAENYDEIRYEGYGPNGIAIIVEAMTDNRNRTASNVRSYFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G LG TGS +  F++ GEI+Y  + GD++  M  AIE+ A +V  ++  +  Y    ++ 
Sbjct: 121 GDLGQTGSVSFMFDRKGEILYKPDAGDADTVMMAAIEAGAEDVESDEDGHWIYTADTDLA 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKP--LNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
             S  LE  +GE++  K+IWKP     I L  A K   ++K+I+ LE+DDDVQ+V  N +
Sbjct: 181 EVSTALEASLGESEHAKLIWKPQAPTEIDLETATK---LMKLIDALEEDDDVQNVTGNFD 237

Query: 239 IADDI 243
           I +++
Sbjct: 238 IPEEV 242


>gi|154252561|ref|YP_001413385.1| hypothetical protein Plav_2114 [Parvibaculum lavamentivorans DS-1]
 gi|189035388|sp|A7HUZ5|Y2114_PARL1 RecName: Full=UPF0082 protein Plav_2114
 gi|154156511|gb|ABS63728.1| protein of unknown function DUF28 [Parvibaculum lavamentivorans
           DS-1]
          Length = 248

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 174/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIM+RK  +D  +SK+F+KL++EITV+AK+   +P  NPRLR AIQ A+ ++
Sbjct: 1   MAGHSQFKNIMYRKGAQDKKRSKLFAKLAKEITVAAKMGLPDPEYNPRLRAAIQAARVEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKK+      NY  +RYEG+GP G+ +I+E LTDNRNRTA  +RSIFTK  
Sbjct: 61  MPKDNIERAIKKSSDQGGENYEEVRYEGFGPGGIGVIVETLTDNRNRTAGEVRSIFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TG+ +  F+++G I Y ++   ++  +E AIE+ A +    +  +  YC  + + 
Sbjct: 121 GNLGETGAVSFMFDRLGLIEYPADAASADDMIEAAIEAGADDCQSGEAGHELYCAPDALH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE K GEA++ +++WKP N I L + +K ++++KM+E L+D+DDVQ VY+N E++
Sbjct: 181 EVAQGLESKFGEARAARIVWKPQNTIALED-EKAETVLKMLEALDDNDDVQQVYANFEMS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DSLM 243


>gi|27376645|ref|NP_768174.1| hypothetical protein blr1534 [Bradyrhizobium japonicum USDA 110]
 gi|33517014|sp|Q89U83|Y1534_BRAJA RecName: Full=UPF0082 protein blr1534
 gi|27349786|dbj|BAC46799.1| blr1534 [Bradyrhizobium japonicum USDA 110]
          Length = 248

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA KSK+F KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQKSKLFGKLAREITVAAKLGTPDPAMNPRLRAAVIAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKALGSDGENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSFFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F++ G I Y  ++   +  ++ AIE+ A +V+  +  +  Y       
Sbjct: 121 GNLGETGSVSFMFDRTGIIEYDRSVASDDAVLDAAIEAGADDVVSGEGGHEIYASTEGYR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GE +   +IWKP N + + + +  + ++K+++ L + DDVQ+VY+N E++
Sbjct: 181 DVAKALEAKFGEPRKAALIWKPQNTVAVDD-ETGEKLLKLMDLLNEHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALV 243


>gi|91978632|ref|YP_571291.1| hypothetical protein RPD_4171 [Rhodopseudomonas palustris BisB5]
 gi|123762431|sp|Q130U9|Y4171_RHOPS RecName: Full=UPF0082 protein RPD_4171
 gi|91685088|gb|ABE41390.1| protein of unknown function DUF28 [Rhodopseudomonas palustris
           BisB5]
          Length = 248

 Score =  241 bits (615), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++DA +SK FSKL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGKQDAQRSKAFSKLAREITVAAKLGTPDPAMNPRLRAAVIAARQEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGGDSENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F++ G I Y +    ++  ++ AIE+ A +VL  +  +  +       
Sbjct: 121 GNLGETGSVSFMFDRTGVIEYDAGKASADDMLDAAIEAGADDVLSSEGGHEVFASQETFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GE +   +IWKP N + + + +  + + K++E+L + DDVQ+VY+N E++
Sbjct: 181 DVAKALEAKFGEPRKAALIWKPQNTVAVDD-ETGEKLFKLMEHLNEHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|87198444|ref|YP_495701.1| hypothetical protein Saro_0419 [Novosphingobium aromaticivorans DSM
           12444]
 gi|119391997|sp|Q2GBA6|Y419_NOVAD RecName: Full=UPF0082 protein Saro_0419
 gi|87134125|gb|ABD24867.1| protein of unknown function DUF28 [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 254

 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 173/251 (68%), Gaps = 8/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLR AI  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSAMFSKLSREITVAAKMGMPDPDMNPRLRAAINAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI RAI KA   +  NY  +RYEGYGP GVAII+EALTDNRNRTA+++R+ F K  
Sbjct: 61  MPKDNIARAIDKASKGEGDNYEEVRYEGYGPGGVAIIVEALTDNRNRTATNVRTAFAKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV---LFEDQE----YIFY 173
           G+LG++G+ +  FE++G I Y   +GD    +E AIE+ A +V   + +  E    +  +
Sbjct: 121 GNLGASGAVSHGFERLGLIEYPGKVGDEEKVLEAAIEAGAEDVESDMGDGDENPGSHQIW 180

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
               ++   +++LE+ +GEA+ +K+ WKP     + +AD   +++K+I+ LEDDDDVQ+V
Sbjct: 181 VAVESLHEVARELEKTLGEAEGVKLAWKPSMKTSV-DADNAATLLKLIDVLEDDDDVQTV 239

Query: 234 YSNLEIADDII 244
           + N +I DD++
Sbjct: 240 WGNYDIPDDVM 250


>gi|89055871|ref|YP_511322.1| hypothetical protein Jann_3380 [Jannaschia sp. CCS1]
 gi|119391968|sp|Q28LW5|Y3380_JANSC RecName: Full=UPF0082 protein Jann_3380
 gi|88865420|gb|ABD56297.1| protein of unknown function DUF28 [Jannaschia sp. CCS1]
          Length = 255

 Score =  241 bits (614), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 174/251 (69%), Gaps = 8/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L++K+FSK+S+EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRAKVFSKMSKEITVAAKMGDPDPDKNPRLRLAVKEAKSVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAI KA   D  NY  IRYEGYGP GVA+I+E +TDN+NRTAS++RS FTK  
Sbjct: 61  VPKDVIERAIAKATGGDSENYDEIRYEGYGPNGVAVIVETMTDNKNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE-------YIFY 173
           G+LG TGS    F++ G++ Y  + GD++  M  AIE+ A +V   + +       ++ +
Sbjct: 121 GNLGETGSVGFMFDRKGQVTYPLSAGDADTIMMAAIEAGAEDVETNEGDGDEDLGGHVIW 180

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           C   ++   S  LE  +GE++S K++W+P     L   D  K ++++I+ LE+DDDVQ+V
Sbjct: 181 CADTDLNDVSNALEADLGESESTKLVWRPTTTTELGLEDAQK-LMRLIDALEEDDDVQTV 239

Query: 234 YSNLEIADDII 244
            +N EI+D+++
Sbjct: 240 TANFEISDEVM 250


>gi|92118985|ref|YP_578714.1| hypothetical protein Nham_3525 [Nitrobacter hamburgensis X14]
 gi|119391973|sp|Q1QHP3|Y3525_NITHX RecName: Full=UPF0082 protein Nham_3525
 gi|91801879|gb|ABE64254.1| protein of unknown function DUF28 [Nitrobacter hamburgensis X14]
          Length = 248

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 171/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA KSK+FSKL+REITV+AKL   +P  N RLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQKSKLFSKLAREITVAAKLGTPDPAMNARLRAAMIAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  +Y  +RYEGYGP GVAII+E LTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKASGHDAESYDELRYEGYGPGGVAIIMEVLTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++G + Y ++   ++  +E A+E+ A +V+  +  +  Y       
Sbjct: 121 GNLGETGSVSFMFDRLGVVEYDADKASADDMLEAAVEAGADDVVSGEGGHEIYASQETFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE K GEA+ + +IWKP N + + + +  + ++K+I+ L + DDVQ+VY+N E++
Sbjct: 181 DVARALEGKFGEARKVALIWKPQNTVAVDD-NTGEKLLKLIDLLNEHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|84515307|ref|ZP_01002669.1| hypothetical protein SKA53_01576 [Loktanella vestfoldensis SKA53]
 gi|84510590|gb|EAQ07045.1| hypothetical protein SKA53_01576 [Loktanella vestfoldensis SKA53]
          Length = 249

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 176/244 (72%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FSKL++EITV+AK+   +P +NPRLRLA++ AK+ S
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSKLAKEITVAAKMGDPDPEKNPRLRLAVKEAKSNS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
            PK+ I+RAIKK+   D  NY  IRYEGYGP G+A+I+EA+TDNRNRTAS++RS FTK  
Sbjct: 61  CPKDVIDRAIKKSQGGDAENYDEIRYEGYGPGGIAVIVEAMTDNRNRTASTVRSTFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS    F+++GEI+Y +++ D++  M  AIE+ A +V  +D  ++ YC   ++ 
Sbjct: 121 GNLGETGSVAFMFDRMGEIVYPASVADADTVMMAAIEAGAEDVQSDDDNHVIYCADTDLA 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE  +GE+ S K+IWKP N     +A+ +  ++K+++ LEDDDDVQ V +N E +
Sbjct: 181 EVSGALEPALGESISTKLIWKP-NMTTEVDAEGLTKLMKLLDTLEDDDDVQRVTANFEAS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DAVM 243


>gi|217978451|ref|YP_002362598.1| hypothetical protein Msil_2305 [Methylocella silvestris BL2]
 gi|254801297|sp|B8EIB7|Y2305_METSB RecName: Full=UPF0082 protein Msil_2305
 gi|217503827|gb|ACK51236.1| protein of unknown function DUF28 [Methylocella silvestris BL2]
          Length = 248

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 167/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMH+K ++DA++SK+FSKL+REITV+AKL   +P  N RLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKLGLPDPNMNARLRAAVIAARVEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGYGP GVA+I+EALTDNRNRTA  IRS FTK  
Sbjct: 61  MPKDNIERAIKKASGADAENYDEVRYEGYGPGGVAVIVEALTDNRNRTAGEIRSYFTKVG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+L  TG+ +  F+ IG I + + +G     +E AIE+ A +VL  ++ +        + 
Sbjct: 121 GALAETGAVSFMFDHIGRIEFPAKVGSEEAMLEAAIEAGAEDVLSGEEGHEVLTSLEMLR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE K GE     +IWKP N I L + +  + ++++I  LED+DDVQ+VY+N E++
Sbjct: 181 DVALALEAKFGEPTRASLIWKPQNTISLDD-ETGEKVLRLIGLLEDNDDVQNVYANYEVS 239

Query: 241 DDII 244
           + ++
Sbjct: 240 EAVL 243


>gi|329888416|ref|ZP_08267014.1| hypothetical protein BDIM_03390 [Brevundimonas diminuta ATCC 11568]
 gi|328846972|gb|EGF96534.1| hypothetical protein BDIM_03390 [Brevundimonas diminuta ATCC 11568]
          Length = 257

 Score =  238 bits (606), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 119/251 (47%), Positives = 169/251 (67%), Gaps = 10/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA++SK+FS+LSREITV+AK    +P  NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAVRSKLFSRLSREITVAAKSGMPDPAMNPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENIERAIKKA   ++     IRYEG GP GV +I+E LTDNRNR AS +RS F K  
Sbjct: 61  MPKENIERAIKKASGGEVDAMEEIRYEGRGPGGVQVIVEVLTDNRNRAASGVRSAFAKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV--------LFEDQE-YI 171
           G+LG +GS T  ++++G+I Y +  G  +  ME AIE+ A +V        ++ED   + 
Sbjct: 121 GALGESGSVTFMWDRVGKIHYPAEAGSEDAVMEAAIEAGAADVESDLVKPDIYEDAPGHT 180

Query: 172 FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
            +  F ++   ++ + + +G+ +S  ++WKP + I L+  D V  + K+++ L+ +DDVQ
Sbjct: 181 IWTAFEDLNEVAEAMSKVLGDPKSTAIVWKPQSEIDLTG-DSVGVLFKLLDALDGEDDVQ 239

Query: 232 SVYSNLEIADD 242
            VYSN  I+D+
Sbjct: 240 QVYSNENISDE 250


>gi|326386110|ref|ZP_08207734.1| hypothetical protein Y88_2002 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209335|gb|EGD60128.1| hypothetical protein Y88_2002 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 247

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLR AI  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSAMFSKLSREITVAAKMGMPDPDMNPRLRAAINAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D  NY  +RYEGYGP GVAII+EALTDNRNRTA+++R+ F K  
Sbjct: 61  MPKDNIQRAIDKASKGDGENYEEVRYEGYGPGGVAIIVEALTDNRNRTATNVRTAFAKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++G+ +  F+++G I Y   +GD    +E AIE+ A +V  +D+ +  +    N+ 
Sbjct: 121 GNLGASGAVSHGFDRLGLIEYPGKVGDEEKVLEAAIEAGAEDVESDDESHQIWVAVENLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +++LE+ +GEA+ +K+ W+P       +AD   ++IK+I+ L+DDDDVQ+V+ N EI 
Sbjct: 181 EVARELEKALGEAEGVKLAWRP-TLKTTVDADTATTLIKLIDTLDDDDDVQTVWGNYEIP 239

Query: 241 DDII 244
           DD++
Sbjct: 240 DDVM 243


>gi|209886417|ref|YP_002290274.1| hypothetical protein OCAR_7305 [Oligotropha carboxidovorans OM5]
 gi|226708050|sp|B6JJ00|Y7305_OLICO RecName: Full=UPF0082 protein OCAR_7305
 gi|209874613|gb|ACI94409.1| conserved hypothetical protein [Oligotropha carboxidovorans OM5]
          Length = 248

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 173/244 (70%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++DA++SK+F KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGKQDAMRSKVFGKLAREITVAAKLGTPDPAMNPRLRAAVLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGGDSENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++G I Y ++   ++  +E AIE+ A +V   ++ +  Y    ++ 
Sbjct: 121 GNLGETGSVSFMFDRVGVIEYDADKASADDMLEAAIEAGADDVASSEEGHEIYTSQASLS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKV-KSIIKMIENLEDDDDVQSVYSNLEI 239
             +K LE K GE +   +IWKP N I +S  D+V + + K+++ L + DDVQ+VY+N E+
Sbjct: 181 EAAKALEAKFGEPRKAALIWKPQNNIAVS--DEVGEKLFKLLDQLNEHDDVQNVYANFEV 238

Query: 240 ADDI 243
           +D +
Sbjct: 239 SDTL 242


>gi|163796366|ref|ZP_02190327.1| hypothetical cytosolic protein [alpha proteobacterium BAL199]
 gi|159178508|gb|EDP63050.1| hypothetical cytosolic protein [alpha proteobacterium BAL199]
          Length = 248

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 119/245 (48%), Positives = 166/245 (67%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIM+RK  +D  ++KIF++L+RE+ ++AK S  +P  NP LR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMYRKGAQDKKRAKIFTRLTRELQIAAKAS-DDPAANPALRSAIIAARKEN 59

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK +G  D  NY ++RYEGYGP GVA+I++ LTDNRNRTAS +RS F+K 
Sbjct: 60  MPKDNIERAIKKGSGGGDDSNYEDVRYEGYGPGGVALIVDTLTDNRNRTASEVRSAFSKY 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG T S +  F ++G+IIY +  G  +  +E AIE+ A      + E+   C   + 
Sbjct: 120 GGNLGETNSVSFMFNRVGQIIYPAEAGTPDAILEAAIEAGAENAESSEAEHEITCAVEDF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LEE +G AQS +  WKPLN I + + D+  +++K+   LED+DDVQ V +N EI
Sbjct: 180 IAVRDALEESLGSAQSAQFTWKPLNTIAV-DEDQAGTLLKLFNTLEDNDDVQQVSANFEI 238

Query: 240 ADDII 244
           ADDI+
Sbjct: 239 ADDIM 243


>gi|220927139|ref|YP_002502441.1| hypothetical protein Mnod_7401 [Methylobacterium nodulans ORS 2060]
 gi|254806597|sp|B8IN22|Y7401_METNO RecName: Full=UPF0082 protein Mnod_7401
 gi|219951746|gb|ACL62138.1| protein of unknown function DUF28 [Methylobacterium nodulans ORS
           2060]
          Length = 248

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 171/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+F KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRVDAVRSKVFGKLAREITVAAKLGTPDPAMNPRLRAAVLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D   Y  IRYEGYGP G A+I+EA TDNRNRTAS +RS FTKA 
Sbjct: 61  MPKDNIERAIKKACGGDAETYEEIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+ +  F+++G + + + + D++  +E AIE+ A +V  ++  +   C+ + +G
Sbjct: 121 GSLAETGAVSFMFDRVGLVAFDAKVADADTMLEAAIEAGADDVKSDESGHEVTCEQSALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE + GE +   ++W+P N + + + +  + +I+++E +ED DDVQ+V+ N  ++
Sbjct: 181 EVAKALEARFGEPRRTSLVWRPQNTVEVDD-ETGEKLIRLVEMIEDQDDVQNVFVNFAVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|315498649|ref|YP_004087453.1| hypothetical protein Astex_1636 [Asticcacaulis excentricus CB 48]
 gi|315416661|gb|ADU13302.1| protein of unknown function DUF28 [Asticcacaulis excentricus CB 48]
          Length = 252

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/246 (46%), Positives = 173/246 (70%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMH+K R DA +SK+FSKL+R+ITV+AK    +P  NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHKKGRADAARSKLFSKLARDITVAAKSGMPDPAMNPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKK  + +  N   IRYEG+GP+G+ II+E LTDNRNRT  ++RS FTK  
Sbjct: 61  MPKDNIDRAIKKGAAGESDNMEEIRYEGFGPQGIGIIVETLTDNRNRTGGNVRSYFTKFG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE----YIFYCDF 176
           G+LG TGS +  ++++G+I Y    G ++  ME AIE+ A +V  ++ E    ++ +  +
Sbjct: 121 GNLGETGSVSFMWDRMGQIEYPLKAGSADAIMEAAIEAGAADVETDEDEEDGGHLIFTAY 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++   ++ + + +G+ +S K IWKP     ++  D  K+++K+I+ L DDDDVQ+VY+N
Sbjct: 181 EDLNTVTEAVAKVLGDPKSTKFIWKPQTLSPIT-GDPAKTLMKLIDALNDDDDVQAVYAN 239

Query: 237 LEIADD 242
            +I+D+
Sbjct: 240 FDISDE 245


>gi|170744614|ref|YP_001773269.1| hypothetical protein M446_6579 [Methylobacterium sp. 4-46]
 gi|226707995|sp|B0UD14|Y6579_METS4 RecName: Full=UPF0082 protein M446_6579
 gi|168198888|gb|ACA20835.1| protein of unknown function DUF28 [Methylobacterium sp. 4-46]
          Length = 248

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 171/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+F KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRVDAVRSKVFGKLAREITVAAKLGVPDPAMNPRLRAAMLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  NY  IRYEGYGP G A+I+EA TDNRNRTAS +RS FTKA 
Sbjct: 61  MPKDNIERAIKKATGGEGENYEEIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+ +  F+++G + + + + D++  +E AIE+ A +V  ++  +   C+   +G
Sbjct: 121 GSLAETGAVSFMFDRVGLVAFDAKVADADAMLEAAIEAGADDVKSDESGHEVTCEHGALG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE + GE +   ++W+P N + + + +  + +I+++E +ED DDVQ+V+ N  ++
Sbjct: 181 EVAKALEARFGEPRRTALVWRPQNTVEVDD-ETGEKLIRLVEMIEDQDDVQNVFVNFAVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|159045302|ref|YP_001534096.1| hypothetical protein Dshi_2762 [Dinoroseobacter shibae DFL 12]
 gi|189039764|sp|A8LJ00|Y2762_DINSH RecName: Full=UPF0082 protein Dshi_2762
 gi|157913062|gb|ABV94495.1| conserved hypothetical protein [Dinoroseobacter shibae DFL 12]
          Length = 246

 Score =  235 bits (599), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 180/244 (73%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L++K+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRAKLFSKLSKEITVAAKMGDPDPDKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKK+   +  NY  IRYEGYGP GVA+I+EA+TDNRNRTAS++RS F+K  
Sbjct: 61  VPKDVIERAIKKSLGGEGENYDEIRYEGYGPGGVAVIVEAMTDNRNRTASTVRSTFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  FE+ G++ Y +  GD++  M  AIE+ A +V  ++  +I +C   ++ 
Sbjct: 121 GNLGETGSVSFMFERKGQVSYPAEAGDADTVMMAAIEAGAEDVESDESGHIIWCADTDLN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE ++GE++S K++W+P     L + + ++ ++K+++ LEDDDDVQ+V +N E +
Sbjct: 181 EVSTALEAELGESESTKLVWRPTTTTEL-DLEGMQKLMKLLDALEDDDDVQNVTANFEAS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|298293010|ref|YP_003694949.1| hypothetical protein Snov_3055 [Starkeya novella DSM 506]
 gi|296929521|gb|ADH90330.1| protein of unknown function DUF28 [Starkeya novella DSM 506]
          Length = 248

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 171/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK ++DA++SK+FSKL+REITVSAKL   +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGKQDAVRSKLFSKLAREITVSAKLGMPDPNMNPRLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIDRAIKKAQGGDAENYDEIRYEGYGPGGVAVIVEALTDNRNRTASEVRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+ +  F++IG + + +     +  ME AIE+ A +V   +  +   C   N+ 
Sbjct: 121 GSLAETGAVSFMFDRIGVVEFDAAKASEDAMMEAAIEAGADDVSSSEDGHEVVCSVENLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE K GE +   ++W+P N + + + +  + +I++++ L D+DDVQ+VY+N E++
Sbjct: 181 EVARALEAKFGEPRKSGLVWRPQNTVAVDD-EVAEKLIRLVDTLNDNDDVQNVYANFELS 239

Query: 241 DDII 244
           D  +
Sbjct: 240 DAFV 243


>gi|329848016|ref|ZP_08263044.1| hypothetical protein ABI_10850 [Asticcacaulis biprosthecum C19]
 gi|328843079|gb|EGF92648.1| hypothetical protein ABI_10850 [Asticcacaulis biprosthecum C19]
          Length = 255

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 119/252 (47%), Positives = 169/252 (67%), Gaps = 14/252 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA++SK+FSKLSR+IT++AK+   +P  N RLRLA+  AK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAVRSKLFSKLSRDITIAAKMGMPDPNMNSRLRLAVAMAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKK  + +      IRYEG GP GV II+E LTDNRNR+A ++RS FTK  
Sbjct: 61  MPKDNIERAIKKGAAGEADTMEEIRYEGRGPGGVGIIVEVLTDNRNRSAGNVRSFFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE----------Y 170
           G L  TGS +  F+++GEI Y    GD++   E AIE+ A +V  +  +          Y
Sbjct: 121 GQLADTGSVSFMFDRVGEIKYPLKAGDADKIFEAAIEAGASDVETDPGDGDEDLGGHAIY 180

Query: 171 IFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDV 230
             + DFN V   ++ L + +G+  S  +IWKP     L+  D VK+++K+++ L DD+DV
Sbjct: 181 TSFEDFNEV---AEALAKTLGDPASTGIIWKPQGLTALT-GDPVKTLMKLLDALNDDEDV 236

Query: 231 QSVYSNLEIADD 242
           Q+VY+N++++D+
Sbjct: 237 QNVYTNMDVSDE 248


>gi|316932640|ref|YP_004107622.1| hypothetical protein Rpdx1_1264 [Rhodopseudomonas palustris DX-1]
 gi|315600354|gb|ADU42889.1| protein of unknown function DUF28 [Rhodopseudomonas palustris DX-1]
          Length = 248

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 125/244 (51%), Positives = 169/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA +SK+FSKL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQRSKLFSKLAREITVAAKLGTPDPAMNPRLRAAVLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGGDSENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSFFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F++ G I Y ++   ++  ++ AIE+ A +V+  +  +  Y       
Sbjct: 121 GNLGETGSVSFMFDRTGIIEYDADKASADDMLDAAIEAGADDVVSSESGHEVYASQETFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GEA+   VIWKP N + + +    K + K+++ L D DDVQ+VY+N E++
Sbjct: 181 DVAKALEAKFGEARKAAVIWKPQNTVAVDDETGEK-LFKLMDALNDHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|39934172|ref|NP_946448.1| hypothetical protein RPA1097 [Rhodopseudomonas palustris CGA009]
 gi|192289697|ref|YP_001990302.1| hypothetical protein Rpal_1287 [Rhodopseudomonas palustris TIE-1]
 gi|49036511|sp|P62040|Y1097_RHOPA RecName: Full=UPF0082 protein RPA1097
 gi|226695901|sp|B3QHR9|Y1287_RHOPT RecName: Full=UPF0082 protein Rpal_1287
 gi|39648020|emb|CAE26540.1| DUF28 [Rhodopseudomonas palustris CGA009]
 gi|192283446|gb|ACE99826.1| protein of unknown function DUF28 [Rhodopseudomonas palustris
           TIE-1]
          Length = 248

 Score =  234 bits (598), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 124/244 (50%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA +SK+FSKL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAQRSKLFSKLAREITVAAKLGTPDPAMNPRLRAAVLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKAIGGDSENYDEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSFFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F++ G I Y ++   ++  ++ AIE+ A +V+  +  +  Y       
Sbjct: 121 GNLGETGSVSFMFDRTGIIEYDADKASADDMLDAAIEAGADDVVSSEAGHEIYASQETFR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GEA+   VIWKP N + + + +  + + K+++ L D DDVQ+VY+N E++
Sbjct: 181 DVAKALEAKFGEARKAAVIWKPQNTVAVDD-ETGEKLFKLMDALNDHDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|170749953|ref|YP_001756213.1| hypothetical protein Mrad2831_3553 [Methylobacterium radiotolerans
           JCM 2831]
 gi|226703861|sp|B1LUU4|Y3553_METRJ RecName: Full=UPF0082 protein Mrad2831_3553
 gi|170656475|gb|ACB25530.1| protein of unknown function DUF28 [Methylobacterium radiotolerans
           JCM 2831]
          Length = 248

 Score =  234 bits (598), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+F KL+REITV+AKL   +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRVDAVRSKVFGKLAREITVAAKLGTPDPAMNPRLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY +IRYEGYGP G A+I+EA TDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGADGENYEDIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+    F+++G I Y +++ D++  +E AIE+ A +V   +  +   C  ++ G
Sbjct: 121 GSLAETGAVAFMFDRVGVIAYPASVADADTMLEAAIEAGADDVSSGEDGHEVICAQDSYG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE + GE     +IWK  N I + + +  + +I+++E +ED DDVQ VY N  ++
Sbjct: 181 EVTKALEARFGEPARTGLIWKAQNTINVDD-ETGEKLIRLVEVIEDQDDVQHVYVNFALS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALV 243


>gi|58040111|ref|YP_192075.1| hypothetical protein GOX1679 [Gluconobacter oxydans 621H]
 gi|67462014|sp|Q5FQC7|Y1679_GLUOX RecName: Full=UPF0082 protein GOX1679
 gi|58002525|gb|AAW61419.1| Nucleotidyltransferase [Gluconobacter oxydans 621H]
          Length = 249

 Score =  234 bits (597), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 162/247 (65%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K F+K+ REITV+ +    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRAKQFAKVLREITVATRSGLPDPTSNPRLRAAISMAREVN 60

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MPK+N+ERAIKKA    G DD   Y  +RYEGYGP GVAII+E LTDNRNRTA  +R+ F
Sbjct: 61  MPKDNVERAIKKASGAAGGDD---YVEVRYEGYGPAGVAIIVEGLTDNRNRTAGEVRAAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  GSLG T S +  F+++G I Y  ++   +  +E AIE+ A      ++ +   C  
Sbjct: 118 SKHGGSLGETNSVSFMFQRLGVISYPLDVASEDEMLEAAIEAGADNAETTEEGHEVTCAM 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            N       LE + GE QS K+ W+P N + L + DK +S++K+I+ LED DD+Q+VY+N
Sbjct: 178 ENFFAVRDALESRFGEPQSAKLDWRPENSVTL-DEDKARSVMKLIDVLEDSDDIQAVYAN 236

Query: 237 LEIADDI 243
            +I DD+
Sbjct: 237 FDIPDDV 243


>gi|146338239|ref|YP_001203287.1| hypothetical protein BRADO1143 [Bradyrhizobium sp. ORS278]
 gi|166228892|sp|A4YMC4|Y1143_BRASO RecName: Full=UPF0082 protein BRADO1143
 gi|146191045|emb|CAL75050.1| conserved hypothetical protein; YebC-like [Bradyrhizobium sp.
           ORS278]
          Length = 248

 Score =  234 bits (597), Expect = 8e-60,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA+KSK+F KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMKSKLFGKLAREITVAAKLGTPDPAMNPRLRAAVVAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKALGGEGENYAEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSFFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++G I +  ++   +  ++ AIE+ A +V+  +  +  Y   ++  
Sbjct: 121 GNLGETGSVSFMFDRVGIIEFDRSVASDDSVLDAAIEAGADDVISGEGGHEVYASPDSFH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GE +   + WKP N + + +    K ++K+++ L + DDVQ+VY+N EI+
Sbjct: 181 EVAKNLEAKFGEPRKAALTWKPQNTVAVDDETGEK-LVKLMDLLNEHDDVQNVYANFEIS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|148258118|ref|YP_001242703.1| hypothetical protein BBta_6910 [Bradyrhizobium sp. BTAi1]
 gi|166228831|sp|A5ERK3|Y6910_BRASB RecName: Full=UPF0082 protein BBta_6910
 gi|146410291|gb|ABQ38797.1| hypothetical protein BBta_6910 [Bradyrhizobium sp. BTAi1]
          Length = 248

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA+KSK+F KL+REITV+AKL   +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMKSKLFGKLAREITVAAKLGTPDPAMNPRLRAAVVAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   +  NY  IRYEGYGP GVA+I+EALTDNRNR AS IRS FTK+ 
Sbjct: 61  MPKDNIERAIKKALGGEGENYAEIRYEGYGPGGVAVIVEALTDNRNRAASDIRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++G I +  ++   +  ++ AIE+ A +V+  +  +  Y   ++  
Sbjct: 121 GNLGETGSVSFMFDRVGIIEFDRSVASDDAVLDAAIEAGADDVISGEGGHEVYASPDSFH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GE +   + WKP N + + +    K ++K+++ L + DDVQ+VY+N EI+
Sbjct: 181 EVAKNLEAKFGEPRKAALTWKPQNTVSVDDETGEK-LLKLMDLLNEHDDVQNVYANFEIS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|103485832|ref|YP_615393.1| hypothetical protein Sala_0337 [Sphingopyxis alaskensis RB2256]
 gi|118574345|sp|Q1GWB2|Y337_SPHAL RecName: Full=UPF0082 protein Sala_0337
 gi|98975909|gb|ABF52060.1| protein of unknown function DUF28 [Sphingopyxis alaskensis RB2256]
          Length = 248

 Score =  234 bits (596), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 114/244 (46%), Positives = 171/244 (70%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  N RLR A+  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSALFSKLSREITVAAKMGLPDPDANARLRAAVNAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D  NY  IRYEGYGP GV++I+EALTDNRNRTA+++R+ F++  
Sbjct: 61  MPKDNIQRAIDKASGGDGDNYEEIRYEGYGPGGVSLIVEALTDNRNRTATNVRTAFSRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++GS +  F+++G I Y   +GD++   E A+++ A +V   D  +  +   +++ 
Sbjct: 121 GNLGTSGSVSHGFDRLGLISYPPGVGDADTVFEAALDAGADDVESSDDGHDIWTSIDSLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K+GEA+ +K+ W+P     +++    +++ K+I+ L+DDDDVQ+V+ N EI 
Sbjct: 181 EVAKALEAKLGEAEGVKLAWRPTMKSEVADEATAQTLFKLIDTLDDDDDVQTVWGNYEIP 240

Query: 241 DDII 244
           D ++
Sbjct: 241 DAVM 244


>gi|329113838|ref|ZP_08242609.1| Hypothetical protein APO_0612 [Acetobacter pomorum DM001]
 gi|326696848|gb|EGE48518.1| Hypothetical protein APO_0612 [Acetobacter pomorum DM001]
          Length = 249

 Score =  233 bits (593), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 163/247 (65%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +SK F K+ RE+TV+ +    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRSKQFGKVIRELTVATRSGLPDPAANPRLRAAISAAREVN 60

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MPK+ IERAIKKA    GSDD   Y  +RYEGYGP GVAII+E LTDNRNRTAS +R+ F
Sbjct: 61  MPKDTIERAIKKASGAAGSDD---YVEVRYEGYGPAGVAIIVEGLTDNRNRTASDVRAAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  GS+G + S +  F ++G I Y +++   +  +E AIE+ A  V+  +  +   C+ 
Sbjct: 118 SKHGGSMGESNSVSFMFRRLGVIAYPASVASEDEMLEAAIEAGAENVVSTETSHEVTCEV 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LE + GE +S K+ W+P N + L + DK +S+ K+++ LED DDVQ+VY+N
Sbjct: 178 ESFFAVKDALEARFGEPESAKLDWRPENTVTL-DEDKARSLFKLLDTLEDHDDVQNVYAN 236

Query: 237 LEIADDI 243
            ++ DD+
Sbjct: 237 FDLPDDL 243


>gi|288957817|ref|YP_003448158.1| hypothetical protein AZL_009760 [Azospirillum sp. B510]
 gi|288910125|dbj|BAI71614.1| hypothetical protein AZL_009760 [Azospirillum sp. B510]
          Length = 250

 Score =  232 bits (592), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 120/246 (48%), Positives = 164/246 (66%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +SKIF+KL+REITV+AK    +P  NPRLR AI   + Q+
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRSKIFNKLAREITVAAKSGLPDPAANPRLRAAILAGRAQN 60

Query: 61  MPKENIERAIKKA--GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP++ I+RAIK+   G  D  NY  +RYEGYGP GVA+I+EALTDNRNRTA+ +RS FTK
Sbjct: 61  MPRDRIDRAIKQGTPGGGDDANYEEVRYEGYGPGGVALIVEALTDNRNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG T S +  F ++G I Y +   D++   EVA+E+ A  V  ++  +       N
Sbjct: 121 YGGSLGETNSVSFMFNRVGAIFYPAAAADADAMFEVALEAGADNVESDENGHEVTSTVEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     LE K G A+S ++ W+PLN +  S  D   S++K+++ LED+DDVQ V  N +
Sbjct: 181 FGAVRDALEAKFGGAESARLTWRPLNTVAPSE-DAAASLLKLLDVLEDNDDVQVVEGNFD 239

Query: 239 IADDII 244
           I+D+++
Sbjct: 240 ISDELM 245


>gi|114570983|ref|YP_757663.1| hypothetical protein Mmar10_2433 [Maricaulis maris MCS10]
 gi|122315328|sp|Q0ALW8|Y2433_MARMM RecName: Full=UPF0082 protein Mmar10_2433
 gi|114341445|gb|ABI66725.1| protein of unknown function DUF28 [Maricaulis maris MCS10]
          Length = 253

 Score =  231 bits (590), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 166/248 (66%), Gaps = 7/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D L+SK+FS+LS+EI+++AKL G +   NPRLRLA+ NAK QS
Sbjct: 1   MAGHSKWANIQHRKGRQDKLRSKLFSRLSKEISIAAKLGGPDVDANPRLRLAVSNAKGQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA   D  ++ +IRYEG+GP G+ +I+E  TDN+NR A+ +R+ F K  
Sbjct: 61  MPKDNIQRAIDKASGGDDESFEDIRYEGFGPAGIGVIVEVSTDNKNRAAAEVRTAFAKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFE------DQEYIFYC 174
           G+LG TGS    F+ +GEI Y  +  D +  ME AIE+ A +V  E      + E++ Y 
Sbjct: 121 GNLGETGSVAFMFDNVGEIRYPLSKADEDTMMEAAIEAGAEDVASEPGDEDNEGEHVIYT 180

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
              ++      L     +  S K+IW+P N I ++  DKV +++KM+E LED DDVQ+VY
Sbjct: 181 AREDLMEVVGGLSATFEDPSSAKLIWRPQNLIEVT-GDKVATLMKMMEMLEDSDDVQNVY 239

Query: 235 SNLEIADD 242
           +N +I+D+
Sbjct: 240 ANFDISDE 247


>gi|258543671|ref|YP_003189104.1| hypothetical protein APA01_26280 [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634749|dbj|BAI00725.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-01]
 gi|256637805|dbj|BAI03774.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-03]
 gi|256640859|dbj|BAI06821.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-07]
 gi|256643914|dbj|BAI09869.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-22]
 gi|256646969|dbj|BAI12917.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-26]
 gi|256650022|dbj|BAI15963.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-32]
 gi|256653012|dbj|BAI18946.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256656066|dbj|BAI21993.1| nucleotidyltransferase [Acetobacter pasteurianus IFO 3283-12]
          Length = 249

 Score =  231 bits (590), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 162/247 (65%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +SK F K+ RE+TV+ +    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRSKQFGKVIRELTVATRSGLPDPAANPRLRAAISAAREVN 60

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MPK+ IERAIKKA    G DD   Y  +RYEGYGP GVA+I+E LTDNRNRTAS +R+ F
Sbjct: 61  MPKDTIERAIKKASGAAGGDD---YVEVRYEGYGPAGVAVIVEGLTDNRNRTASDVRAAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  GS+G T S +  F ++G I Y +++   +  +E AIE+ A  V+  +  +   C+ 
Sbjct: 118 SKHGGSMGETNSVSFMFRRLGVITYPASVASEDEMLEAAIEAGAENVVSTETSHEVTCEV 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LE + GE +S K+ W+P N + L + DK +++ K+++ LED DDVQ+VY+N
Sbjct: 178 ESFFAVKDALEARFGEPESAKLDWRPENTVTL-DEDKARTLFKLLDTLEDHDDVQNVYAN 236

Query: 237 LEIADDI 243
            ++ DD+
Sbjct: 237 FDLPDDL 243


>gi|163850415|ref|YP_001638458.1| hypothetical protein Mext_0982 [Methylobacterium extorquens PA1]
 gi|163662020|gb|ABY29387.1| protein of unknown function DUF28 [Methylobacterium extorquens PA1]
          Length = 264

 Score =  231 bits (588), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 169/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+FSKL+REITV+AKL   +P  NPRLR AI  A+ ++
Sbjct: 17  MAGHSQFKNIMHRKGRVDAVRSKVFSKLAREITVAAKLGTPDPSMNPRLRAAILAARAEN 76

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP G A+I+EA TDNRNRTAS +RS FTK+ 
Sbjct: 77  MPKDNIERAIKKAVGGDGENYEEIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKSG 136

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+    F+++G I +  ++ D++  +E AIE+ A +V  + + +   C  +  G
Sbjct: 137 GSLAETGAVAFMFDRVGVIAFAPDVADADTMLEAAIEAGADDVRSDTEGHEVICAQDAYG 196

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE + GE +   +IWK  N I + + +  + +I+++E +ED DDVQ+VY N  ++
Sbjct: 197 DVSKALEGRFGEPRRTGLIWKAQNTIDVDD-ETGEKLIRLVEVIEDQDDVQNVYVNFALS 255

Query: 241 DDII 244
           + ++
Sbjct: 256 EALV 259


>gi|260576629|ref|ZP_05844616.1| protein of unknown function DUF28 [Rhodobacter sp. SW2]
 gi|259021114|gb|EEW24423.1| protein of unknown function DUF28 [Rhodobacter sp. SW2]
          Length = 248

 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 111/243 (45%), Positives = 170/243 (69%), Gaps = 1/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D L+SK+FSKL++EITV+AK+   +   NPRLRLA++ AK  S
Sbjct: 1   MAGHSKWANIQHRKGKQDKLRSKMFSKLAKEITVAAKMGMPDVDMNPRLRLAVKAAKAVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ I+RAIKK+   D  +YT IRYEGYG  G+AII+EALTDN NRTA+++RS FTK  
Sbjct: 61  MPKDVIDRAIKKSQMGDGADYTEIRYEGYGANGIAIIVEALTDNLNRTAANVRSYFTKCG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TGS +  F+++GE+ Y ++ G ++  M  A+++ A +V  ++  +  YC    + 
Sbjct: 121 GNLGQTGSVSHGFDRVGEVSYPASAGSADDVMMAALDAGADDVESDEDGHWVYCSVEALN 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             S  LE+ +GE+   K+IWKP     + + D  + ++K+I+ LE+DDDVQ+V  N +++
Sbjct: 181 EVSDALEKALGESTESKLIWKPQTLTEV-DLDTAQKLMKLIDMLEEDDDVQTVTHNFDMS 239

Query: 241 DDI 243
           +++
Sbjct: 240 EEV 242


>gi|218528975|ref|YP_002419791.1| hypothetical protein Mchl_0946 [Methylobacterium chloromethanicum
           CM4]
 gi|240137491|ref|YP_002961962.1| hypothetical protein MexAM1_META1p0760 [Methylobacterium extorquens
           AM1]
 gi|254807280|sp|B7L273|Y946_METC4 RecName: Full=UPF0082 protein Mchl_0946
 gi|218521278|gb|ACK81863.1| protein of unknown function DUF28 [Methylobacterium
           chloromethanicum CM4]
 gi|240007459|gb|ACS38685.1| conserved protein with domain of unknown function DUF28
           [Methylobacterium extorquens AM1]
          Length = 248

 Score =  231 bits (588), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 121/244 (49%), Positives = 169/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+FSKL+REITV+AKL   +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRVDAVRSKVFSKLAREITVAAKLGTPDPSMNPRLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP G A+I+EA TDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIERAIKKAVGGDGENYEEIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+    F+++G I +  ++ D++  +E AIE+ A +V  + + +   C  +  G
Sbjct: 121 GSLAETGAVAFMFDRVGVIAFAPDVADADTMLEAAIEAGADDVRSDTEGHEVICAQDAYG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE + GE +   +IWK  N I + + +  + +I+++E +ED DDVQ+VY N  ++
Sbjct: 181 DVSKALEGRFGEPRRTGLIWKAQNTIDVDD-ETGEKLIRLVEVIEDQDDVQNVYVNFALS 239

Query: 241 DDII 244
           + ++
Sbjct: 240 EALV 243


>gi|323136015|ref|ZP_08071098.1| protein of unknown function DUF28 [Methylocystis sp. ATCC 49242]
 gi|322399106|gb|EFY01625.1| protein of unknown function DUF28 [Methylocystis sp. ATCC 49242]
          Length = 248

 Score =  230 bits (587), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMH+K ++DA++SK+FSKL+REITV+AK    +P  N RLR A+  AK ++
Sbjct: 1   MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKAGLPDPNMNARLRAAVLAAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA   D  NY  +RYEGY P GVA+IIEALTDNRNRTA  +RS FTKA 
Sbjct: 61  MPKDNIDRAIKKASGADSENYDEVRYEGYAPGGVAVIIEALTDNRNRTAGEVRSYFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+ +  F+++G + +   +   +  ME AIE+ A +V   D+ +       ++ 
Sbjct: 121 GSLAETGAVSFMFDRVGLVEFDKKVASEDAMMEAAIEAGADDVSTTDEAHEIITSVESLR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LEEK GE +   ++W+P N I++ + +  + I+K++  LED+DDVQ+VY+N EI+
Sbjct: 181 DVAKALEEKFGEPRKAALVWRPQNTIKVDD-EAGEKILKLVGALEDNDDVQNVYANFEIS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALM 243


>gi|241761373|ref|ZP_04759461.1| protein of unknown function DUF28 [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
 gi|241374280|gb|EER63777.1| protein of unknown function DUF28 [Zymomonas mobilis subsp. mobilis
           ATCC 10988]
          Length = 249

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIM+RK  +D  +S +FSKLSRE+TV+AK    +P  NPRLR A+  A++  
Sbjct: 1   MAGHSKFKNIMYRKGAQDKKRSALFSKLSREVTVAAKSGLPDPNANPRLRAAVSAARSGG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAI KA   D  NY  +RYEG+GP GV++IIE LTDNRNRTA+++R+  +K  
Sbjct: 61  MPKDNIERAIAKAIGGDGDNYEELRYEGFGPSGVSLIIETLTDNRNRTATNVRTALSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++GS T  F+++G I Y +  GD +   E A+E+ A +V   + E+  +    ++ 
Sbjct: 121 GNLGTSGSVTHGFDRMGLITYKAEAGDPDKIFEAALEAGAEDVTSSEDEHEIWTAQADLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             + KLE  +GE + +K+ W+P   I + + +   +++++IE LEDDDDVQ+V++N +I 
Sbjct: 181 EVAGKLEAILGEPEGVKLAWRPQTLINV-DEESAGTLLRLIETLEDDDDVQTVWANYDID 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|254559669|ref|YP_003066764.1| hypothetical protein METDI1129 [Methylobacterium extorquens DM4]
 gi|254266947|emb|CAX22746.1| conserved protein with domain of unknown function DUF28
           [Methylobacterium extorquens DM4]
          Length = 248

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 120/244 (49%), Positives = 169/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+FSKL+REITV+AKL   +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRVDAVRSKVFSKLAREITVAAKLGTPDPSMNPRLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERA+KKA   D  NY  IRYEGYGP G A+I+EA TDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIERAVKKAVGGDGENYEEIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+    F+++G I +  ++ D++  +E AIE+ A +V  + + +   C  +  G
Sbjct: 121 GSLAETGAVAFMFDRVGVIAFAPDVADADTMLEAAIEAGADDVRSDTEGHEVICAQDAYG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE + GE +   +IWK  N I + + +  + +I+++E +ED DDVQ+VY N  ++
Sbjct: 181 DVSKALEGRFGEPRRTGLIWKAQNTIDVDD-ETGEKLIRLVEVIEDQDDVQNVYVNFALS 239

Query: 241 DDII 244
           + ++
Sbjct: 240 EALV 243


>gi|56551049|ref|YP_161888.1| hypothetical protein ZMO0153 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|260753288|ref|YP_003226181.1| hypothetical protein Za10_1052 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
 gi|67461904|sp|Q5NR77|Y153_ZYMMO RecName: Full=UPF0082 protein ZMO0153
 gi|56542623|gb|AAV88777.1| protein of unknown function DUF28 [Zymomonas mobilis subsp. mobilis
           ZM4]
 gi|258552651|gb|ACV75597.1| protein of unknown function DUF28 [Zymomonas mobilis subsp. mobilis
           NCIMB 11163]
          Length = 249

 Score =  230 bits (586), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIM+RK  +D  +S +FSKLSRE+TV+AK    +P  NPRLR A+  A++  
Sbjct: 1   MAGHSKFKNIMYRKGAQDKKRSALFSKLSREVTVAAKSGLPDPNANPRLRAAVSAARSGG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAI KA   D  NY  +RYEG+GP GV++IIE LTDNRNRTA+++R+  +K  
Sbjct: 61  MPKDNIERAIAKAIGGDGDNYEELRYEGFGPSGVSLIIETLTDNRNRTATNVRTALSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG++GS T  F+++G I Y +  GD +   E A+E+ A +V   + E+  +    ++ 
Sbjct: 121 GNLGTSGSVTHGFDRMGLITYKAEAGDPDKIFEAALEAGAEDVTSSEDEHEIWTAQADLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             + KLE  +GE + +K+ W+P   I + + +   +++++IE LEDDDDVQ+V++N +I 
Sbjct: 181 EVAGKLEAILGEPEGVKLAWRPQTLINV-DEESAGTLLRLIETLEDDDDVQTVWANYDID 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|260432977|ref|ZP_05786948.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
 gi|260416805|gb|EEX10064.1| conserved hypothetical protein [Silicibacter lacuscaerulensis
           ITI-1157]
          Length = 231

 Score =  229 bits (585), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 162/244 (66%), Gaps = 16/244 (6%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +SK+FSKLS+EITV+AK+   +P +NPRLRLA++ AK+QS
Sbjct: 1   MAGHSKWANIQHRKGRQDAARSKLFSKLSKEITVAAKMGDPDPEKNPRLRLAVKEAKSQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D   Y  IRYEGYGP GVA+I+E +TDN+NRTAS++RS      
Sbjct: 61  MPKDNIERAIKKATGGDAETYEEIRYEGYGPNGVAVIVETMTDNKNRTASNVRS------ 114

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
                    T        ++Y ++ GD++   E AIE+ A +V   +  +I +C   ++ 
Sbjct: 115 ---------TXXXXXXXXVVYPASAGDADTIFEAAIEAGAEDVESSEDGHIIWCADTDLN 165

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +  LE  +GE++S K++WKP     L   D ++ ++K++E LEDDDDVQ V +N E +
Sbjct: 166 EVASALEAALGESESTKLVWKPTTTTELGLED-MQRLMKLVEALEDDDDVQRVTTNFEAS 224

Query: 241 DDII 244
           D+++
Sbjct: 225 DEVM 228


>gi|209965103|ref|YP_002298018.1| hypothetical protein RC1_1808 [Rhodospirillum centenum SW]
 gi|226695975|sp|B6INM1|Y1808_RHOCS RecName: Full=UPF0082 protein RC1_1808
 gi|209958569|gb|ACI99205.1| conserved hypothetical protein [Rhodospirillum centenum SW]
          Length = 250

 Score =  229 bits (584), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 170/245 (69%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K F+KL+REITVSAK    +P  NPRLR AIQ A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRAKKFNKLAREITVSAKAGLPDPASNPRLRAAIQAARAEN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ IERAIK+     D  NY  +RYEGYGP GVA+I+EALTDNRNRTAS +R+ FTK 
Sbjct: 61  MPKDRIERAIKQGTPGADGANYEEVRYEGYGPGGVALIVEALTDNRNRTASEVRTAFTKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG T S +  F +IG+++Y +++ D++  +E AIE+ A +V  ++  +      +++
Sbjct: 121 GGTLGETNSVSFMFNRIGQVVYPASVADADTVLEAAIEAGADDVQSDEGGHYISTAVDSL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     LE + G  +S K+ W+P N + ++  D  +S++K+++ L+D+DDVQ+V  N +I
Sbjct: 181 GEVRDALETRFGPPESAKLTWQPQNTVPVAAEDAAQSLMKLLDMLDDNDDVQTVLGNFDI 240

Query: 240 ADDII 244
             D++
Sbjct: 241 PQDLL 245


>gi|254292415|ref|YP_003058438.1| hypothetical protein Hbal_0039 [Hirschia baltica ATCC 49814]
 gi|254040946|gb|ACT57741.1| protein of unknown function DUF28 [Hirschia baltica ATCC 49814]
          Length = 252

 Score =  229 bits (583), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 166/247 (67%), Gaps = 3/247 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQ-NPLENPRLRLAIQNAKNQ 59
           MAGHS++ NI HRK  +D  K+KIF+KLS+EIT++AK+ G  +P  NPRLRLAI NA+  
Sbjct: 1   MAGHSKWANIQHRKGAQDKKKAKIFAKLSKEITIAAKMGGSGDPDMNPRLRLAIANARGA 60

Query: 60  SMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           SMPK+NI RAI KA   D+  Y  IRYEG+   GV +I+E  TDN+NR+   +R+ FTK 
Sbjct: 61  SMPKDNITRAIDKAVGGDMEQYEEIRYEGFASGGVGLIVECSTDNKNRSGGDVRASFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG TG+ +  F+Q+G+I++ +  G  +  ME AIE+ A +V F+   +I Y    ++
Sbjct: 121 GGNLGETGAVSFGFDQVGQIVFSAEAGGEDAVMEAAIEAGADDVEFDGDAHIIYTAREDL 180

Query: 180 GLTSKKLEEKIG--EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
              +  LE K G  EA + ++IWKP N + + + +    I+K+IE LED DDVQ+VYSN 
Sbjct: 181 MDVASSLEGKFGEVEASATELIWKPQNLVPVEDEETAGKILKLIEVLEDLDDVQNVYSNY 240

Query: 238 EIADDII 244
           +I+D+++
Sbjct: 241 DISDELM 247


>gi|209543388|ref|YP_002275617.1| hypothetical protein Gdia_1219 [Gluconacetobacter diazotrophicus
           PAl 5]
 gi|209531065|gb|ACI51002.1| protein of unknown function DUF28 [Gluconacetobacter diazotrophicus
           PAl 5]
          Length = 249

 Score =  229 bits (583), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 114/247 (46%), Positives = 160/247 (64%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +++ F+K+ REITV+A+    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDARRARQFAKVIREITVAARSGMPDPASNPRLRAAISAAREVN 60

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MPK+ +ERAIKKA    G DD   Y  +RYEGYGP GVA+I+EALTDNRNRTAS +R+ F
Sbjct: 61  MPKDTVERAIKKATGAGGGDD---YAEVRYEGYGPAGVAVIVEALTDNRNRTASDVRAAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  GSLG T S +  F ++G I Y + +   +  +E AIE+ A  V   D+ +   C  
Sbjct: 118 SKHGGSLGETNSVSFMFTRLGVITYPAAVATEDEMLEAAIEAGAENVESTDEGHEVTCPV 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LE + GE  S K  W+P   + L + DK + ++K+I+ L++ DDVQ+VY+N
Sbjct: 178 ESFFAVRDALETRFGEPSSAKFDWRPGTVVTL-DEDKARGVLKLIDVLDEHDDVQAVYAN 236

Query: 237 LEIADDI 243
            ++ DD+
Sbjct: 237 FDLPDDV 243


>gi|312113458|ref|YP_004011054.1| hypothetical protein Rvan_0679 [Rhodomicrobium vannielii ATCC
           17100]
 gi|311218587|gb|ADP69955.1| protein of unknown function DUF28 [Rhodomicrobium vannielii ATCC
           17100]
          Length = 248

 Score =  228 bits (581), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 111/244 (45%), Positives = 166/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHSQFKNIM+RK  +D+ +SK+FSK +REIT +AK+   +P  NPRLR AI  A+ Q+
Sbjct: 1   MSGHSQFKNIMYRKGAQDSKRSKMFSKFAREITAAAKIGLPDPAMNPRLRTAILAARAQN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKK+      +Y  +RYEG+ P GV II+EALTDNRNRTA  +RS+FTK  
Sbjct: 61  MPKDNIERAIKKSQEAGGADYIEVRYEGFAPGGVGIIVEALTDNRNRTAGEVRSLFTKYG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG TG+ +  F+++GEI Y  + G +   +E AIE+ A +   + + +      +   
Sbjct: 121 GNLGETGAVSFSFDRVGEIEYPLSAGSAEEMLEAAIEAGADDCESDAEAHWLTTTIDAFS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
               +LE+K G A+S  + W+P N + + + +K + ++K+I++LED DDVQ VY+N E++
Sbjct: 181 EVQAELEKKFGPAKSAAIGWRPQNTVEV-DEEKGEKLLKLIDSLEDSDDVQKVYANFEMS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DKVM 243


>gi|158422134|ref|YP_001523426.1| hypothetical protein AZC_0510 [Azorhizobium caulinodans ORS 571]
 gi|172048034|sp|A8IM90|Y510_AZOC5 RecName: Full=UPF0082 protein AZC_0510
 gi|158329023|dbj|BAF86508.1| uncharacterized protein [Azorhizobium caulinodans ORS 571]
          Length = 248

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 174/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITV+AK+   +P  N RLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAVRSKLFSKLAREITVAAKMGLPDPNMNARLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D+ NY  IRYEGYGP GVA+I+EALTDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIERAIKKASGADMENYDEIRYEGYGPGGVAVIVEALTDNRNRTASEVRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+L  TG+ +  F+++G I + +   +++  +E AIE+ A +V   ++ +   C   ++ 
Sbjct: 121 GNLAETGAVSFMFDRLGAIEFDAAKVNADDLLEAAIEAGADDVNSSEETHEVVCAVESLA 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              K LE K GE +   ++W+P N I + + +  + +++++E LED+DDVQ+V +N E++
Sbjct: 181 EVQKALEAKFGEPRKAGLVWRPQNTIAVDD-ETGEKLMRLVETLEDNDDVQNVTANFELS 239

Query: 241 DDII 244
           + ++
Sbjct: 240 EALM 243


>gi|330991870|ref|ZP_08315819.1| UPF0082 protein [Gluconacetobacter sp. SXCC-1]
 gi|329760891|gb|EGG77386.1| UPF0082 protein [Gluconacetobacter sp. SXCC-1]
          Length = 249

 Score =  227 bits (578), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 158/247 (63%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K F+K+ REITV+A+    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRAKQFAKVIREITVAAREGMPDPAMNPRLRAAISAAREVN 60

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MPK+ +ERAIKKA    G DD   Y  +RYEGYGP GVA+I+E LTDNRNRTAS +R+ F
Sbjct: 61  MPKDTVERAIKKASGAGGGDD---YMEVRYEGYGPAGVAVIVEGLTDNRNRTASDVRAAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  GSLG T S +  F ++G I Y  +    +  +E  +E+ A  V   D  +   C  
Sbjct: 118 SKHGGSLGETNSVSFMFTRLGVITYPLDAASEDDLIEAGLEAGAENVETVDGMHEVTCPV 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LE + GE  S K+ W+P N + L + DK +S+ K+I+ LED DDVQ+VY+N
Sbjct: 178 ESFFAVRDALETRFGEPASAKLDWRPGNTVEL-DEDKARSVFKLIDTLEDHDDVQAVYAN 236

Query: 237 LEIADDI 243
            ++ DD+
Sbjct: 237 FDLPDDV 243


>gi|254455905|ref|ZP_05069334.1| conserved hypothetical protein TIGR01033 [Candidatus Pelagibacter
           sp. HTCC7211]
 gi|207082907|gb|EDZ60333.1| conserved hypothetical protein TIGR01033 [Candidatus Pelagibacter
           sp. HTCC7211]
          Length = 241

 Score =  226 bits (577), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 116/242 (47%), Positives = 171/242 (70%), Gaps = 3/242 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + D  +SKIFSKLS+EITV+AKL  ++P+ NPRLR AIQ A++ +
Sbjct: 1   MAGHSHWAGIKHKKGKADKQRSKIFSKLSKEITVAAKLGDKDPVMNPRLRSAIQAARSAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAI K+ +    N+ N+RYEG+GP+ +A+I+E LTDN+NRTAS+IR+IF K+ 
Sbjct: 61  MPKDNIERAIDKSAAASGVNFENLRYEGFGPDKIAVIVETLTDNKNRTASNIRTIFQKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           GSLG+ GS +  F Q+G I I  + I D N+  E+AIES A E +  D+ +   C  + +
Sbjct: 121 GSLGTQGSASHNFNQLGIIKIDRNEISDENI-FELAIESGADECISNDEFHEIQCPVSEI 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               KKLE+ +    S ++ W PLN + ++N D+ + +I+ +E +EDDDDVQ+VYSN+++
Sbjct: 180 YNVKKKLEKIVANFISTEIEWVPLNSVNVTN-DRREDVIEFLETIEDDDDVQNVYSNVQL 238

Query: 240 AD 241
            +
Sbjct: 239 GN 240


>gi|296117347|ref|ZP_06835937.1| hypothetical protein GXY_16062 [Gluconacetobacter hansenii ATCC
           23769]
 gi|295976113|gb|EFG82901.1| hypothetical protein GXY_16062 [Gluconacetobacter hansenii ATCC
           23769]
          Length = 249

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 113/247 (45%), Positives = 161/247 (65%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K F+K+ REITV+A+    +P  NPRLR A+  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDARRAKQFAKVIREITVAAREGMPDPAMNPRLRAAMSAAREVN 60

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MPK+ +ERAIKKA    G DD   Y  +RYEGYGP GVA+I+E LTDNRNRTAS +R+ F
Sbjct: 61  MPKDTVERAIKKASGAGGGDD---YVEVRYEGYGPAGVAVIVEGLTDNRNRTASDVRAAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  GSLG T S +  F+++G + Y  ++   +  +E  IE+ A  V    + +   C  
Sbjct: 118 SKHGGSLGETNSVSFMFQRLGVVTYPLDVATEDGMLEAGIEAGADNVETTAEGHEVTCPV 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LE + GE  S K+ W+P   + L + DK +S++K+I+ LE++DDVQSVY+N
Sbjct: 178 ESFFAVRDALETRFGEPASAKLDWRPETVVTL-DEDKARSVLKLIDVLEENDDVQSVYAN 236

Query: 237 LEIADDI 243
            ++ DD+
Sbjct: 237 FDLPDDV 243


>gi|296282046|ref|ZP_06860044.1| hypothetical protein CbatJ_00410 [Citromicrobium bathyomarinum
           JL354]
          Length = 247

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/244 (47%), Positives = 174/244 (71%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLA+  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSNLFSKLSREITVAAKMGMPDPDMNPRLRLAVNAAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA ++D  NY  +RYEGYGP G AII+EALTDNRNRTA++IR+ F+K  
Sbjct: 61  MPKDNIQRAIDKASANDGDNYEEVRYEGYGPGGSAIIVEALTDNRNRTATNIRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ GS    FE++G I+Y ++ GD    +E A+E+ A ++   D  +  +   +++ 
Sbjct: 121 GNLGTEGSVAHGFERLGLIVYPADAGDEEKVLEAALEAGAEDIASSDDGHEIWTAPDDLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE+ +G A+++K+ WKP N     +     +++K+I+ L+DDDDVQ+V+ N +I+
Sbjct: 181 AVAENLEKSLGSAETVKLAWKP-NLTVDMDEKNAGTLLKLIDALDDDDDVQTVWGNYDIS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|154246991|ref|YP_001417949.1| hypothetical protein Xaut_3062 [Xanthobacter autotrophicus Py2]
 gi|226703687|sp|A7IJU9|Y3062_XANP2 RecName: Full=UPF0082 protein Xaut_3062
 gi|154161076|gb|ABS68292.1| protein of unknown function DUF28 [Xanthobacter autotrophicus Py2]
          Length = 249

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 119/244 (48%), Positives = 173/244 (70%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R+DA++SK+FSKL+REITVSAK+   +P  N RLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRQDAMRSKLFSKLAREITVSAKMGLPDPNMNARLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  IRYEGYGP GVA+I+EALTDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIERAIKKAAGADGENYDEIRYEGYGPGGVAVIVEALTDNRNRTASEVRSFFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+L  TG+ +  F+++G I + +   D++  ME AI++ A +V   +  +   C   ++ 
Sbjct: 121 GNLAETGAVSFMFDRVGAIEFAAEKADADAMMEAAIDAGADDVTSSEHGHEVICAAESLA 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              + LE K GE +   ++W+P N + + + +  + +++++ENLED+DDVQ+V +N E++
Sbjct: 181 EVQRALEAKFGEPKKAALVWRPQNTVAVDD-ETGEKLLRLVENLEDNDDVQNVTANFELS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALL 243


>gi|91762273|ref|ZP_01264238.1| hypothetical protein PU1002_03371 [Candidatus Pelagibacter ubique
           HTCC1002]
 gi|91718075|gb|EAS84725.1| hypothetical protein PU1002_03371 [Candidatus Pelagibacter ubique
           HTCC1002]
          Length = 241

 Score =  223 bits (569), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 118/238 (49%), Positives = 165/238 (69%), Gaps = 3/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ +I H K + D  +SK+FSKLS+EI+V+AKL  ++P  NPRLR AIQ AK+ +
Sbjct: 1   MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAI K+  +   NY N+RYEG+GP+ +A+I+EALTDN+NRTAS+IRSIF K+ 
Sbjct: 61  MPKDNIERAIAKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNIRSIFVKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           G+LG+ GS +  F Q+G I I    I D  +  E+AIES A E +  D+ +   C  + +
Sbjct: 121 GNLGTQGSASHNFNQLGIIKIDKKEISDEQI-FELAIESGADECISNDEFHEIQCPMSEI 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
               K LE+ I    S ++ W PLN + +   DKV++ I+ +E LEDDDDVQSVYSN+
Sbjct: 180 YNVKKNLEKTIANFISTEIEWLPLNSVDVEK-DKVEAAIEFLETLEDDDDVQSVYSNI 236


>gi|188580190|ref|YP_001923635.1| hypothetical protein Mpop_0922 [Methylobacterium populi BJ001]
 gi|226696029|sp|B1Z942|Y922_METPB RecName: Full=UPF0082 protein Mpop_0922
 gi|179343688|gb|ACB79100.1| protein of unknown function DUF28 [Methylobacterium populi BJ001]
          Length = 248

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 170/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK R DA++SK+FSKL+REITV+AKL   +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFKNIMHRKGRVDAVRSKVFSKLAREITVAAKLGTPDPSMNPRLRAAILAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA  +D  NY  IRYEGYGP G A+I+EA TDNRNRTAS +RS FTK+ 
Sbjct: 61  MPKDNIERAIKKAVGNDGENYEEIRYEGYGPGGAALIVEAQTDNRNRTASDVRSAFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+    F+++G I + +++ D++  +E AIE+ A +V  +   +   C  +  G
Sbjct: 121 GSLAETGAVAFMFDRVGVIAFAADVADADTMLEAAIEAGADDVRSDADGHEITCAQDAYG 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             SK LE + GE +   +IWK  N I + + +  + +I+++E +ED DDVQ+VY N  ++
Sbjct: 181 EVSKALEARFGEPRRTGLIWKAQNTIDVDD-ETGEKLIRLVEVIEDQDDVQNVYVNFALS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALV 243


>gi|296447689|ref|ZP_06889607.1| protein of unknown function DUF28 [Methylosinus trichosporium OB3b]
 gi|296254830|gb|EFH01939.1| protein of unknown function DUF28 [Methylosinus trichosporium OB3b]
          Length = 248

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 166/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMH+K ++DA++SK+FSKL+REITV+AK+   +P  N RLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKMGLPDPNMNARLRAAVLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  NY  +RYEGY P GVA+IIEALTDNRNRTA  IRS FTKA 
Sbjct: 61  MPKDNIERAIKKASGADAENYDEVRYEGYAPGGVAVIIEALTDNRNRTAGEIRSYFTKAG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+L  TG+ +  F+++G + +       +  ME +IE+ A +V   +  +        + 
Sbjct: 121 GALAETGAVSFMFDRVGLVEFPRKAASEDAMMEASIEAGAEDVTATEDSHEVITSVEGLR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE K GE +   ++W+P N + + + +  + I+K+I  LED+DDVQ+VY+N E++
Sbjct: 181 DVAKALEAKFGEPKKAALVWRPQNTVAVDD-EAGEKIVKLIGALEDNDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DALL 243


>gi|148261889|ref|YP_001236016.1| hypothetical protein Acry_2907 [Acidiphilium cryptum JF-5]
 gi|326405393|ref|YP_004285475.1| hypothetical protein ACMV_32460 [Acidiphilium multivorum AIU301]
 gi|146403570|gb|ABQ32097.1| protein of unknown function DUF28 [Acidiphilium cryptum JF-5]
 gi|325052255|dbj|BAJ82593.1| hypothetical protein ACMV_32460 [Acidiphilium multivorum AIU301]
          Length = 253

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 119/248 (47%), Positives = 163/248 (65%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +++ F+KL REITVSAK    +P  NPRLR A   A+  +
Sbjct: 5   MAGHSQFKNIMHRKGAQDARRARQFAKLIREITVSAKTGLPDPAANPRLRAACAAARQAN 64

Query: 61  MPKENIERAIKKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           MP++ IERAIKKA    G DD   Y  +RYEGYGP G+AII+EALTDNRNRTAS +R+ F
Sbjct: 65  MPRDTIERAIKKAAGGAGGDD---YVEVRYEGYGPSGIAIIVEALTDNRNRTASDVRAAF 121

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +K  G+LG T S    F++IG I Y +    ++  +E AIE+ A +V   D+ +   C  
Sbjct: 122 SKHGGALGETNSVAFMFDRIGLIRYPTAAASADDMLEAAIEAGADDVQSTDEGHEIICAV 181

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            N       +E+K GE ++ K+ W+P     L + +  +S++K+I+ LE+ DDVQSVY+N
Sbjct: 182 ENFFAVRDAMEQKFGEPEAAKLDWRPTTTTPL-DEEAARSVMKLIDALEESDDVQSVYAN 240

Query: 237 LEIADDII 244
            EI DD++
Sbjct: 241 FEIPDDVM 248


>gi|114327761|ref|YP_744918.1| hypothetical protein GbCGDNIH1_1097 [Granulibacter bethesdensis
           CGDNIH1]
 gi|122327273|sp|Q0BT57|Y1097_GRABC RecName: Full=UPF0082 protein GbCGDNIH1_1097
 gi|114315935|gb|ABI61995.1| hypothetical cytosolic protein [Granulibacter bethesdensis CGDNIH1]
          Length = 249

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 163/245 (66%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +++ F+K+ REITVSA+    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDARRAREFAKVIREITVSARSGLPDPASNPRLRAAISWAREVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ ++RAIKKA G+    +Y  +RYEGYGP GVA+I+EALTDNRNRTA+ +RS F+K 
Sbjct: 61  MPKDTVDRAIKKATGAGQGDDYAEVRYEGYGPAGVAVIVEALTDNRNRTAADVRSAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG T S +  F ++G I + ++ G ++  +E AIE+ A  V    + +       + 
Sbjct: 121 GGALGETNSVSFMFSRVGVIRFPASAGSADDMLEAAIEAGADNVESTAETHEITTSVEDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE + G  ++ K+ W+P   + L + DK  S++K+++ LED+DDVQ+VY+N +I
Sbjct: 181 FAVRDVLESRFGAPEAAKLDWRPGTTVTL-DQDKASSVLKLLDVLEDNDDVQAVYANFDI 239

Query: 240 ADDII 244
            DD++
Sbjct: 240 PDDVM 244


>gi|71083297|ref|YP_266016.1| hypothetical protein SAR11_0592 [Candidatus Pelagibacter ubique
           HTCC1062]
 gi|119369529|sp|Q4FN26|Y592_PELUB RecName: Full=UPF0082 protein SAR11_0592
 gi|71062410|gb|AAZ21413.1| protein with conserved domain of unknown function DUF28 [Candidatus
           Pelagibacter ubique HTCC1062]
          Length = 241

 Score =  222 bits (566), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 116/238 (48%), Positives = 165/238 (69%), Gaps = 3/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ +I H K + D  +SK+FSKLS+EI+V+AKL  ++P  NPRLR AIQ AK+ +
Sbjct: 1   MSGHSKWASIKHSKGKADKQRSKVFSKLSKEISVAAKLGDKDPAMNPRLRSAIQAAKSAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAI K+  +   NY N+RYEG+GP+ +A+I+EALTDN+NRTAS++RSIF K+ 
Sbjct: 61  MPKDNIERAIAKSSVNSETNYENLRYEGFGPDKIAVIVEALTDNKNRTASNVRSIFVKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           G+LG+ GS +  F Q+G I I    I D  +  E+AIES A E +  D+ +   C  + +
Sbjct: 121 GNLGTQGSASHNFNQLGIIKIDKKEISDEQI-FELAIESGADECISNDEFHEIQCPMSEI 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
               K LE+ I    S ++ W PLN + +   DKV++ ++ +E LEDDDDVQSVYSN+
Sbjct: 180 YNVKKNLEKTIANFISTEIEWVPLNSVDVEK-DKVEAALEFLETLEDDDDVQSVYSNI 236


>gi|16127473|ref|NP_422037.1| hypothetical protein CC_3243 [Caulobacter crescentus CB15]
 gi|221236287|ref|YP_002518724.1| hypothetical protein CCNA_03352 [Caulobacter crescentus NA1000]
 gi|33517137|sp|Q9A3G1|Y3243_CAUCR RecName: Full=UPF0082 protein CC_3243
 gi|254801662|sp|B8H462|Y3352_CAUCN RecName: Full=UPF0082 protein CCNA_03352
 gi|13424929|gb|AAK25205.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220965460|gb|ACL96816.1| hypothetical cytosolic protein [Caulobacter crescentus NA1000]
          Length = 251

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 118/246 (47%), Positives = 169/246 (68%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA +SK+FSKLSREITV+AK    +P  NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKTGLPDPAMNPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ IERAIKK+   D  +Y+ IRYEG    GV II+E LTDN+NR A+++RS FTK  
Sbjct: 61  LPKDVIERAIKKSQMGDAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRSYFTKMG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF----EDQEYIFYCDF 176
           G++G+TGS T  F+++G+I Y +     +  ME AIE+ A +V      E + +  Y  F
Sbjct: 121 GNMGATGSVTFNFDRVGQISYPAKAASEDDMMEAAIEAGADDVTSDMDEEGEGHTVYTAF 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++   +  LE K G A + K+ W+P   + ++  D V +++K+++ L++DDDVQ+VYSN
Sbjct: 181 ESLNDVAAALEAKFGAASNTKIAWRPKMQVPVTG-DAVATLMKLLDMLDEDDDVQAVYSN 239

Query: 237 LEIADD 242
            +I+D+
Sbjct: 240 EDISDE 245


>gi|254420128|ref|ZP_05033852.1| conserved hypothetical protein TIGR01033 [Brevundimonas sp. BAL3]
 gi|196186305|gb|EDX81281.1| conserved hypothetical protein TIGR01033 [Brevundimonas sp. BAL3]
          Length = 257

 Score =  221 bits (562), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 110/251 (43%), Positives = 168/251 (66%), Gaps = 10/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA++SK+FSKLSR+ITV+AK    +P  NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAVRSKLFSKLSRDITVAAKSGLPDPAANPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAI KA   D+     +RYEG GP GV II+EALTDNRNR AS+I + F K  
Sbjct: 61  LPKDVIQRAINKASGGDVDTMEEVRYEGRGPGGVGIIVEALTDNRNRAASNIGAAFKKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV--------LFEDQE-YI 171
           G+L    S    ++++G+IIY +  G  +  ME AIE+ A +V        ++ED   + 
Sbjct: 121 GALSEMNSVAFMWDKVGQIIYKAEAGTEDEVMEAAIEAGAQDVESDLVKPDIYEDAPGHT 180

Query: 172 FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
            +  F ++   ++ + + +G+ +S  ++WKP + + ++  + V ++ K+++ L+ +DDVQ
Sbjct: 181 IWTAFEDLNEVAEAMSKVLGDPKSTAIVWKPQSEVTVT-GEAVGTLFKLLDALDAEDDVQ 239

Query: 232 SVYSNLEIADD 242
           +VYSN +I+D+
Sbjct: 240 NVYSNEDISDE 250


>gi|302384297|ref|YP_003820120.1| hypothetical protein Bresu_3191 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194925|gb|ADL02497.1| protein of unknown function DUF28 [Brevundimonas subvibrioides ATCC
           15264]
          Length = 257

 Score =  221 bits (562), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 167/251 (66%), Gaps = 10/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA++SK+FSKLSR+ITV+AK    +   NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAVRSKLFSKLSRDITVAAKSGMPDVALNPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAI KA   D+     +RYEG GP GV II+EALTDNRNR  S+IR  FTK  
Sbjct: 61  LPKDVIQRAINKAAGGDVDTMEEVRYEGRGPGGVGIIVEALTDNRNRANSNIRVAFTKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV--------LFEDQE-YI 171
           G+LG   S    ++++G+I+Y +  G  +  ME AIE+ A +V        ++ED   + 
Sbjct: 121 GALGEMNSVAFMWDRVGKIVYPAEAGTEDAIMEAAIEAGAQDVESDLEKPDIYEDAPGHT 180

Query: 172 FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
            +  F ++   ++ + + +G+ +S  ++WKP   + +S  D+V +++K+++ L+ +DDV 
Sbjct: 181 IWTAFEDLNEVAEAMSKVLGDPKSTAIVWKPQTEVPVS-GDQVGTLMKLLDALDAEDDVS 239

Query: 232 SVYSNLEIADD 242
            VYSN +I+D+
Sbjct: 240 MVYSNEDISDE 250


>gi|239946877|ref|ZP_04698630.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
 gi|239921153|gb|EER21177.1| conserved hypothetical protein [Rickettsia endosymbiont of Ixodes
           scapularis]
          Length = 253

 Score =  220 bits (560), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 159/245 (64%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+ +A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTSARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 61  NLPKERIDKAINSANDSSNTENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F+  G I Y SNI  +   +E  IE D  +++ +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFKHCGVIQYLSNIASNENILEAVIELDVDDIISDDTTHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 181 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEILEESDDVQRVFGNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|85375730|ref|YP_459792.1| hypothetical protein ELI_14515 [Erythrobacter litoralis HTCC2594]
 gi|84788813|gb|ABC64995.1| glucose-1-phosphate adenylyl transferase [Erythrobacter litoralis
           HTCC2594]
          Length = 248

 Score =  219 bits (558), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 116/244 (47%), Positives = 168/244 (68%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+AK+   +P  NPRLRLA+  AK QS
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSNLFSKLSREITVAAKMGTPDPDMNPRLRLAVNTAKAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA + D  NY  +RYEGYGP G AII+EALTDNRNRTA+++R+ F+K  
Sbjct: 61  MPKDNIQRAIDKASAGDDENYEEVRYEGYGPGGSAIIVEALTDNRNRTATAVRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ GS    FE++G I Y    GD    +E A+E+ A ++      +  +    ++ 
Sbjct: 121 GNLGTEGSVAHGFERLGYIEYGPEAGDEEKVLEAALEAGAEDIQSSRDGHEIWTAAEDLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE+ +GEA+ +K+ WKP   + L   D    ++K+++ L+DDDDVQ+V+ N +I+
Sbjct: 181 AVAEALEKALGEAKEVKLAWKPNLTVELDEKD-AGVLLKLVDALDDDDDVQTVWGNYDIS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|182677342|ref|YP_001831488.1| hypothetical protein Bind_0345 [Beijerinckia indica subsp. indica
           ATCC 9039]
 gi|226703833|sp|B2IDE7|Y345_BEII9 RecName: Full=UPF0082 protein Bind_0345
 gi|182633225|gb|ACB93999.1| protein of unknown function DUF28 [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 248

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 169/244 (69%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMH+K ++DA++SK+FSKL+REITV+AKL   +P  N RLR A+  A+ ++
Sbjct: 1   MAGHSQFKNIMHKKGKQDAIRSKLFSKLAREITVAAKLGLPDPAMNARLRAAVLAARAEN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA + D  NY  +RYEGY P GVA+I+EALTDNRNRTA  +RS FTK+ 
Sbjct: 61  MPKDNIERAIKKASAADGENYDEVRYEGYAPGGVALIVEALTDNRNRTAGEVRSYFTKSG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           GSL  TG+ +  F+ +G I + +++      +E AIE+ A +V   ++ +       ++ 
Sbjct: 121 GSLAETGAVSFMFDHVGLIEFPASVASEEAMLEAAIEAGAEDVQSNEETHEIITSLESLR 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             ++ LE K GE +   +IWK  N I + + +  + I++++  LE++DDVQ+VY+N E++
Sbjct: 181 DVAQALETKFGEPRKASLIWKAQNAIAVDD-EAGEKILRLVNLLEENDDVQNVYANFEVS 239

Query: 241 DDII 244
           D ++
Sbjct: 240 DTLL 243


>gi|295688112|ref|YP_003591805.1| hypothetical protein Cseg_0677 [Caulobacter segnis ATCC 21756]
 gi|295430015|gb|ADG09187.1| protein of unknown function DUF28 [Caulobacter segnis ATCC 21756]
          Length = 251

 Score =  219 bits (557), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 169/246 (68%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA +SK+FSKLSREITV+AK    +P  NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKSGLPDPAMNPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+   D  +YT IRYEG    GV II+E +TDN+NR A+++RS FTK  
Sbjct: 61  LPKDVIDRAIKKSQMGDAADYTEIRYEGVAAGGVGIIVEVMTDNKNRAAANVRSYFTKMG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF----EDQEYIFYCDF 176
           G++G+TGS T  F+++G+I Y +     +  ME AIE+ A +V      E + +  Y  F
Sbjct: 121 GNMGATGSVTFNFDRVGQISYPAKTASEDEMMEAAIEAGADDVTSDMDEEGEGHTIYTAF 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++   +  LE K G A + K+ W+P   + ++  D V +++K+++ L++DDDVQ+VYSN
Sbjct: 181 EDLNEVAAALEAKFGAAANTKIAWRPKMQVPVTG-DSVATLMKLLDMLDEDDDVQAVYSN 239

Query: 237 LEIADD 242
            +I+++
Sbjct: 240 EDISEE 245


>gi|241068641|ref|XP_002408495.1| conserved hypothetical protein [Ixodes scapularis]
 gi|215492483|gb|EEC02124.1| conserved hypothetical protein [Ixodes scapularis]
          Length = 251

 Score =  216 bits (551), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/243 (46%), Positives = 157/243 (64%), Gaps = 2/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+ +A++Q
Sbjct: 9   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTSARSQ 68

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 69  NLPKERIDKAINSANDSSNTENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 128

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F+  G I Y SNI  +   +E  IE D  +++ +D  +  Y D  N
Sbjct: 129 YGGSLGETGSVNYLFKHCGVIQYLSNIASNENILEAVIELDVDDIISDDTTHTIYTDIEN 188

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 189 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEILEESDDVQRVFGNYE 248

Query: 239 IAD 241
           ++D
Sbjct: 249 LSD 251


>gi|161723846|ref|NP_360318.2| hypothetical protein RC0681 [Rickettsia conorii str. Malish 7]
 gi|33517085|sp|Q92HU0|Y681_RICCN RecName: Full=UPF0082 protein RC0681
          Length = 253

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 61  NLPKERIDKAINSANDSSNNENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFNHCGVIQYPINIASNKDILEAVIEAGGHDIISDDTTHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 181 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEVLEESDDVQRVFGNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|167644746|ref|YP_001682409.1| hypothetical protein Caul_0780 [Caulobacter sp. K31]
 gi|189040605|sp|B0SUN3|Y780_CAUSK RecName: Full=UPF0082 protein Caul_0780
 gi|167347176|gb|ABZ69911.1| protein of unknown function DUF28 [Caulobacter sp. K31]
          Length = 251

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 168/246 (68%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK R DA +SK+FSKLSREITV+AK    +P  NPRLRLA+ NAK +S
Sbjct: 1   MAGHSKFKNIMHRKGRADAARSKLFSKLSREITVAAKSGVPDPNMNPRLRLAVNNAKAES 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+ I+RAIKK+   D  +Y+ IRYEG    GV II+E LTDN+NR A+++RS FTK  
Sbjct: 61  LPKDVIDRAIKKSQMGDAADYSEIRYEGVAAGGVGIIVEVLTDNKNRAAANVRSYFTKMG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF----EDQEYIFYCDF 176
           G++G+T S    ++++G++ Y +     +  ME AIE+ A +V+     E + +I Y  F
Sbjct: 121 GNMGATNSVAFNYDRVGQVSYPAKAASEDDMMEAAIEAGADDVVSDMDEEGEGHIVYTAF 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++   +  LE K G A + K+ W+P   + ++  D V +++K+++ L DDDDVQ+VYSN
Sbjct: 181 ESLNEVAAALEAKFGPASNTKIAWRPKMQVPVTG-DAVATLMKLLDALNDDDDVQAVYSN 239

Query: 237 LEIADD 242
            EI+D+
Sbjct: 240 EEISDE 245


>gi|157964633|ref|YP_001499457.1| hypothetical protein RMA_0775 [Rickettsia massiliae MTU5]
 gi|157844409|gb|ABV84910.1| hypothetical protein RMA_0775 [Rickettsia massiliae MTU5]
          Length = 308

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN-PLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK    N P  NPRLR A+  A++Q
Sbjct: 56  MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNIPENNPRLRNALTTARSQ 115

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S ++ NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 116 NLPKERIDKAINSANDSSNIENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 175

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E AIE+   +++ +D  +  Y D  N
Sbjct: 176 YGGSLGETGSVNYLFNHCGVIQYPINIASNEDVLEAAIEAGGNDIISDDTTHTIYTDIEN 235

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 236 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEVLEESDDVQRVFGNYE 295

Query: 239 IADDI 243
           ++D +
Sbjct: 296 LSDGV 300


>gi|15619771|gb|AAL03219.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 295

 Score =  214 bits (546), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 43  MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 102

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 103 NLPKERIDKAINSANDSSNNENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 162

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 163 YGGSLGETGSVNYLFNHCGVIQYPINIASNKDILEAVIEAGGHDIISDDTTHTIYTDIEN 222

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 223 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEVLEESDDVQRVFGNYE 282

Query: 239 IADDI 243
           ++DD+
Sbjct: 283 LSDDV 287


>gi|157826982|ref|YP_001496046.1| hypothetical protein A1I_03240 [Rickettsia bellii OSU 85-389]
 gi|166229092|sp|A8GVY2|Y3240_RICB8 RecName: Full=UPF0082 protein A1I_03240
 gi|157802286|gb|ABV79009.1| hypothetical protein A1I_03240 [Rickettsia bellii OSU 85-389]
          Length = 256

 Score =  214 bits (545), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 158/244 (64%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  + K    NP  NPRLR A+  A++Q+
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKAGSTNPDNNPRLRTALATARSQN 60

Query: 61  MPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK 
Sbjct: 61  LPKERIDKAINSANDSANNENYTEIRYEGYAPGGIAIIVEALTDNKNRTAAEVRSSFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG TGS    F+  G I Y   I  +   +E AIE+ A +++ ++  +  Y D  N 
Sbjct: 121 GGNLGETGSVNFLFKHCGVIQYPLEISSAENILETAIEAGADDIVSDEVLHTIYTDIENF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L +K G A+   + W PLN I + + +K + ++K+++ LE+ DDVQ V+ N E+
Sbjct: 181 SKVLEFLTDKYGTAEEAYIGWVPLNTIIIDDKEKAEKLLKLVDLLEESDDVQRVFGNYEL 240

Query: 240 ADDI 243
           +D+I
Sbjct: 241 SDEI 244


>gi|229586849|ref|YP_002845350.1| hypothetical protein RAF_ORF0717 [Rickettsia africae ESF-5]
 gi|259647113|sp|C3PNU7|Y717_RICAE RecName: Full=UPF0082 protein RAF_ORF0717
 gi|228021899|gb|ACP53607.1| Unknown [Rickettsia africae ESF-5]
          Length = 253

 Score =  214 bits (544), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 154/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S +  NYT IRYEGY P G+AII+E LTDN+NRTA+ +RS FTK
Sbjct: 61  NLPKERIDKAINSANDSSNNENYTEIRYEGYAPNGIAIIVEVLTDNKNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFNHCGVIQYPINIASNEDVLEAVIEAGGHDIISDDTTHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 181 FSKVLAFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEVLEESDDVQRVFGNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|157803685|ref|YP_001492234.1| hypothetical protein A1E_02520 [Rickettsia canadensis str. McKiel]
 gi|166228396|sp|A8EYL6|Y2520_RICCK RecName: Full=UPF0082 protein A1E_02520
 gi|157784948|gb|ABV73449.1| hypothetical protein A1E_02520 [Rickettsia canadensis str. McKiel]
          Length = 252

 Score =  213 bits (543), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 157/245 (64%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI +RK  +D  ++KIF+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQYRKGAQDKKRAKIFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  + +  NY  IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 61  NLPKERIDKAINSANDASNTENYMEIRYEGYAPSGIAIIVEALTDNKNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F+  G I Y SNI  S   +E  +E D  ++  +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFKHCGVIQYLSNIVSSENILEAVMEVDVDDITSDDTIHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+SN E
Sbjct: 181 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEVLEESDDVQRVFSNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|161777627|ref|YP_426174.2| hypothetical protein Rru_A1086 [Rhodospirillum rubrum ATCC 11170]
 gi|118573915|sp|Q2RVF8|Y1086_RHORT RecName: Full=UPF0082 protein Rru_A1086
          Length = 249

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 165/245 (67%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++++F+KL+REITVSAKL   +P  NPRLR AI  A+ QS
Sbjct: 1   MAGHSQFKNIMHRKGGQDAKRAQLFTKLAREITVSAKLGSPDPNANPRLRAAILAARAQS 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+NI+RAI KA S  D  N   +RYEGYGP  VA+I+E LTDNRNRTAS +R+ F+K 
Sbjct: 61  LPKDNIQRAIDKATSGGDAANLEELRYEGYGPGNVAVIVECLTDNRNRTASEVRTAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G +GS    FE++G I Y    G ++  ++  IE+ A +V   +  +   C  +++
Sbjct: 121 GGTMGESGSVAFNFERVGLIHYPLKAGAADAVLDAGIEAGADDVQSSEDGHDITCRPDDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
              SK LE  +G+ +  ++ WKPL  + + +AD V +++K ++ L+D DDVQ V +N EI
Sbjct: 181 NAVSKALEAALGDPEFARLDWKPLVQVPV-DADTVPALMKFLDILDDCDDVQRVAANYEI 239

Query: 240 ADDII 244
            D I+
Sbjct: 240 DDAIM 244


>gi|332188824|ref|ZP_08390533.1| hypothetical protein SUS17_3945 [Sphingomonas sp. S17]
 gi|332011134|gb|EGI53230.1| hypothetical protein SUS17_3945 [Sphingomonas sp. S17]
          Length = 247

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 113/244 (46%), Positives = 165/244 (67%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S  FSKLSREITV+AK+   +P  NPRLR A+  AK  S
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSAAFSKLSREITVAAKMGTPDPDMNPRLRAAVNAAKAAS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI RAI KA   D  NY  IRYEG+GP GV++IIEALTDNRNRTA+++R+  +K  
Sbjct: 61  MPKDNIARAIDKASRGDGENYEEIRYEGFGPGGVSLIIEALTDNRNRTATNVRTAVSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ GS +  F+++G I Y ++ GD+    E A+E+ A +V   +  +  +    ++ 
Sbjct: 121 GNLGTAGSVSHGFDRMGLINYPASAGDAEKVFEAALEAGAEDVTSSEDGHEIWTAQADLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE  +GEA+  K+ W+P   + +  A    ++ K+I+ L+DDDDVQ+V+ N E++
Sbjct: 181 EVAKALEPVLGEAEGAKLAWRPQTMVAVDEA-AAATLFKLIDTLDDDDDVQTVWGNYEVS 239

Query: 241 DDII 244
           D+++
Sbjct: 240 DEVM 243


>gi|83575336|gb|ABC21887.1| Protein of unknown function DUF28 [Rhodospirillum rubrum ATCC
           11170]
          Length = 262

 Score =  213 bits (541), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/245 (46%), Positives = 165/245 (67%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++++F+KL+REITVSAKL   +P  NPRLR AI  A+ QS
Sbjct: 14  MAGHSQFKNIMHRKGGQDAKRAQLFTKLAREITVSAKLGSPDPNANPRLRAAILAARAQS 73

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+NI+RAI KA S  D  N   +RYEGYGP  VA+I+E LTDNRNRTAS +R+ F+K 
Sbjct: 74  LPKDNIQRAIDKATSGGDAANLEELRYEGYGPGNVAVIVECLTDNRNRTASEVRTAFSKN 133

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G +GS    FE++G I Y    G ++  ++  IE+ A +V   +  +   C  +++
Sbjct: 134 GGTMGESGSVAFNFERVGLIHYPLKAGAADAVLDAGIEAGADDVQSSEDGHDITCRPDDL 193

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
              SK LE  +G+ +  ++ WKPL  + + +AD V +++K ++ L+D DDVQ V +N EI
Sbjct: 194 NAVSKALEAALGDPEFARLDWKPLVQVPV-DADTVPALMKFLDILDDCDDVQRVAANYEI 252

Query: 240 ADDII 244
            D I+
Sbjct: 253 DDAIM 257


>gi|91205383|ref|YP_537738.1| hypothetical protein RBE_0568 [Rickettsia bellii RML369-C]
 gi|119369526|sp|Q1RJ15|Y568_RICBR RecName: Full=UPF0082 protein RBE_0568
 gi|91068927|gb|ABE04649.1| unknown [Rickettsia bellii RML369-C]
          Length = 253

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 108/244 (44%), Positives = 157/244 (64%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  + K    NP  NPRLR A+  A++Q+
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKAGSTNPDNNPRLRTALATARSQN 60

Query: 61  MPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK 
Sbjct: 61  LPKERIDKAINSANDSANNENYTEIRYEGYAPGGIAIIVEALTDNKNRTAAEVRSSFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG TGS    F+  G I Y   I  +   +E AIE+   +++ ++  +  Y D  N 
Sbjct: 121 GGNLGETGSVNFLFKHCGVIQYPLEISSAENILETAIEAGTDDIVSDEVLHTIYTDIENF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L +K G A+   + W PLN I + + +K + ++K+++ LE+ DDVQ V+ N E+
Sbjct: 181 SKVLEFLTDKYGTAEEAYIGWVPLNTIIIDDKEKAEKLLKLVDLLEESDDVQRVFGNYEL 240

Query: 240 ADDI 243
           +D+I
Sbjct: 241 SDEI 244


>gi|157828650|ref|YP_001494892.1| hypothetical protein A1G_04400 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|166227257|sp|A8GSK9|Y4400_RICRS RecName: Full=UPF0082 protein A1G_04400
 gi|157801131|gb|ABV76384.1| hypothetical protein A1G_04400 [Rickettsia rickettsii str. 'Sheila
           Smith']
          Length = 253

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 153/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++A+  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 61  NLPKERIDKALNSANESSNNENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFNHCGVIQYPINIASNEDVLEAVIEAGGHDIISDDTTHTIYTDVEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                     K G  +   + W PLN I + + +K   ++K++E LE+ DDVQ V+ N E
Sbjct: 181 FSKVLDFFTGKYGIPEDSYIGWIPLNTIIIDDKEKAAKLLKLVEVLEESDDVQRVFGNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|67459191|ref|YP_246815.1| hypothetical protein RF_0799 [Rickettsia felis URRWXCal2]
 gi|75536377|sp|Q4ULC3|Y799_RICFE RecName: Full=UPF0082 protein RF_0799
 gi|67004724|gb|AAY61650.1| unknown [Rickettsia felis URRWXCal2]
          Length = 252

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 155/244 (63%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN-PLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  + K    N P  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAVKTGSSNIPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           ++PKE I++AI  A   +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK 
Sbjct: 61  NLPKERIDKAINSADDANTENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSGFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG TGS    F+  G I Y +NI  +    E AIE+   +++ ++  +  Y D  N 
Sbjct: 121 GGSLGETGSVNYLFKHCGVIQYPTNIASNEDIFEAAIEAGGDDIVSDEIFHTIYTDIENF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E+
Sbjct: 181 SKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEILEESDDVQRVFGNYEL 240

Query: 240 ADDI 243
           +DD+
Sbjct: 241 SDDV 244


>gi|165933367|ref|YP_001650156.1| hypothetical protein RrIowa_0924 [Rickettsia rickettsii str. Iowa]
 gi|165908454|gb|ABY72750.1| hypothetical cytosolic protein [Rickettsia rickettsii str. Iowa]
          Length = 295

 Score =  211 bits (538), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 153/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 43  MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 102

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++A+  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 103 NLPKERIDKALNSANESSNNENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTK 162

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 163 YGGSLGETGSVNYLFNHCGVIQYPINIASNEDVLEAVIEAGGHDIISDDTTHTIYTDVEN 222

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                     K G  +   + W PLN I + + +K   ++K++E LE+ DDVQ V+ N E
Sbjct: 223 FSKVLDFFTGKYGIPEDSYIGWIPLNTIIIDDKEKAAKLLKLVEVLEESDDVQRVFGNYE 282

Query: 239 IADDI 243
           ++DD+
Sbjct: 283 LSDDV 287


>gi|23015561|ref|ZP_00055333.1| COG0217: Uncharacterized conserved protein [Magnetospirillum
           magnetotacticum MS-1]
          Length = 249

 Score =  211 bits (536), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 163/245 (66%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K+F+KL RE+TVSAK    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRAKVFTKLIRELTVSAKSGMPDPAANPRLRAAIVAARAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ ++RAIK+ AG +D  NY  +RYEGYGP  VAII+E LTDNRNRTA+ +R+ F K 
Sbjct: 61  MSKDTMDRAIKRGAGGEDGTNYEEVRYEGYGPGSVAIIVEGLTDNRNRTATEVRTAFNKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG T S +  F+++G I Y ++   +    E A+++ A  V  +++ +   C  +++
Sbjct: 121 GGALGETNSVSFMFDRVGAIRYPASAAGAEAMFEGALDAGADNVESDEEGHEITCAPDDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     LE K G  +  ++ WKP   + +++ D  ++++K+++ LED+DDVQ V +N EI
Sbjct: 181 GAVRDALEAKFGTPEYARLDWKPQTTVPVADEDTARTLLKLLDTLEDNDDVQRVQANFEI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIM 245


>gi|157825896|ref|YP_001493616.1| hypothetical protein A1C_04175 [Rickettsia akari str. Hartford]
 gi|166227232|sp|A8GNY3|Y4175_RICAH RecName: Full=UPF0082 protein A1C_04175
 gi|157799854|gb|ABV75108.1| hypothetical protein A1C_04175 [Rickettsia akari str. Hartford]
          Length = 252

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 109/244 (44%), Positives = 153/244 (62%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN-PLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  + K    N P  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKCAQDKKRAKVFTKLIREIVTAVKTGSSNIPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           ++PKE I++AI  A   +  NYT IRYEGY P G+AII+EALTDN+NRTA+ +RS FTK 
Sbjct: 61  NLPKERIDKAINSADDANTENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEVRSSFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG TGS    F+  G I Y +NI  +    E AIE+   +++ +   +    D  N 
Sbjct: 121 GGSLGETGSVNYLFKHCGVIQYPTNIASNEDIFEAAIEAGGDDIVSDAIFHTICTDIENF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+SN E 
Sbjct: 181 SKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDTEKAEKLLKLVEALEESDDVQRVFSNYEF 240

Query: 240 ADDI 243
           +DD+
Sbjct: 241 SDDV 244


>gi|162319783|ref|YP_422583.2| hypothetical protein amb3220 [Magnetospirillum magneticum AMB-1]
          Length = 249

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 108/245 (44%), Positives = 162/245 (66%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K+F+KL RE+TVSAK    +P  NPRLR AI  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRAKVFTKLIRELTVSAKSGMPDPAANPRLRAAIVAARAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ ++RAIK+ AG +D  NY  +RYEGYGP  VAII+E LTDNRNRTA+ +R+ F K 
Sbjct: 61  MSKDTMDRAIKRGAGGEDGTNYEEVRYEGYGPGSVAIIVEGLTDNRNRTATEVRTAFNKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG T S +  F+++G I Y ++   +    E A+++ A  V  ++  +   C  +++
Sbjct: 121 GGALGETNSVSFMFDRVGAIRYPASAAGAEAMFEGALDAGADNVESDEDGHEITCAPDDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     LE K G  +  ++ WKP   + +++ +  ++++K+++ LED+DDVQ V +N EI
Sbjct: 181 GAVRDALEAKFGTPEYARLDWKPQTTVPVADEETARTLLKLLDTLEDNDDVQRVQANFEI 240

Query: 240 ADDII 244
            DDI+
Sbjct: 241 PDDIM 245


>gi|238650874|ref|YP_002916729.1| hypothetical protein RPR_05505 [Rickettsia peacockii str. Rustic]
 gi|259647082|sp|C4K280|Y5505_RICPU RecName: Full=UPF0082 protein RPR_05505
 gi|238624972|gb|ACR47678.1| hypothetical protein RPR_05505 [Rickettsia peacockii str. Rustic]
          Length = 253

 Score =  210 bits (534), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 154/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI ++AK  S  NP  NPRLR A+  A+ Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDTKRAKVFTKLIREIVIAAKTGSSNNPENNPRLRNALTAARIQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++A+  A  S +  NYT IRYEGY   G+AII+EALTDN+NRTA+ +RS FTK
Sbjct: 61  NLPKERIDKALNSANDSSNNENYTEIRYEGYAQNGIAIIVEALTDNKNRTAAEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFNHCGVIQYPINIASNEDVLEAVIEAGGHDIISDDTTHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE  DDVQ V+ N E
Sbjct: 181 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLVEVLEKSDDVQKVFGNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|42526995|ref|NP_972093.1| hypothetical protein TDE1487 [Treponema denticola ATCC 35405]
 gi|49036513|sp|P62042|Y1487_TREDE RecName: Full=UPF0082 protein TDE_1487
 gi|41817419|gb|AAS12004.1| conserved hypothetical protein TIGR01033 [Treponema denticola ATCC
           35405]
 gi|325474057|gb|EGC77245.1| hypothetical protein HMPREF9353_01595 [Treponema denticola F0402]
          Length = 247

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 109/243 (44%), Positives = 159/243 (65%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H K   DA + ++F+K  +EI+++AK+ G +P  NPRLR A+  A+  +
Sbjct: 1   MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISIAAKMGGGDPATNPRLRTAVLKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NIERAIKK G+ +LG  NY  + YEGYGP GVA+++E LTDN+NRTA+S+R+IFTK
Sbjct: 61  MPKDNIERAIKK-GTGELGAVNYEELLYEGYGPGGVAVLVEVLTDNKNRTAASVRNIFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           + G+LG+TGS    F + G I Y + +      ME A+E+ A ++  ED       D N+
Sbjct: 120 SGGNLGATGSVAYMFNRKGVIEYDAEVVSEEAIMEAALEAGAEDIATEDGVITVTTDPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L+EK  E+ S  V   P  Y+ L +AD  +  +KMI+ LE+DDDVQ+V SN+E
Sbjct: 180 FASVLEALQEKGFESVSAAVSMVPDTYVAL-DADTTQKALKMIDKLEEDDDVQTVSSNIE 238

Query: 239 IAD 241
           I +
Sbjct: 239 IPE 241


>gi|124008996|ref|ZP_01693681.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
 gi|123985422|gb|EAY25330.1| conserved hypothetical protein [Microscilla marina ATCC 23134]
          Length = 248

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/244 (47%), Positives = 156/244 (63%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL +EITV+AK+   +P  NPRLRLAIQNAK  +
Sbjct: 1   MAGHSKWANIKHRKGAQDAKRGKIFTKLIKEITVAAKIGSPDPETNPRLRLAIQNAKGVN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIERAIKKA   D  +YT   YEGY P G+A+ +E  TDN NRT +S+RSIF K  
Sbjct: 61  MPKDNIERAIKKATGADGTDYTETTYEGYAPNGIAVFVECTTDNLNRTVASVRSIFNKYG 120

Query: 121 GSLGSTGSTTRFFEQIG--EIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G+L + GS    F++ G  +II    I      +E+A +  A EV F D   +  C   +
Sbjct: 121 GNLATNGSVEFLFDRKGVFQIIRPEGIDADEFELELA-DGGAEEVEFSDDYIVVTCAMED 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G   KKL+E   EA++  +   P   + LS+ D  +S +K+I+ LEDDDDVQ VY N+E
Sbjct: 180 FGNVQKKLDEMTIEAENAGLERIPTTSVNLSDEDLQQS-MKVIDKLEDDDDVQKVYHNIE 238

Query: 239 IADD 242
           I+++
Sbjct: 239 ISEE 242


>gi|170723162|ref|YP_001750850.1| hypothetical protein PputW619_4001 [Pseudomonas putida W619]
 gi|169761165|gb|ACA74481.1| protein of unknown function DUF28 [Pseudomonas putida W619]
          Length = 248

 Score =  209 bits (531), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/246 (43%), Positives = 164/246 (66%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + KIF+K  RE+TV+AK  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAAKQGGGDPASNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+++  N   + YEGYGP GVAI++EA+TDNRNRTA+++R  FTK 
Sbjct: 61  MSRDIIDRAVARGAGTNESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + D +  ME A+E+DA +V+  ED  +  +  FN+
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGV-DEDALMEAAMEADADDVVANEDGSFEVFTSFNS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEE   +A   +++ +P     L + +  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEEAGFKAADAEIVMQPTTSAEL-DQEGAEKVLKLIDMLEDLDDVQNVYSNAQ 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|325274572|ref|ZP_08140630.1| hypothetical protein G1E_15175 [Pseudomonas sp. TJI-51]
 gi|324100299|gb|EGB98087.1| hypothetical protein G1E_15175 [Pseudomonas sp. TJI-51]
          Length = 248

 Score =  208 bits (529), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 164/246 (66%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + K+F+K  RE+TV+AK  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGGPDPASNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+++  N   + YEGYGP GVAI++EA+TDNRNRTA+++R  FTK 
Sbjct: 61  MSRDIIDRAVARGAGTNESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G++ +   + D +  ME A+E+DA +V+  ED  +  +  FN+
Sbjct: 121 GGNLGTDGSVAYLFERKGQLSFAPGV-DEDALMEAAMEADADDVVANEDGSFEVFTSFNS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEE   +A   +++ +P     L + +  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRTALEEAGFKAADAEIVMQPTTSAELDH-EGAEKVLKLIDMLEDLDDVQNVYSNAQ 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|297717820|gb|ADI50053.1| hypothetical protein [Candidatus Odyssella thessalonicensis L13]
          Length = 247

 Score =  207 bits (528), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 162/245 (66%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++++F+K++REI VSA++ G +P  NPRLR A+  A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRARMFAKIAREIIVSARI-GADPSANPRLRAAMAAARAAN 59

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAIKKA G +D  NY  +RYEGYGP G A+I+E+LTDNRNRTAS +RS FTK 
Sbjct: 60  MPKDNVDRAIKKAVGGEDTANYEEVRYEGYGPGGTALIVESLTDNRNRTASEVRSAFTKC 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G TGS    F+++G I     +G  +   E A+E+ A  +      Y      +N 
Sbjct: 120 GGNMGETGSVAFMFDRVGLIQLSKTVGSYDEVFEKAVEAGADNLEEGGDFYEIIATVDNF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 + +   +    K++W+P N I + + +  + I+K+I+ LED+DDVQ+VY N E+
Sbjct: 180 AAVRDAISQDYEDISESKLVWRPQNTIAV-DEEAAQKILKLIDTLEDNDDVQNVYCNFEV 238

Query: 240 ADDII 244
           ++DI+
Sbjct: 239 SEDIL 243


>gi|296535994|ref|ZP_06898138.1| glucose-1-phosphate adenylyl transferase [Roseomonas cervicalis
           ATCC 49957]
 gi|296263680|gb|EFH10161.1| glucose-1-phosphate adenylyl transferase [Roseomonas cervicalis
           ATCC 49957]
          Length = 249

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/245 (46%), Positives = 162/245 (66%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA +++ F+KL REITVSA+    +P  NPRLR A+Q A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRARAFAKLIREITVSARQGLPDPAFNPRLRSAVQAARVAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ I+RAIKKA     G +Y  +RYEGYGP GVAII+E LTDNRNRTAS IRS F+K 
Sbjct: 61  MTKDTIDRAIKKASGAAAGEDYVEVRYEGYGPAGVAIIVETLTDNRNRTASDIRSAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG T S    FE+ G + Y +   D++  +E AIE+ A +V    + +       ++
Sbjct: 121 GGALGETNSVAFQFERNGVVRYPAAAADADAMLEAAIEAGAADVESGAEGHEIRTAIEDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LEEK G A+S K+ W+P   + L + +K +S++K+I+ L++ DDVQ+V +N E+
Sbjct: 181 FTVRDALEEKFGPAESAKLEWRPNVTVEL-DEEKARSVLKLIDVLDEHDDVQTVTANFEV 239

Query: 240 ADDII 244
            +D++
Sbjct: 240 PEDVL 244


>gi|162146620|ref|YP_001601079.1| hypothetical protein GDI_0798 [Gluconacetobacter diazotrophicus PAl
           5]
 gi|161785195|emb|CAP54741.1| conserved protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 239

 Score =  207 bits (526), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 104/237 (43%), Positives = 150/237 (63%), Gaps = 8/237 (3%)

Query: 11  MHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSMPKENIERAI 70
           MHRK  +DA +++ F+K+ REITV+A+    +P  NPRLR AI  A+  +MPK+ +ERAI
Sbjct: 1   MHRKGAQDARRARQFAKVIREITVAARSGMPDPASNPRLRAAISAAREVNMPKDTVERAI 60

Query: 71  KKA----GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKANGSLGST 126
           KKA    G DD   Y  +RYEGYGP GVA+I+EALTDNRNRTAS +R+ F+K  GSLG T
Sbjct: 61  KKATGAGGGDD---YAEVRYEGYGPAGVAVIVEALTDNRNRTASDVRAAFSKHGGSLGET 117

Query: 127 GSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVGLTSKKL 186
            S +  F ++G I Y + +   +  +E AIE+ A  V   D+ +   C   +       L
Sbjct: 118 NSVSFMFTRLGVITYPAAVATEDEMLEAAIEAGAENVESTDEGHEVTCPVESFFAVRDAL 177

Query: 187 EEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIADDI 243
           E + GE  S K  W+P   + L + DK + ++K+I+ L++ DDVQ+VY+N ++ DD+
Sbjct: 178 ETRFGEPSSAKFDWRPGTVVTL-DEDKARGVLKLIDVLDEHDDVQAVYANFDLPDDV 233


>gi|94264072|ref|ZP_01287871.1| Protein of unknown function DUF28 [delta proteobacterium MLMS-1]
 gi|93455488|gb|EAT05678.1| Protein of unknown function DUF28 [delta proteobacterium MLMS-1]
          Length = 249

 Score =  206 bits (524), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 160/246 (65%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK   DA + KIFS+L++EI V+A+L G +   NPRLR A+  AK ++
Sbjct: 1   MAGHSKWANIKRRKGAVDAKRGKIFSRLNKEIMVAARLGGGDSTGNPRLRSALAAAKAEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKEN+ERAIKK  G  +   Y  I YEGYGP GVA+++EA+TDNR RT + +R  F+KA
Sbjct: 61  MPKENVERAIKKGTGELEGAAYEEITYEGYGPGGVAVLVEAMTDNRVRTVAEVRHAFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LG T S +  F++ G++ I    + + +L +E+A+E+ A +++ ++Q +   CD   
Sbjct: 121 GGNLGETNSVSWMFDKKGQVFIERQGLAEDDL-LEMALEAGAEDMISDEQSFQILCDPGE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               S+ L E+        V   P N + +S+    + ++KM+E LED+DDVQ V+SNL+
Sbjct: 180 FDQVSQALRERGLPVSEAAVTMIPKNLVEVSDEKTARQLLKMLEMLEDNDDVQQVHSNLD 239

Query: 239 IADDII 244
           IADD++
Sbjct: 240 IADDLV 245


>gi|294085858|ref|YP_003552618.1| hypothetical protein SAR116_2291 [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292665433|gb|ADE40534.1| hypothetical cytosolic protein [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 246

 Score =  206 bits (523), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 113/247 (45%), Positives = 169/247 (68%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNI HRK  +D  ++KIF +L +E+TV+A+ S  +P  NPRLR A+  A+  +
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKIFGRLIKELTVAAR-SSTDPDSNPRLRTALSAARAAN 59

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NIER +K+A   +  NY  IRYEGYGP G A+I++A+TDNRNRTAS +RS FTK  
Sbjct: 60  MPKDNIERVLKRAEGGEGENYDEIRYEGYGPGGTALIVDAMTDNRNRTASEVRSAFTKYG 119

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DFN 177
           GSLG TGS +  F+++G++I+ S++  ++   E A+E+ A  V  ++  +   C   DFN
Sbjct: 120 GSLGETGSVSFMFDRVGQMIFPSDVASADDMFEAALEAGADNVESDESSHEVTCAPEDFN 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           NV    + +E   G  +   +IWKP N I +S A  + +++K+++ L+D+DDVQ+V SN 
Sbjct: 180 NV---REAMENAFGAPEESGLIWKPQNTIEVSEAHAI-TLLKLLDVLDDNDDVQNVSSNF 235

Query: 238 EIADDII 244
           +I+DDI+
Sbjct: 236 DISDDIL 242


>gi|146283146|ref|YP_001173299.1| hypothetical protein PST_2811 [Pseudomonas stutzeri A1501]
 gi|145571351|gb|ABP80457.1| conserved hypothetical protein [Pseudomonas stutzeri A1501]
 gi|327481499|gb|AEA84809.1| conserved hypothetical protein [Pseudomonas stutzeri DSM 4166]
          Length = 249

 Score =  205 bits (522), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 162/251 (64%), Gaps = 13/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + KIF+KL RE+TV+AK  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKIFTKLIRELTVAAKHGGGVPADNPRLRLAVDKALTAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M +E I+RAI + AGS++  N T + YEGY P GVAIIIEA+TDNRNRTA+ +R  F+K 
Sbjct: 61  MSREVIDRAIARGAGSNEADNMTELSYEGYAPSGVAIIIEAMTDNRNRTAAEVRHAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFED----QEYIFYCD 175
            G+LG+ GS    F++ G+I Y   + D +  ME A+E+ A +V+ ++    + Y  + D
Sbjct: 121 GGNLGTDGSVAYMFDRKGQISYAPGV-DEDALMEAALEAGADDVVTQEDGSVEVYTSFAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F +V   LT    +    E   I  I  P     +++ +  + ++++I+ LED DDVQ+V
Sbjct: 180 FLSVNEALTEAGFKGDEAEVAMIPSIMAP-----ITDVETAQKVLRLIDALEDLDDVQNV 234

Query: 234 YSNLEIADDII 244
           Y N EIAD+I+
Sbjct: 235 YHNAEIADEIM 245


>gi|225848858|ref|YP_002729022.1| hypothetical protein SULAZ_1049 [Sulfurihydrogenibium azorense
           Az-Fu1]
 gi|225644599|gb|ACN99649.1| conserved hypothetical protein [Sulfurihydrogenibium azorense
           Az-Fu1]
          Length = 251

 Score =  205 bits (522), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 164/249 (65%), Gaps = 8/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI ++K + DA++ KIF+K+ +EITV+A+L G +P  NPRLR+AI+ AK  +
Sbjct: 1   MAGHSKWHNIKNKKAKMDAIRGKIFTKVIKEITVAARLGGGDPEANPRLRMAIEKAKEVN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIK+   +  G NY  +RYEGYGPEGVAII+EA TDNRNRT + +R IF+K 
Sbjct: 61  MPSENIERAIKRGTGELEGVNYEEVRYEGYGPEGVAIIVEATTDNRNRTTAEVRHIFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEY----IFYCD 175
            G+LGS+G  +  FE  G I    +       +E A+E+ A +V+ +D++Y        D
Sbjct: 121 GGNLGSSGCVSFLFEDKGVINVEKSKYSEEEILEKALEAGAEDVITDDEDYYEIRTSVQD 180

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V    +K+  +I  A+  K+   P   ++++N +    ++K+++ LED+DDVQ VY+
Sbjct: 181 FYKVKENLEKMGVEIARAELTKI---PTTTVKITNEETATKLMKLLDALEDNDDVQKVYA 237

Query: 236 NLEIADDII 244
           N +I ++++
Sbjct: 238 NFDIPEELL 246


>gi|160946336|ref|ZP_02093545.1| hypothetical protein PEPMIC_00296 [Parvimonas micra ATCC 33270]
 gi|158447452|gb|EDP24447.1| hypothetical protein PEPMIC_00296 [Parvimonas micra ATCC 33270]
          Length = 247

 Score =  202 bits (514), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 158/244 (64%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K ++DA + KIF+KL+R I V+ K  G +P  NP L+ AI+ AK ++
Sbjct: 1   MSGHNKWSTIKHKKGKEDARRGKIFTKLARYIIVAVKEGGADPEYNPSLKTAIEKAKAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERA+KK AG  D  NY  I YEGYGPEG+A+++E LTDNRNRTA+ +R  F K 
Sbjct: 61  MPNDNIERALKKGAGDGDSSNYETIIYEGYGPEGIAVVVECLTDNRNRTAADVRHAFDKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG  GS    FE+ G I+   +  + +  M+ A+E+ A +   +++ Y  Y + ++ 
Sbjct: 121 GGNLGQNGSVLFMFEKKGVIVISRDQAEEDDLMDFALENGASDFESDEEVYTIYSEVSDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L+EK     + ++ + P N  ++SN D +K ++KMI+ LED+DDVQ+VY N EI
Sbjct: 181 ITLRDALQEKGYTFSACELEYVPNNNSQISNPDNIKKMVKMIDQLEDNDDVQNVYHNWEI 240

Query: 240 ADDI 243
            +D+
Sbjct: 241 PEDL 244


>gi|34581562|ref|ZP_00143042.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262947|gb|EAA26451.1| unknown [Rickettsia sibirica 246]
          Length = 253

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 113/245 (46%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKL-SGQNPLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  ++K+F+KL REI  +AK  S  NP  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKRAKVFTKLIREIVTAAKTGSSNNPENNPRLRNALTAARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  S +  NYT IRYEGY P G+AII+EALTDN+NRTA+ IRS FTK
Sbjct: 61  NLPKERIDKAINSANDSSNNENYTEIRYEGYAPNGIAIIVEALTDNKNRTAAEIRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GSLG TGS    F   G I Y  NI  +   +E  IE+   +++ +D  +  Y D  N
Sbjct: 121 YGGSLGETGSVNYLFNHCGVIQYPINIASNEDVLEAVIEAGGHDIISDDTTHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K G  +   + W PLN I + + +K + ++K++E LE+ DDVQ V+ N E
Sbjct: 181 FSKVLEFLTGKYGIPEDSYIGWIPLNTIIIDDKEKAEKLLKLLEVLEESDDVQRVFGNYE 240

Query: 239 IADDI 243
           ++DD+
Sbjct: 241 LSDDV 245


>gi|291280038|ref|YP_003496873.1| hypothetical protein DEFDS_1661 [Deferribacter desulfuricans SSM1]
 gi|290754740|dbj|BAI81117.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 249

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA K KIF+K++RE+ V+AK+ G +P  NPRLR+A++ A+  +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKKGKIFTKIARELMVAAKIGGSDPEMNPRLRVALEKARQAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKEN+ERAIKK  G  +  N+ ++ YEGYGP GVAI+++ALTDN+NRT + +RS  TK 
Sbjct: 61  MPKENVERAIKKGTGEGNESNFEDVIYEGYGPGGVAILVQALTDNKNRTVAEVRSTLTKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG  G     FE+ G I       D +  M++ +E+ A ++  ED  Y    + +  
Sbjct: 121 GGSLGEAGCVAWLFEKKGVIGIKRETIDEDTLMDIVLEAGAEDLKVEDDNYEVITEPSEY 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               K LE+K  + +  ++  KP N +++   +  K ++ +IE LED DDVQ VY+N +I
Sbjct: 181 YNVKKALEDKGIKIEYAELTMKPKNTVKVE-GENAKKLLGLIEALEDLDDVQEVYANFDI 239

Query: 240 ADDII 244
            D ++
Sbjct: 240 DDKVM 244


>gi|152985870|ref|YP_001349893.1| hypothetical protein PSPA7_4544 [Pseudomonas aeruginosa PA7]
 gi|167012955|sp|A6VA08|Y4544_PSEA7 RecName: Full=UPF0082 protein PSPA7_4544
 gi|150961028|gb|ABR83053.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 248

 Score =  201 bits (512), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 159/251 (63%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+KL RE+TV+AK  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAAKQGGGVPADNPRLRLAVDKALTAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI +  GS+D  N   + YEGY P GVAII+EA+TDNRNRTA+ +R  F+K 
Sbjct: 61  MTRDTIDRAIARGVGSNDADNMVELSYEGYAPSGVAIIVEAMTDNRNRTAAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE----YIFYCD 175
            G+LG+ GS    FE+ G+I +   + +  L M+ A+E+ A +V+  D      +  + D
Sbjct: 121 GGNLGTDGSVAYMFERKGQISFAPGVDEEAL-MDAALEAGADDVVVNDDGSIDVFTTFAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F +V   LT+   +   G+   + +I      + L  A KV   +K+I+ LED DDVQ+V
Sbjct: 180 FISVNEALTAAGFK---GDEAEVTMIPSTTATLDLETAQKV---LKLIDMLEDLDDVQNV 233

Query: 234 YSNLEIADDII 244
           YSN +I DD++
Sbjct: 234 YSNADIPDDVM 244


>gi|148555057|ref|YP_001262639.1| hypothetical protein Swit_2142 [Sphingomonas wittichii RW1]
 gi|166227669|sp|A5V885|Y2142_SPHWW RecName: Full=UPF0082 protein Swit_2142
 gi|148500247|gb|ABQ68501.1| protein of unknown function DUF28 [Sphingomonas wittichii RW1]
          Length = 247

 Score =  201 bits (510), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 157/244 (64%), Gaps = 1/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNIMHRK  +D  +S +FSKLSREITV+A++   +P  N RLR A+  A+ + 
Sbjct: 1   MAGHSKFKNIMHRKGAQDKKRSALFSKLSREITVAARMGLPDPAMNARLRQAVITARKEG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+NIER+I KA   D  NY  IRYEG+GP GVA+IIEALTDNRNRTA+++R+I +K  
Sbjct: 61  LPKDNIERSINKAAGGDGANYEEIRYEGFGPGGVALIIEALTDNRNRTATNVRTIVSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ GS +  F+++G I Y    GD+    E A+E+ A +V   +  +  +   + + 
Sbjct: 121 GNLGAGGSVSHGFDRLGLISYGLAAGDAEKVFEAALEAGADDVSSSEDGHEIWTAQDALH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
             +K LE  +GE    K+ W+P   + +   D  K +  +    + DDDVQ+V+ N ++ 
Sbjct: 181 EVAKALEPVLGEPDGAKLAWRPQTQVTVGEDDAAKLLKLIDALDD-DDDVQTVWGNYDVP 239

Query: 241 DDII 244
           ++++
Sbjct: 240 EEVM 243


>gi|226945721|ref|YP_002800794.1| hypothetical protein Avin_36720 [Azotobacter vinelandii DJ]
 gi|226720648|gb|ACO79819.1| conserved hypothetical protein [Azotobacter vinelandii DJ]
          Length = 249

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 158/251 (62%), Gaps = 13/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + KIF+KL RE+TV+AK  G NP +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKIFTKLIRELTVAAKHGGGNPADNPRLRLAMDKALTAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI + AG+ +  N   + YEGY P GVAII+EALTDNRNRTA+ +R  F+K 
Sbjct: 61  MTRDTIDRAIARGAGTSEADNMAELSYEGYAPSGVAIIVEALTDNRNRTAAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE----YIFYCD 175
            G+LG+ GS    F++ G+I +   + +  L ME A+E+ A +V+  D      +  + D
Sbjct: 121 GGNLGTDGSVAYMFDRKGQISFAPGVNEDAL-MEAALEAGADDVVGNDDGSVDVFTSFAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F+ V   L +   +    E   I  I  P     +++ +  + ++K+I+ LED DDVQ+V
Sbjct: 180 FHTVNEALVAAGFKGDEAEVAMIPSITAP-----IADLETAQKVMKLIDMLEDLDDVQNV 234

Query: 234 YSNLEIADDII 244
           Y N EI D+I+
Sbjct: 235 YHNAEIPDEIM 245


>gi|319790085|ref|YP_004151718.1| protein of unknown function DUF28 [Thermovibrio ammonificans HB-1]
 gi|317114587|gb|ADU97077.1| protein of unknown function DUF28 [Thermovibrio ammonificans HB-1]
          Length = 247

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 155/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KI++KL+REITV+A+  G +P  NPRLR AI+ A+  +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIYTKLAREITVAAREGGGDPETNPRLRAAIERARKFN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIK+   +  G  Y  + YEGYGP GVAII++ LTDNRNRTAS +R  F+K 
Sbjct: 61  MPKENIERAIKRGTGEIAGEAYEEVTYEGYGPGGVAIIVKCLTDNRNRTASEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++G  +  FE+ G I   ++  D    M  AI++ A +V+ ED +++ Y     +
Sbjct: 121 GGNLGTSGCVSWMFERKGVITVPADKFDEETVMLAAIDAGADDVVREDDKFVIYTQPTEL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               K L +   E +  K+   P    R+   +  + ++K++  LED DDVQ VYSN ++
Sbjct: 181 EAVRKGLLDAGIEVEEAKLDLIPTTTTRVE-GETAQKVLKLLMALEDLDDVQEVYSNFDM 239

Query: 240 ADDII 244
            ++++
Sbjct: 240 PEEVM 244


>gi|104783075|ref|YP_609573.1| hypothetical protein PSEEN4095 [Pseudomonas entomophila L48]
 gi|95112062|emb|CAK16789.1| conserved hypothetical protein [Pseudomonas entomophila L48]
          Length = 250

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 164/247 (66%), Gaps = 4/247 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + K+F+K  RE+TV+AK  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGGPDPASNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+++  N   + YEGYGP GVAI++EA+TDNRNRTA+++R  FTK 
Sbjct: 61  MSRDIIDRAVARGAGTNESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG-DSNLAMEVAIESDAFEVL-FEDQEYIFYCDFN 177
            G+LG+ GS    FE+ G+I + + +  + +  ME A+E+ A +V+  ED  +  +  F+
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAAELKVEEDALMEAALEAGADDVVNNEDGSFDVFTSFS 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +       LEE   +A   +++ +P     L + +  + ++K+I+ LED DDVQ+VYSN 
Sbjct: 181 SFYAVRNALEEGGFKASDAEIVMQPTTSAEL-DQEGAEKVLKLIDMLEDLDDVQNVYSNA 239

Query: 238 EIADDII 244
           +I+D+I+
Sbjct: 240 QISDEIM 246


>gi|225849643|ref|YP_002729877.1| hypothetical protein PERMA_0079 [Persephonella marina EX-H1]
 gi|254799888|sp|C0QT62|Y079_PERMH RecName: Full=UPF0082 protein PERMA_0079
 gi|225645009|gb|ACO03195.1| conserved hypothetical protein [Persephonella marina EX-H1]
          Length = 250

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 159/246 (64%), Gaps = 2/246 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K + DA + ++F+K+ REITV+A+  G +P  NPRLR+AI+ AK  +
Sbjct: 1   MAGHSKWHNIRHKKAKMDAKRGQMFTKIIREITVAARQGGGDPEFNPRLRIAIEKAKKAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIK+   +  G +Y  + YEGYGPEGVAII+E LTDNRNRT   +R IFTK 
Sbjct: 61  MPVENIERAIKRGTGELEGVSYEEVVYEGYGPEGVAIIVECLTDNRNRTTGEVRHIFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE-YIFYCDFNN 178
            G+LGS+G  +  FE+ G I+   +  D     E AIE+ A +V+ +D+E Y    +   
Sbjct: 121 GGNLGSSGCVSFLFEEKGVILVPKDKYDEETVFEKAIEAGAEDVITDDEEFYEIRTEPKE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    + LE++  E +  ++   P   + +++ +    ++K+++ LED+DDVQ VYSN E
Sbjct: 181 LYTVKENLEKEGIEIEKAELTRIPTTTVEINDEETATKLMKLLDALEDNDDVQKVYSNFE 240

Query: 239 IADDII 244
           ++  ++
Sbjct: 241 MSQQLM 246


>gi|99038014|gb|ABF64626.1| protein of unknown function DUF28 [Ruegeria sp. TM1040]
          Length = 209

 Score =  200 bits (509), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 93/207 (44%), Positives = 144/207 (69%), Gaps = 1/207 (0%)

Query: 38  LSGQNPLENPRLRLAIQNAKNQSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAII 97
           +   +P +NPRLRLA++ AK+ S+PK+ I+RAIKKA   D  NY  IRYEGYGP GVA+I
Sbjct: 1   MGDPDPEKNPRLRLAVKEAKSNSVPKDVIDRAIKKATGGDAENYDEIRYEGYGPNGVAVI 60

Query: 98  IEALTDNRNRTASSIRSIFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIE 157
           +E +TDN+NRTAS++RS F+K  G+LG TGS    FE+ GE+ Y +++GD++  M  AIE
Sbjct: 61  VETMTDNKNRTASTVRSTFSKNGGNLGETGSVGFMFERKGEVTYPASVGDADTVMMAAIE 120

Query: 158 SDAFEVLFEDQEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSI 217
           + A +V   +  ++ +C   ++   S  LE ++GE++S K+IWKP     L + + ++ +
Sbjct: 121 AGAEDVESSEDGHVIFCADTDLNEVSNALEAELGESESTKLIWKPTTTTEL-DLEGMQKL 179

Query: 218 IKMIENLEDDDDVQSVYSNLEIADDII 244
           +K+++ LEDDDDVQ V +N E +D+++
Sbjct: 180 MKLVDALEDDDDVQRVTTNFEASDEVM 206


>gi|138896161|ref|YP_001126614.1| hypothetical protein GTNG_2524 [Geobacillus thermodenitrificans
           NG80-2]
 gi|196250115|ref|ZP_03148809.1| protein of unknown function DUF28 [Geobacillus sp. G11MC16]
 gi|166228394|sp|A4IRB5|Y2524_GEOTN RecName: Full=UPF0082 protein GTNG_2524
 gi|134267674|gb|ABO67869.1| Conserved hypothetical protein [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210299|gb|EDY05064.1| protein of unknown function DUF28 [Geobacillus sp. G11MC16]
          Length = 247

 Score =  199 bits (507), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 157/242 (64%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKNGGGDPAANPSLRLVIEKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  NY  IRYEGYGP GVA+++  LTDN+NRTA+++RS F+K 
Sbjct: 61  MPGENIERAIKKATGNQEHTNYEEIRYEGYGPGGVAVMVVCLTDNKNRTAANVRSAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  FE+ G ++      N+ +  L + +AIE+ A E+   D+ +  Y   
Sbjct: 121 GGNLGETGCVSYLFERKGLLVIDREQHNMEEDELLL-LAIEAGAEEMETTDESFEIYTTP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +     ++LE++     S ++   P  Y  LS  D++K ++K+I+ LEDDDDVQ VY N
Sbjct: 180 ESFETVKEQLEQQGLTFASAEITMIPQTYTTLS-GDELKKMLKLIDTLEDDDDVQEVYHN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|120437646|ref|YP_863332.1| hypothetical protein GFO_3323 [Gramella forsetii KT0803]
 gi|117579796|emb|CAL68265.1| protein containing DUF28 [Gramella forsetii KT0803]
          Length = 252

 Score =  199 bits (506), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 152/247 (61%), Gaps = 4/247 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLE-NPRLRLAIQNAKNQ 59
           MAGHS++ NI HRK  +D  ++K F++  +EITV+ K  G +  E NP LR AIQNAK  
Sbjct: 1   MAGHSKWANIKHRKGAQDKKRAKQFTRAIKEITVAVKEGGSDDSETNPSLRNAIQNAKGV 60

Query: 60  SMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +MPK+ IERAIKKA   D  NY  + +EGYGP G+AI +E  TDN NRT +SIRSIF+K 
Sbjct: 61  NMPKDTIERAIKKASGADADNYETVTFEGYGPNGIAIFVECTTDNTNRTVASIRSIFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           NGSLG+ GS    F++ G  +    NI  D        IE  A +   ED     Y  F 
Sbjct: 121 NGSLGTNGSLEFLFDKKGVFVLEKENIEMDLEELELELIEGGASKFEKEDDYLTIYTAFT 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + GL S KLE+   E+++ +V   PLN + L   D  K I+ ++E  EDDDDVQ+VY NL
Sbjct: 181 DFGLMSSKLEDLEIESKNSEVQRIPLNTVELPVEDAQK-ILDLVEKFEDDDDVQNVYHNL 239

Query: 238 EIADDII 244
           EI D++I
Sbjct: 240 EITDELI 246


>gi|15596161|ref|NP_249655.1| hypothetical protein PA0964 [Pseudomonas aeruginosa PAO1]
 gi|107100421|ref|ZP_01364339.1| hypothetical protein PaerPA_01001446 [Pseudomonas aeruginosa PACS2]
 gi|116048889|ref|YP_792310.1| hypothetical protein PA14_51810 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218893065|ref|YP_002441934.1| hypothetical protein PLES_43501 [Pseudomonas aeruginosa LESB58]
 gi|254239312|ref|ZP_04932635.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254245247|ref|ZP_04938569.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296390677|ref|ZP_06880152.1| hypothetical protein PaerPAb_21088 [Pseudomonas aeruginosa PAb1]
 gi|313105851|ref|ZP_07792114.1| hypothetical protein PA39016_000110148 [Pseudomonas aeruginosa
           39016]
 gi|12230973|sp|Q51423|Y964_PSEAE RecName: Full=UPF0082 protein PA0964
 gi|122257996|sp|Q02IC6|Y5181_PSEAB RecName: Full=UPF0082 protein PA14_51810
 gi|226706171|sp|B7UXW8|Y4350_PSEA8 RecName: Full=UPF0082 protein PLES_43501
 gi|9946871|gb|AAG04353.1|AE004530_6 pqsR-mediated PQS regulator, PmpR [Pseudomonas aeruginosa PAO1]
 gi|115584110|gb|ABJ10125.1| conserved hypothetical protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126171243|gb|EAZ56754.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126198625|gb|EAZ62688.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218773293|emb|CAW29105.1| conserved hypothetical protein [Pseudomonas aeruginosa LESB58]
 gi|310878616|gb|EFQ37210.1| hypothetical protein PA39016_000110148 [Pseudomonas aeruginosa
           39016]
          Length = 248

 Score =  198 bits (504), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 109/251 (43%), Positives = 158/251 (62%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+KL RE+TV+A+  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKLIRELTVAARQGGGVPADNPRLRLAVDKALTAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI +  GS+D  N   + YEGY P GVAII+EA+TDNRNRTA+ +R  F+K 
Sbjct: 61  MTRDTIDRAIARGVGSNDADNMVELSYEGYAPSGVAIIVEAMTDNRNRTAAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE----YIFYCD 175
            G+LG+ GS    FE+ G+I +   + +  L M+ A+E+ A +V+  D      +  + D
Sbjct: 121 GGNLGTDGSVAYMFERKGQISFAPGVDEEAL-MDAALEAGADDVVVNDDGSIDVFTTFAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F +V   L +   +   G+   + +I      + L  A KV   +K+I+ LED DDVQ+V
Sbjct: 180 FISVNEALAAAGFK---GDEAEVTMIPSTTATLDLETAQKV---LKLIDMLEDLDDVQNV 233

Query: 234 YSNLEIADDII 244
           YSN +I DD++
Sbjct: 234 YSNADIPDDVM 244


>gi|189424310|ref|YP_001951487.1| hypothetical protein Glov_1245 [Geobacter lovleyi SZ]
 gi|226696294|sp|B3E787|Y1245_GEOLS RecName: Full=UPF0082 protein Glov_1245
 gi|189420569|gb|ACD94967.1| protein of unknown function DUF28 [Geobacter lovleyi SZ]
          Length = 247

 Score =  198 bits (503), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 106/243 (43%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + KIF+K+ +EI+V+AKL G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKIFTKIIKEISVAAKLGGGDPAANPRLRTAIDKAKGEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK  G  +   Y  I YEGYGP GVA+++E +TDNRNRT S +RSIFTK 
Sbjct: 61  MPKDNIERAIKKGTGGMEGVVYEEIVYEGYGPGGVAVLVEVMTDNRNRTVSEVRSIFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G  G     F++ G I Y +++ D +   E A+E+ A +V+ ED++   Y + ++ 
Sbjct: 121 NGNMGEAGCVAWMFDKKGVISYDTSL-DFDQLFEAALEAGAEDVVEEDEQIEVYTEPSSF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE K  + QS ++   P   + L    + +S++KM++ LED DDVQ+VY+N +I
Sbjct: 180 IEVRDALEAKGFKFQSAEITMIPQTQVAL-EGKQAESMLKMMDRLEDCDDVQNVYANFDI 238

Query: 240 ADD 242
           + D
Sbjct: 239 SAD 241


>gi|254423344|ref|ZP_05037062.1| conserved hypothetical protein TIGR01033 [Synechococcus sp. PCC
           7335]
 gi|196190833|gb|EDX85797.1| conserved hypothetical protein TIGR01033 [Synechococcus sp. PCC
           7335]
          Length = 257

 Score =  197 bits (502), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 108/253 (42%), Positives = 159/253 (62%), Gaps = 11/253 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA+K K+F+KLSREI V+A+L G +P  N +LR AI  AK  S
Sbjct: 1   MAGHSKWANIKRQKARVDAVKGKVFAKLSREIIVAARLGGGDPDGNFQLRTAIDKAKAAS 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
            PKENI+RAI K    SD    + +IRYEGYGP GVA++IEALTDNRNR A+ +R+ F K
Sbjct: 61  FPKENIDRAIAKGCGNSDGADAFESIRYEGYGPGGVAVLIEALTDNRNRAAADLRTAFGK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNL---AMEVAIESDAFEVLFEDQE----YI 171
             G+LG TG     F+Q G +     + +  L   A+EV  +S  +E++ E +E      
Sbjct: 121 NGGNLGETGCVGWMFDQKGVVTLVGEVDEEALIEDALEVGAQS--YEMVGEVEEEQKGVE 178

Query: 172 FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
             C+  ++   S  L++K    Q++++ W P N +++   D   S+IKM++ LED DDVQ
Sbjct: 179 VLCEVADLEAVSSALQKKNYSVQAVEMRWIPSNTVQIEEPDIALSLIKMMDALEDSDDVQ 238

Query: 232 SVYSNLEIADDII 244
           SV +N ++++ ++
Sbjct: 239 SVTANFDMSEAVM 251


>gi|71736092|ref|YP_275915.1| hypothetical protein PSPPH_3775 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|257487012|ref|ZP_05641053.1| hypothetical protein PsyrptA_27305 [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|119391982|sp|Q48FC2|Y3775_PSE14 RecName: Full=UPF0082 protein PSPPH_3775
 gi|71556645|gb|AAZ35856.1| conserved hypothetical protein TIGR01033 [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|320323054|gb|EFW79143.1| hypothetical protein PsgB076_18867 [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320329674|gb|EFW85663.1| hypothetical protein PsgRace4_12793 [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330877981|gb|EGH12130.1| hypothetical protein Pgy4_11912 [Pseudomonas syringae pv. glycinea
           str. race 4]
 gi|330988967|gb|EGH87070.1| hypothetical protein PLA107_28358 [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 248

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 106/248 (42%), Positives = 158/248 (63%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G+I + + + D +  +E A+E+DA +V+  D   I  +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGV-DEDALIEAAMEADADDVVTNDDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKASDAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI DD++
Sbjct: 237 AEIPDDVM 244


>gi|289626494|ref|ZP_06459448.1| hypothetical protein PsyrpaN_15357 [Pseudomonas syringae pv.
           aesculi str. NCPPB3681]
 gi|289650940|ref|ZP_06482283.1| hypothetical protein Psyrpa2_24852 [Pseudomonas syringae pv.
           aesculi str. 2250]
 gi|330868610|gb|EGH03319.1| hypothetical protein PSYAE_15427 [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 248

 Score =  197 bits (502), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 106/248 (42%), Positives = 159/248 (64%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  D   I  +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNDDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKASDAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI DD++
Sbjct: 237 AEIPDDVM 244


>gi|325295278|ref|YP_004281792.1| yeeN [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325065726|gb|ADY73733.1| UPF0082 protein yeeN [Desulfurobacterium thermolithotrophum DSM
           11699]
          Length = 247

 Score =  197 bits (501), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 156/245 (63%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KI++KL+REITV+A+  G +P  NPRLR AI+ A+  +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIYTKLAREITVAAREGGGDPETNPRLRAAIERARKFN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIK+   +  G  Y  + YEGYGP GVAII++ LTDNRNRTA+ +R  F+K 
Sbjct: 61  MPKENIERAIKRGTGEIAGEAYEEVTYEGYGPGGVAIIVKCLTDNRNRTAAEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++G  +  FE+ G I   +   D +  M   IE+ A +V+ E+  ++ Y    ++
Sbjct: 121 GGNLGTSGCVSWMFERKGIITIPAENYDEDTVMMAVIEAGADDVVKEESYFVVYTQAQDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               K + +   E +  K+   P N  R+     +K ++K++E LED DDVQ VYSN ++
Sbjct: 181 EDVRKAILDAGLEIEESKLDLIPQNTTRVEGETALK-VLKLLEALEDLDDVQEVYSNFDM 239

Query: 240 ADDII 244
            ++++
Sbjct: 240 PEEVM 244


>gi|56380971|dbj|BAD76879.1| hypothetical conserved protein [Geobacillus kaustophilus HTA426]
          Length = 252

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 153/242 (63%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRL I+ AK  +
Sbjct: 7   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKSGGGDPASNPSLRLVIEKAKAAN 66

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  NY  IRYEGYGP GVA+++  LTDN+NRTA+++R+ F K 
Sbjct: 67  MPSENIERAIKKATGTQEHTNYEEIRYEGYGPGGVAVMVVCLTDNKNRTAANVRAAFAKN 126

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  FE+ G ++      N+ +  L + +AIE+ A E+   D+ +  Y   
Sbjct: 127 GGNLGETGCVSYLFERKGLLVIDREQHNVDEDELLL-LAIEAGAEEMETTDESFEIYTAP 185

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +      +LE++     S ++   P  Y  L   D +K ++K+I+ LEDDDDVQ VY N
Sbjct: 186 ESFETVKDELEQQGFTFASAEITMIPQTYTTLE-GDDLKKMLKLIDTLEDDDDVQEVYHN 244

Query: 237 LE 238
           L+
Sbjct: 245 LD 246


>gi|257458165|ref|ZP_05623319.1| conserved hypothetical protein [Treponema vincentii ATCC 35580]
 gi|257444459|gb|EEV19548.1| conserved hypothetical protein [Treponema vincentii ATCC 35580]
          Length = 247

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 160/245 (65%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H K   DA + ++F+K  +EI+++A++ G +P  NPRLR AI  A+  +
Sbjct: 1   MSGHSKWATIKHAKGAADAKRGQMFTKFIKEISIAARMGGGDPNGNPRLRTAILKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NIERAIKK G+ +LG  +Y  + YEGY P GVA+++E LTDN+NR A+++R++F+K
Sbjct: 61  MPKDNIERAIKK-GTGELGGASYEELLYEGYAPGGVAVLVEVLTDNKNRAAANVRNLFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+LG+TGS +  F + G I Y + +      ME A+E+ A ++  E        D N+
Sbjct: 120 NGGNLGATGSVSYMFNRKGVIEYDAEVVSEEKLMEEALEAGAEDIQTEGGIITITTDPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L+EK  E+ S +V   P  Y+ L  A+ ++ ++KM+E LE+DDDVQ+VY+NL+
Sbjct: 180 FASVLEALQEKGFESVSAEVSMVPATYMSLE-AETIRKVLKMVERLEEDDDVQNVYTNLD 238

Query: 239 IADDI 243
           I DD 
Sbjct: 239 IPDDF 243


>gi|161551793|ref|YP_148447.2| hypothetical protein GK2594 [Geobacillus kaustophilus HTA426]
 gi|67462017|sp|Q5KWQ7|Y2594_GEOKA RecName: Full=UPF0082 protein GK2594
          Length = 246

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 153/242 (63%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKSGGGDPASNPSLRLVIEKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  NY  IRYEGYGP GVA+++  LTDN+NRTA+++R+ F K 
Sbjct: 61  MPSENIERAIKKATGTQEHTNYEEIRYEGYGPGGVAVMVVCLTDNKNRTAANVRAAFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  FE+ G ++      N+ +  L + +AIE+ A E+   D+ +  Y   
Sbjct: 121 GGNLGETGCVSYLFERKGLLVIDREQHNVDEDELLL-LAIEAGAEEMETTDESFEIYTAP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +      +LE++     S ++   P  Y  L   D +K ++K+I+ LEDDDDVQ VY N
Sbjct: 180 ESFETVKDELEQQGFTFASAEITMIPQTYTTLE-GDDLKKMLKLIDTLEDDDDVQEVYHN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|297529243|ref|YP_003670518.1| hypothetical protein GC56T3_0898 [Geobacillus sp. C56-T3]
 gi|297252495|gb|ADI25941.1| protein of unknown function DUF28 [Geobacillus sp. C56-T3]
          Length = 246

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 154/242 (63%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKSGGGDPASNPSLRLVIEKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  NY  IRYEGYGP GVA+++  LTDN+NRTA+++R+ F+K 
Sbjct: 61  MPSENIERAIKKATGTQEHTNYEEIRYEGYGPGGVAVMVVCLTDNKNRTAANVRAAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  FE+ G ++      N+ +  L + +AIE+ A E+   D+ +  Y   
Sbjct: 121 GGNLGETGCVSYLFERKGLLVIDREQHNVDEDELLL-LAIEAGAEEMETTDESFEIYTAP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +      +LE++     S ++   P  Y  L   D +K ++K+I+ LEDDDDVQ VY N
Sbjct: 180 ESFETVKDELEQQGFTFASAEITMIPQTYTTLE-GDDLKKMLKLIDTLEDDDDVQEVYYN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|261418391|ref|YP_003252073.1| hypothetical protein GYMC61_0924 [Geobacillus sp. Y412MC61]
 gi|319767650|ref|YP_004133151.1| hypothetical protein GYMC52_2629 [Geobacillus sp. Y412MC52]
 gi|261374848|gb|ACX77591.1| protein of unknown function DUF28 [Geobacillus sp. Y412MC61]
 gi|317112516|gb|ADU95008.1| protein of unknown function DUF28 [Geobacillus sp. Y412MC52]
          Length = 246

 Score =  197 bits (500), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 107/242 (44%), Positives = 154/242 (63%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKSGGGDPASNPSLRLVIEKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  NY  IRYEGYGP GVA+++  LTDN+NRTA+++R+ F+K 
Sbjct: 61  MPSENIERAIKKATGTQEHTNYEEIRYEGYGPGGVAVMVVCLTDNKNRTAANVRAAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  FE+ G ++      N+ +  L + +AIE+ A E+   D+ +  Y   
Sbjct: 121 GGNLGETGCVSYLFERKGLLVIDREQHNVDEDELLL-LAIEAGAEEMETTDESFEIYTAP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +      +LE++     S ++   P  Y  L   D +K ++K+I+ LEDDDDVQ VY N
Sbjct: 180 ESFETVKDELEQQGFTFASAEMTMIPQTYTTLE-GDDLKKMLKLIDTLEDDDDVQEVYHN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|302187159|ref|ZP_07263832.1| hypothetical protein Psyrps6_12440 [Pseudomonas syringae pv.
           syringae 642]
          Length = 248

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 158/246 (64%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +A   +++  P     L + D  + ++K+I+ LED DDVQ+VYSN E
Sbjct: 180 FYAVRNALEAAGFKAADAEIVMLPTTSAVL-DLDTAEKVLKLIDMLEDLDDVQNVYSNAE 238

Query: 239 IADDII 244
           I D+++
Sbjct: 239 IPDEVM 244


>gi|332295724|ref|YP_004437647.1| UPF0082 protein yeeN [Thermodesulfobium narugense DSM 14796]
 gi|332178827|gb|AEE14516.1| UPF0082 protein yeeN [Thermodesulfobium narugense DSM 14796]
          Length = 253

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/248 (40%), Positives = 158/248 (63%), Gaps = 6/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K ++DA++ +IF+KL+RE+TV+A+  G NP  NPRLR+AI+ AK+ +
Sbjct: 1   MSGHSKWANIKHKKSKEDAIRGRIFTKLARELTVAARTGGGNPEANPRLRIAIEKAKSVN 60

Query: 61  MPKENIERAIKKAGSD--DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NI+RAI+K   +  D  NY  + YEGYGP G+A++++  TDN+NRTA  IR IF+K
Sbjct: 61  MPSDNIKRAIQKGTGELNDGTNYEELMYEGYGPFGIAVLMQVTTDNKNRTAPEIRKIFSK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAF--EVLFEDQEYIFYCDF 176
             GS+   G+    F + GEII      +    ME+A+E D F  +V  ++ E     + 
Sbjct: 121 YGGSMAEAGAVAWMFSRKGEIIIDGE--NEEKIMELALEEDLFVDDVEQDEGETKITTEP 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            N+     KL+E      S +++  P  Y++++N    K ++  +E LED DD+Q+VYSN
Sbjct: 179 ENLYQVQSKLKEHNFNIISCELVMVPSTYVQINNVSDAKKVLSFLEQLEDHDDIQNVYSN 238

Query: 237 LEIADDII 244
            +I D+I+
Sbjct: 239 FDIPDEIM 246


>gi|1183839|dbj|BAA11816.1| unknown [Pseudomonas aeruginosa]
          Length = 248

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 158/251 (62%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HR+ER+DA K KIF+KL RE+TV+A+  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHREERQDAKKGKIFTKLIRELTVAARQGGGVPADNPRLRLAVDKALTAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI +  GS+D  N   + YEGY P GVAII+EA+TDNRNRTA+ +R  F+K 
Sbjct: 61  MTRDTIDRAIARGVGSNDADNMVELSYEGYAPSGVAIIVEAMTDNRNRTAAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE----YIFYCD 175
            G+LG+ GS    FE+ G+I +   + +  L M+ A+E+ A +V+  D      +  + D
Sbjct: 121 GGNLGTDGSVAYMFERKGQISFAPGVDEEAL-MDAALEAGADDVVVNDDGSIDVFTTFAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F +V   L +   +   G+   + +I      + L  A KV   +K+I+ LED DDVQ+V
Sbjct: 180 FISVNEALAAAGFK---GDEAEVTMIPSTTATLDLETAQKV---LKLIDMLEDLDDVQNV 233

Query: 234 YSNLEIADDII 244
           YSN +I DD++
Sbjct: 234 YSNADIPDDVM 244


>gi|313673194|ref|YP_004051305.1| hypothetical protein Calni_1234 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312939950|gb|ADR19142.1| protein of unknown function DUF28 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 242

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 155/244 (63%), Gaps = 5/244 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQ--NPLENPRLRLAIQNAKN 58
           MAGHS++ NI HRK  +DA K KIF+K+++E+TV+AKL GQ  +P  NPRLRLA+  AK 
Sbjct: 1   MAGHSKWANIKHRKAAQDAKKGKIFTKIAKELTVAAKL-GQSGDPEFNPRLRLALDKAKA 59

Query: 59  QSMPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
            +MPK+N+ERAIKK  G  D  NY ++ YEGYGP GVAI+I+ALTDN+NRT + +RS  T
Sbjct: 60  ANMPKDNVERAIKKGLGEGDGSNYEDVIYEGYGPGGVAILIQALTDNKNRTVAEVRSTLT 119

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           K  GS+G  G  +  F++ G I    +  D +  M +AI+S A +V+  D  Y    D  
Sbjct: 120 KRGGSMGEAGCVSWMFDKKGVINIPKDAVDEDTLMMIAIDSGAEDVVTNDDGYEVITDPA 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           N     K +E    + +  ++  +P N I LS  +  K+ + ++E LED DDVQ VYSN 
Sbjct: 180 NYETVKKAIESSNIKIEYAEITMRPKNTIELSGEEAEKT-MALLEALEDLDDVQEVYSNF 238

Query: 238 EIAD 241
           ++ +
Sbjct: 239 DMVE 242


>gi|313497565|gb|ADR58931.1| Hypothetical protein, conserved [Pseudomonas putida BIRD-1]
          Length = 248

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 163/246 (66%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + K+F+K  RE+TV+AK  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGGPDPASNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+++  N   + YEGYGP GVAI++EA+TDNRNRTA+++R  FTK 
Sbjct: 61  MSRDIIDRAVARGAGTNESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ-EYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + +  L ME A+E+DA +V+  D   +  +  FN+
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGVEEDAL-MEAAMEADADDVVANDDGSFDVFTSFNS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEE   +A   +++ +P     L + D  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEEAGFKAADAEIVMQPTTSAEL-DQDGAEKVLKLIDMLEDLDDVQNVYSNAQ 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|222055419|ref|YP_002537781.1| protein of unknown function DUF28 [Geobacter sp. FRC-32]
 gi|254801298|sp|B9LZC7|Y2326_GEOSF RecName: Full=UPF0082 protein Geob_2326
 gi|221564708|gb|ACM20680.1| protein of unknown function DUF28 [Geobacter sp. FRC-32]
          Length = 247

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 157/243 (64%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + KIF+KL +EITV+AKL G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKIFTKLIKEITVAAKLGGGDPDGNPRLRTAIDKAKGEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK  G  D   Y    YEGYGP G A+++E +TDNRNRT S +RSIFTK 
Sbjct: 61  MPKDNIERAIKKGTGGMDGVVYEETTYEGYGPGGAAVLVEVMTDNRNRTVSDVRSIFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G  G  +  F++ G I++  ++ D +   E AIE+ A +V  ED++     D +N 
Sbjct: 121 NGNMGEAGCVSWMFDKKGLIVFPKSV-DFDKLFEAAIEAGAEDVSDEDEQIEVTTDPSNF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE+   +  S +V   P   ++L    + ++++K+++ +ED+DDVQ+VYSN +I
Sbjct: 180 MEVRDALEKAGFKPDSAEVTMIPQTMVKLE-GKQAENMLKLMDRMEDNDDVQNVYSNFDI 238

Query: 240 ADD 242
           +++
Sbjct: 239 SEE 241


>gi|167035197|ref|YP_001670428.1| hypothetical protein PputGB1_4204 [Pseudomonas putida GB-1]
 gi|166861685|gb|ABZ00093.1| protein of unknown function DUF28 [Pseudomonas putida GB-1]
          Length = 248

 Score =  196 bits (498), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 163/246 (66%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + K+F+K  RE+TV+AK  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGGPDPASNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+++  N   + YEGYGP GVAI++EA+TDNRNRTA+++R  FTK 
Sbjct: 61  MSRDIIDRAVARGAGTNESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ-EYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + +  L ME A+E+DA +V+  D   +  +  FN+
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGVEEDAL-MEAAMEADADDVVANDDGSFEVFTSFNS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEE   +A   +++ +P     L + D  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEEAGFKAADAEIVMQPTTSAEL-DQDGAEKVLKLIDMLEDLDDVQNVYSNAQ 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|26987949|ref|NP_743374.1| hypothetical protein PP_1214 [Pseudomonas putida KT2440]
 gi|148546486|ref|YP_001266588.1| hypothetical protein Pput_1243 [Pseudomonas putida F1]
 gi|33517008|sp|Q88NJ3|Y1214_PSEPK RecName: Full=UPF0082 protein PP_1214
 gi|24982661|gb|AAN66838.1|AE016312_9 conserved hypothetical protein TIGR01033 [Pseudomonas putida
           KT2440]
 gi|148510544|gb|ABQ77404.1| protein of unknown function DUF28 [Pseudomonas putida F1]
          Length = 248

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 163/246 (66%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + K+F+K  RE+TV+AK  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKVFTKWIRELTVAAKQGGPDPASNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+++  N   + YEGYGP GVAI++EA+TDNRNRTA+++R  FTK 
Sbjct: 61  MSRDIIDRAVARGAGTNESDNVEELSYEGYGPGGVAIMVEAMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ-EYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + +  L ME A+E+DA +V+  D   +  +  FN+
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGVEEDAL-MEAAMEADADDVVANDDGSFDVFTSFNS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEE   +A   +++ +P     L + D  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEEAGFKAADAEIVMQPTTSAEL-DQDGAEKVLKLIDMLEDLDDVQNVYSNAQ 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|30248234|ref|NP_840304.1| hypothetical protein NE0210 [Nitrosomonas europaea ATCC 19718]
 gi|33516990|sp|Q82XP6|Y210_NITEU RecName: Full=UPF0082 protein NE0210
 gi|30180119|emb|CAD84121.1| Domain of unknown function DUF28 [Nitrosomonas europaea ATCC 19718]
          Length = 241

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 155/238 (65%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K  +DA + KIF++L +EITV+A+L G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGGGDPNSNPRLRLAMDKAFGHN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIK+   +  G NY  IRYEGYG  G A++++ +TDNR RT +++R  FTK 
Sbjct: 61  MPKDNVERAIKRGCGELEGVNYEEIRYEGYGISGAAVMVDCMTDNRTRTVAAVRHAFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    F+  G++++   +G++ L +E A+E+ A +V+  D   +      + 
Sbjct: 121 GGNLGTDGSVAYLFKHCGQLLFAPGVGEAQL-LEAALEAGAEDVISNDDGSLEVITGPDT 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++ +   EK G +A+  +V WKP N + L   D VK + K+++ LED DDVQ VY++
Sbjct: 180 FVSVRDTLEKAGFKAELAEVTWKPENEVLLQGDDAVK-MQKLLDALEDIDDVQDVYTS 236


>gi|330892238|gb|EGH24899.1| hypothetical protein PSYMO_26974 [Pseudomonas syringae pv. mori
           str. 301020]
          Length = 248

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 156/248 (62%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G  D  +   + YEGYGP GVAI++E +TDNRNRT +++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGGSDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTPAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G+I + + + D +  +E A+E+DA +V+  D   I  +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGV-DEDALIEAAMEADADDVVTNDDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKASDAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI DD++
Sbjct: 237 AEIPDDVM 244


>gi|298488211|ref|ZP_07006247.1| Concerved hypothetical protein yebC [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
 gi|298157269|gb|EFH98353.1| Concerved hypothetical protein yebC [Pseudomonas savastanoi pv.
           savastanoi NCPPB 3335]
          Length = 248

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 158/248 (63%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  F K 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFAKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  D   I  +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNDDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKASDAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI DD++
Sbjct: 237 AEIPDDVM 244


>gi|237800216|ref|ZP_04588677.1| hypothetical protein POR16_15404 [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331023073|gb|EGI03130.1| hypothetical protein POR16_15404 [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 248

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 158/248 (63%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + D +  +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGV-DEDALIEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEASGFKADDAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|253699569|ref|YP_003020758.1| hypothetical protein GM21_0933 [Geobacter sp. M21]
 gi|259710172|sp|C6E1T1|Y933_GEOSM RecName: Full=UPF0082 protein GM21_0933
 gi|251774419|gb|ACT17000.1| protein of unknown function DUF28 [Geobacter sp. M21]
          Length = 247

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 159/243 (65%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + KIF+K+ +EITV+AKL G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKIFTKIIKEITVAAKLGGGDPDGNPRLRTAIDKAKGEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIKK  G  +   Y    YEGYGP G A+++E +TDNRNRT S +RSIFTK 
Sbjct: 61  MPKDNVERAIKKGVGGLEGTTYEETTYEGYGPGGTAVLVEVMTDNRNRTVSDVRSIFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G +G  +  F++ G +++  +I D +   E +IE+ A +V  ED++Y    D +  
Sbjct: 121 NGNMGESGCVSWLFDKKGLLVFPKSI-DFDKLFEASIEAGADDVTDEDEQYEVLTDPSAF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE    +A+S ++   P   ++L   +  ++++K+++ +ED+DDVQ+VY+N +I
Sbjct: 180 HQVKTALEGAGFKAESAEITMIPQTMVKLEGKN-AENMLKLMDRMEDNDDVQNVYANFDI 238

Query: 240 ADD 242
           +++
Sbjct: 239 SEE 241


>gi|269122135|ref|YP_003310312.1| hypothetical protein Sterm_3547 [Sebaldella termitidis ATCC 33386]
 gi|268616013|gb|ACZ10381.1| protein of unknown function DUF28 [Sebaldella termitidis ATCC
           33386]
          Length = 250

 Score =  195 bits (496), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 164/245 (66%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA ++K+F+++ +E+T++AKL G +   NPRLRLA+  AK  +
Sbjct: 1   MAGHSKWANIKHRKGRQDAQRAKVFTRIGKELTIAAKLGGGDIGFNPRLRLAVDKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIKK   +  G +Y  IRYEGYGP GVA +++ +TDN+NR+AS++R  F++ 
Sbjct: 61  MPKDNMERAIKKGTGELEGVDYQEIRYEGYGPGGVAFLVDVVTDNKNRSASTVRMNFSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG TGS +  F++ G   +  +  D ++ ME A+++ A +V+ + + ++   D N+ 
Sbjct: 121 DGNLGETGSVSFLFDRKGIFEFKKDGIDEDVLMETALDAGAEDVVEKSEAWLVITDTNDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               +  +      +  +V   P   I +++ +  K ++K+ ++LE+++DVQ +YSN +I
Sbjct: 181 DTVKEAFDTNKLIYEEGEVTMHPATEIEITDLETAKKLMKLYDDLEENEDVQEIYSNFDI 240

Query: 240 ADDII 244
           AD+I+
Sbjct: 241 ADEIM 245


>gi|320537069|ref|ZP_08037047.1| conserved hypothetical protein TIGR01033 [Treponema phagedenis
           F0421]
 gi|320146072|gb|EFW37710.1| conserved hypothetical protein TIGR01033 [Treponema phagedenis
           F0421]
          Length = 247

 Score =  195 bits (496), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 158/244 (64%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H K   DA + ++F+K  +EI+++A++ G +P  NPRLR AI  A+  +
Sbjct: 1   MSGHSKWATIKHAKGAADAKRGQMFTKFIKEISIAARMGGGDPAANPRLRTAILKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NIERAIKK G+ +LG  NY  + YEGY P GVAI++E LTDN+NR A+++R++F+K
Sbjct: 61  MPKDNIERAIKK-GTGELGGSNYEELIYEGYAPGGVAILVEVLTDNKNRAAANVRNLFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+LGSTGS    F + G I Y + +      M+ A+E+ A ++  E        D N+
Sbjct: 120 NGGNLGSTGSVAYMFNRKGVIEYDAEVASEEAVMDAALEAGAEDIQNEGGIITVTTDPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L+ K  E+ S ++   P  Y+ L +A+  + ++KMI+ +E+DDDVQ+VYSN++
Sbjct: 180 FETVLEALQTKGLESVSAEISMVPDTYMSL-DAETTRKVLKMIDRIEEDDDVQNVYSNID 238

Query: 239 IADD 242
           + DD
Sbjct: 239 VPDD 242


>gi|213969183|ref|ZP_03397322.1| hypothetical protein PSPTOT1_3331 [Pseudomonas syringae pv. tomato
           T1]
 gi|301384822|ref|ZP_07233240.1| hypothetical protein PsyrptM_19399 [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063524|ref|ZP_07255065.1| hypothetical protein PsyrptK_26373 [Pseudomonas syringae pv. tomato
           K40]
 gi|302130612|ref|ZP_07256602.1| hypothetical protein PsyrptN_04412 [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213926181|gb|EEB59737.1| hypothetical protein PSPTOT1_3331 [Pseudomonas syringae pv. tomato
           T1]
 gi|330872655|gb|EGH06804.1| hypothetical protein PSYMP_00684 [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
 gi|330964822|gb|EGH65082.1| hypothetical protein PSYAC_09232 [Pseudomonas syringae pv.
           actinidiae str. M302091]
 gi|331016437|gb|EGH96493.1| hypothetical protein PLA106_10459 [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 248

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 159/248 (64%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVA+++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAVMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  D   I  +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNDDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|66044655|ref|YP_234496.1| hypothetical protein Psyr_1407 [Pseudomonas syringae pv. syringae
           B728a]
 gi|75502955|sp|Q4ZWL4|Y1407_PSEU2 RecName: Full=UPF0082 protein Psyr_1407
 gi|63255362|gb|AAY36458.1| Protein of unknown function DUF28 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330936723|gb|EGH40908.1| hypothetical protein PSYPI_00070 [Pseudomonas syringae pv. pisi
           str. 1704B]
 gi|330968893|gb|EGH68959.1| hypothetical protein PSYAR_00165 [Pseudomonas syringae pv. aceris
           str. M302273PT]
 gi|330975330|gb|EGH75396.1| hypothetical protein PSYAP_01503 [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 248

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 159/248 (64%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|330950611|gb|EGH50871.1| hypothetical protein PSYCIT7_04243 [Pseudomonas syringae Cit 7]
          Length = 248

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 159/248 (64%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEATGFKAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|295131887|ref|YP_003582563.1| hypothetical protein ZPR_0003 [Zunongwangia profunda SM-A87]
 gi|294979902|gb|ADF50367.1| conserved hypothetical protein [Zunongwangia profunda SM-A87]
          Length = 252

 Score =  195 bits (495), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 111/247 (44%), Positives = 150/247 (60%), Gaps = 4/247 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSG-QNPLENPRLRLAIQNAKNQ 59
           MAGHS++ NI HRK  +D  ++K F++  +EI+V+ K  G  +P  NP LR AI NAK  
Sbjct: 1   MAGHSKWANIKHRKGAQDKKRAKQFTRAIKEISVAVKEGGGADPEANPSLRNAISNAKGV 60

Query: 60  SMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +MPK+ I+RAIKKA   D  NY  + +EGYGP G+AI +E  TDN NRT +S+RSIFTK 
Sbjct: 61  NMPKDTIDRAIKKASGADADNYETVTFEGYGPNGIAIFVECTTDNTNRTVASVRSIFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            GSLG+ GS    F++ G  +        +        IE  A ++  ED     Y DFN
Sbjct: 121 GGSLGTNGSLEFLFDKKGVFVLEKEKIEMNLEEFELELIEGGATKIEKEDDLMTIYTDFN 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G+ S KLEE   E +S +V   PLN + L   D  K I+ ++E  EDDDDVQ+VY NL
Sbjct: 181 DFGMMSSKLEELNIETKSSEVQRIPLNTLELPVED-AKKILNLVEKFEDDDDVQNVYHNL 239

Query: 238 EIADDII 244
           +I D++I
Sbjct: 240 DITDELI 246


>gi|144898111|emb|CAM74975.1| protein containing DUF28 [Magnetospirillum gryphiswaldense MSR-1]
          Length = 249

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 112/245 (45%), Positives = 161/245 (65%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQFKNIMHRK  +DA ++K+F+KL RE+TVSAK    +P  NPRLR AIQ A+  +
Sbjct: 1   MAGHSQFKNIMHRKGAQDAKRAKVFTKLIRELTVSAKSGQPDPAMNPRLRAAIQAARAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ ++RAIK+ AG +D  NY  +RYEGYGP  VAII+E LTDNRNRTAS +RS F+K 
Sbjct: 61  MPKDTMDRAIKRGAGGEDGANYEEVRYEGYGPGSVAIIVEGLTDNRNRTASEVRSAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG + S +  F++IG I Y +    +    E A+E+ A  V   +  +   C  +++
Sbjct: 121 GGALGESNSVSFMFDRIGAIRYATEAAGAEAMFEAALEAGADNVESSEDGHEITCSPDDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE   G  +  ++ WKP   + +++ +  K+++K+++ LED+DDVQ V +N EI
Sbjct: 181 ATVRDALEATFGTPEYARLDWKPQTSVPVADENVAKTLLKLLDTLEDNDDVQRVSANFEI 240

Query: 240 ADDII 244
            DDI+
Sbjct: 241 PDDIM 245


>gi|146306301|ref|YP_001186766.1| hypothetical protein Pmen_1269 [Pseudomonas mendocina ymp]
 gi|145574502|gb|ABP84034.1| protein of unknown function DUF28 [Pseudomonas mendocina ymp]
          Length = 249

 Score =  194 bits (494), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 154/246 (62%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KIF+KL RE+TV+AK  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKGRQDAKRGKIFTKLIRELTVAAKHGGPVPADNPRLRLAVDKALTNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M +E I+RAI + AG+++  N     YEGY P GVAII+E +TDNRNRTA+ +R  FTK 
Sbjct: 61  MSREVIDRAIARGAGNNEADNVVEFSYEGYAPSGVAIIVEVMTDNRNRTAAEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + D +  ME A+E+ A +V + ED   +    F  
Sbjct: 121 GGNLGTDGSVAYMFERKGQISFAPGV-DEDALMEAALEAGADDVEMGEDGSALVSTSFTE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               ++ L     +A+  ++   P     +++ +  + + K+I+ LED DDVQ+VY N E
Sbjct: 180 FHAVNEALGAAGFKAEEAEIAMIPSISAPIADLETAQKVFKLIDMLEDLDDVQNVYHNAE 239

Query: 239 IADDII 244
           +AD+I+
Sbjct: 240 VADEIM 245


>gi|330896126|gb|EGH28347.1| hypothetical protein PSYJA_04844 [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 248

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 159/248 (64%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVA+++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAVMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|289674668|ref|ZP_06495558.1| hypothetical protein PsyrpsF_15489 [Pseudomonas syringae pv.
           syringae FF5]
          Length = 248

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 159/248 (64%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVAI++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDDDDVEELGYEGYGPGGVAIMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFKAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|114776336|ref|ZP_01451381.1| hypothetical protein SPV1_01412 [Mariprofundus ferrooxydans PV-1]
 gi|114553166|gb|EAU55564.1| hypothetical protein SPV1_01412 [Mariprofundus ferrooxydans PV-1]
          Length = 251

 Score =  194 bits (494), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 153/245 (62%), Gaps = 6/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ +I H+K   DA + KIF++  REIT++A+L G +P  NPRLR AI  AK  +
Sbjct: 1   MSGHNKWSSIKHKKAAVDAKRGKIFTRYIREITIAARLGGDDPDANPRLRAAITAAKGVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP++NIERAI + AG DD  N   +RYEGYG  GVAI+++ +TDNRNRT + +RS F K 
Sbjct: 61  MPRDNIERAISRGAGGDDGENIEEVRYEGYGQGGVAILVDCMTDNRNRTVADVRSAFNKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE---YIFYCDF 176
            G++G  G  +  F Q G+ ++ S   D    MEVA+ + A ++  ED +    I  C+ 
Sbjct: 121 GGNMGEAGCVSWMFHQKGQFVFASGTVDEEQLMEVALGAGADDIE-EDSDAGCMIVSCEP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
              G   + L++   EAQ  ++ W P N I +   +  + ++ +IE LED DDVQ+VY+N
Sbjct: 180 TAFGTLHQALDDVGLEAQVSEISWVPENSISVE-GEAAEKVLALIERLEDLDDVQNVYAN 238

Query: 237 LEIAD 241
            +I+D
Sbjct: 239 YDISD 243


>gi|172035810|ref|YP_001802311.1| hypothetical protein cce_0894 [Cyanothece sp. ATCC 51142]
 gi|254807261|sp|B1WS51|Y894_CYAA5 RecName: Full=UPF0082 protein cce_0894
 gi|171697264|gb|ACB50245.1| DUF28-containing protein [Cyanothece sp. ATCC 51142]
          Length = 256

 Score =  194 bits (494), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 115/251 (45%), Positives = 159/251 (63%), Gaps = 8/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +KER DA K K F++LSR I V+AK    +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKERVDAKKGKTFAQLSRAIIVAAKHGIPDPAGNFQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+  +D   Y  IRYEGYG  GVAI+IEA TDNRNRTA+ +RS F 
Sbjct: 61  IPNDNIERAIAKGAGTYENDDTVYEEIRYEGYGVGGVAILIEAFTDNRNRTAADLRSAFN 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI--ESDAFEVLFE--DQEYIFY 173
           K  G+LG TG  +  FEQ G +    NI D N  +E ++  E+D++E+  E  DQ    +
Sbjct: 121 KNGGNLGETGCVSWMFEQKGVVRIEGNI-DENALLEASMEGEADSYELYEEDDDQAAEVF 179

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            +  N+   S+ L +K      +++ W P N I + N ++ KSIIK+IE LE  DDVQ+V
Sbjct: 180 TEMTNLDTLSQTLNDKNFNVTEVELRWIPNNLIYIENDEQAKSIIKLIEALESLDDVQNV 239

Query: 234 YSNLEIADDII 244
            +N E+AD+++
Sbjct: 240 TTNFEMADELM 250


>gi|114799876|ref|YP_758895.1| hypothetical protein HNE_0161 [Hyphomonas neptunium ATCC 15444]
 gi|123028463|sp|Q0C5U8|Y161_HYPNA RecName: Full=UPF0082 protein HNE_0161
 gi|114740050|gb|ABI78175.1| conserved hypothetical protein TIGR01033 [Hyphomonas neptunium ATCC
           15444]
          Length = 252

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 111/245 (45%), Positives = 160/245 (65%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++D  ++ +F++LS+EITV++K+ G +P  NPRLRLAI NAK  S
Sbjct: 1   MAGHSKWANIQHRKGKQDKKRAVLFARLSKEITVASKMGGPDPAMNPRLRLAITNAKGVS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +PK+NI+RAI K  S    +Y +IRYEG GP GV II+EA TDN+NR A+ IR+ F+K  
Sbjct: 61  VPKDNIQRAIDKGQSSGGADYADIRYEGVGPGGVGIIVEASTDNKNRAATDIRTAFSKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+TGS +  F+Q+GEI Y  + G ++  ME AI + A +V   +  +  Y    +  
Sbjct: 121 GTLGTTGSVSFNFDQLGEIEYPVSAGSADEVMEAAIMAGAQDVESNEDGHWIYTAREDFA 180

Query: 181 LTSKKLEEKIG---EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
             S  L +  G   E  S K+IWKP     ++  D    ++KM++ L++ DDVQSVY N 
Sbjct: 181 AVSTALADTFGSKVEPTSAKIIWKPKVTTPIA-GDAADQLMKMLDVLDELDDVQSVYDNS 239

Query: 238 EIADD 242
           EI++D
Sbjct: 240 EISED 244


>gi|28871125|ref|NP_793744.1| hypothetical protein PSPTO_3980 [Pseudomonas syringae pv. tomato
           str. DC3000]
 gi|33517005|sp|Q87Y32|Y3980_PSESM RecName: Full=UPF0082 protein PSPTO_3980
 gi|28854375|gb|AAO57439.1| conserved protein of unknown function [Pseudomonas syringae pv.
           tomato str. DC3000]
          Length = 248

 Score =  194 bits (493), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 158/248 (63%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVA+++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAVMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G+I + + + + +L +E A+E+DA +V+  D   I  +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGVDEDSL-IEAAMEADADDVVTNDDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE     A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFMAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|197119678|ref|YP_002140105.1| hypothetical protein Gbem_3313 [Geobacter bemidjiensis Bem]
 gi|226703778|sp|B5EAH0|Y3313_GEOBB RecName: Full=UPF0082 protein Gbem_3313
 gi|197089038|gb|ACH40309.1| protein of unknown function DUF28 [Geobacter bemidjiensis Bem]
          Length = 247

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + K+F+K+ +EITV+AKL G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKVFTKIIKEITVAAKLGGGDPDGNPRLRTAIDKAKGEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIKK  G  +   Y    YEGYGP G A+++E +TDNRNRT S +RSIFTK 
Sbjct: 61  MPKDNVERAIKKGVGGLEGTTYEETTYEGYGPGGTAVLVEVMTDNRNRTVSDVRSIFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G +G  +  F++ G +++  +I D +   E +IE+ A +V  ED++Y    D    
Sbjct: 121 NGNMGESGCVSWLFDKKGLLVFPKSI-DFDKLFEASIEAGADDVTDEDEQYEVLTDPAAF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE    +A+S ++   P   ++L   +  ++++K+++ +ED+DDVQ+VY+N +I
Sbjct: 180 HQVKTALEGAGFKAESAEITMIPQTMVKLEGKN-AENMLKLMDRMEDNDDVQNVYANFDI 238

Query: 240 ADD 242
           +++
Sbjct: 239 SEE 241


>gi|330959263|gb|EGH59523.1| hypothetical protein PMA4326_11977 [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 248

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 157/248 (63%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ +  G+ D  +   + YEGYGP GVA+++E +TDNRNRTA+++R  FTK 
Sbjct: 61  MTRDTIDRAVARGVGASDGDDVEELGYEGYGPGGVAVMVETMTDNRNRTAAAVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I + + + D +  +E A+E+DA +V+  ED     +  F+ 
Sbjct: 121 GGNLGTDGSVAYLFDRKGQISFAAGV-DEDALIEAAMEADADDVVTNEDGSIDVFTSFSG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLN--YIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE     A   +++  P     + L  A+KV   +K+I+ LED DDVQ+VYSN
Sbjct: 180 FYAVRNALEAAGFNAADAEIVMLPTTSAVLDLETAEKV---LKLIDMLEDLDDVQNVYSN 236

Query: 237 LEIADDII 244
            EI D+++
Sbjct: 237 AEIPDEVM 244


>gi|51473643|ref|YP_067400.1| hypothetical protein RT0442 [Rickettsia typhi str. Wilmington]
 gi|60390802|sp|Q68WS4|Y442_RICTY RecName: Full=UPF0082 protein RT0442
 gi|51459955|gb|AAU03918.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 252

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 152/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN-PLENPRLRLAIQNAKNQ 59
           M+GHS+FKNI HRK  +D  KSK+F+KL REI  + K    N P  NPRLR A+  A++Q
Sbjct: 1   MSGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNVPENNPRLRKALNAARSQ 60

Query: 60  SMPKENIERAIKKAG-SDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           ++PKE I++AI  A  + +  +YT IRYEGY P G+AIIIEALTDN+NRTAS +RS FTK
Sbjct: 61  NLPKERIDKAINSANDASNTESYTEIRYEGYAPNGIAIIIEALTDNKNRTASEVRSSFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G LG TGS    F   G I Y  NI  +    E AIE+   +++  D  +  Y D  N
Sbjct: 121 YGGILGETGSVNYLFNHCGVIQYPINIASNEDIFEAAIEAGGNDIISNDFAHTIYTDIEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  L +K G  +   + W P+N I + + +K K ++K+IE LE++DDVQ V+ N  
Sbjct: 181 FYKALGFLTDKYGIPEDSYIGWIPVNTIIIDDKEKAKKLLKLIEVLEENDDVQRVFGNYM 240

Query: 239 IADDI 243
           +++D+
Sbjct: 241 LSEDV 245


>gi|330814400|ref|YP_004358639.1| hypothetical protein SAR11G3_01425 [Candidatus Pelagibacter sp.
           IMCC9063]
 gi|327487495|gb|AEA81900.1| hypothetical protein SAR11G3_01425 [Candidatus Pelagibacter sp.
           IMCC9063]
          Length = 249

 Score =  193 bits (491), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 158/248 (63%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + D  +SK+FSKLSREITV+AKL   +   NPRLR A+Q A+  +
Sbjct: 1   MAGHSHWAGIKHKKGKADKQRSKLFSKLSREITVAAKLGLPDIEFNPRLRSAVQAAREAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI RAIKK+ G  +  NY   +YEG+GP GVA I+EALTDN+NRT +++R +F K 
Sbjct: 61  MPKDNILRAIKKSQGPSEDSNYEKSQYEGFGPGGVAFIVEALTDNKNRTFTNLRLLFEKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
           N SLG  GS +  FE++G I     +   +     AIE+ A + +  ++ +  YC    F
Sbjct: 121 NASLGVEGSVSYQFEEVGHIKIKKELITEDEIFSHAIEAGAEDCISGEEHHEIYCKKEKF 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           N V ++   +E KI E     +IWKP N + + N +  + II  I+ LEDD+DVQ+VY+N
Sbjct: 181 NEVRVS---IETKIKELSFSGIIWKPKNTVSI-NKEVFEKIINFIDLLEDDEDVQNVYTN 236

Query: 237 LEIADDII 244
            +I ++I+
Sbjct: 237 FDIDENIL 244


>gi|220932072|ref|YP_002508980.1| conserved hypothetical protein TIGR01033 [Halothermothrix orenii H
           168]
 gi|259645757|sp|B8CXG6|Y1235_HALOH RecName: Full=UPF0082 protein Hore_12350
 gi|219993382|gb|ACL69985.1| conserved hypothetical protein TIGR01033 [Halothermothrix orenii H
           168]
          Length = 253

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 158/248 (63%), Gaps = 5/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++D  + K+FSKLS+ ITV+A+  G +P  NP LRLAIQ AK+ +
Sbjct: 1   MAGHSKWANIKHKKAKEDRKRGKLFSKLSKMITVAAREGGGDPEMNPDLRLAIQKAKDNN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERAIK+   +  G  Y    YEGYGP GVA+ +E ++DNRNRTA+ IR + +K 
Sbjct: 61  MPNDNIERAIKRGTGELEGVKYEKFVYEGYGPGGVALYLELMSDNRNRTAAEIRHVLSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG +G  +  F++ G++I     S+  +  L +E A+E+ A +V+ ED     Y D 
Sbjct: 121 GGNLGESGCVSWMFKRRGQLIVDLNESDFDEDELMLE-ALEAGAEDVVTEDNLLTIYTDP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           ++     K+LEE+  +  S  +   P N + + +    K ++K+++ LED DDVQ VYSN
Sbjct: 180 SDFEEVRKQLEEQGIKFSSADIAMVPENNVNVDDKSTAKKVLKLMDALEDHDDVQEVYSN 239

Query: 237 LEIADDII 244
            +I D+I+
Sbjct: 240 FDIPDEIM 247


>gi|95931131|ref|ZP_01313856.1| protein of unknown function DUF28 [Desulfuromonas acetoxidans DSM
           684]
 gi|95132821|gb|EAT14495.1| protein of unknown function DUF28 [Desulfuromonas acetoxidans DSM
           684]
          Length = 248

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 109/245 (44%), Positives = 153/245 (62%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL +EITV+AK+ G +   NPRLR A+  AK  +
Sbjct: 1   MAGHSKWANIKHRKGAQDAKRGKIFTKLIKEITVAAKIGGGDLEANPRLRTAVDKAKGGN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ IERAIKK   D D  +Y     EGYGP GVA+++E +TDNR RT + +R  FTK 
Sbjct: 61  MPKDTIERAIKKGTGDLDGVSYEEGTMEGYGPGGVAVMVEIMTDNRTRTVADVRHCFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NGSLG  GS    F++ G +I  SN  D +   E+A+E+ A +V  E + Y    + N  
Sbjct: 121 NGSLGVDGSVAFLFDRKG-LIAISNEADFDTIFEIALENGAEDVKDEGESYEVITEPNEF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L E+  E +S +V   P N + L    K + ++K+++ LED+DDVQ+VY+N +I
Sbjct: 180 TAVRDALAEQGIEFESAEVTMIPQNTVELEGK-KAEQMLKLMDMLEDNDDVQNVYTNADI 238

Query: 240 ADDII 244
            DD+I
Sbjct: 239 DDDVI 243


>gi|225630084|ref|YP_002726875.1| hypothetical protein WRi_002620 [Wolbachia sp. wRi]
 gi|254765053|sp|C0R5P2|Y2620_WOLWR RecName: Full=UPF0082 protein WRi_002620
 gi|225592065|gb|ACN95084.1| hypothetical protein WRi_002620 [Wolbachia sp. wRi]
          Length = 246

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 150/246 (60%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +S+ F+KL REITV+AK    +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPELNPRLRSAIFAARKEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AIK A  +  G NY  I+YEG+GP G A+I+ ALT+NRNRTAS +R IF++ 
Sbjct: 61  LPKDKIETAIKNATGNVAGENYEEIQYEGHGPSGTALIVHALTNNRNRTASEVRYIFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
            G+LG TGS +  F+ +G I+Y +   + +      IE +   V   D+E  ++  C+  
Sbjct: 121 GGNLGETGSVSYLFDHVGLIVYKAEGVNFDDLFSHGIELEVLNVEENDKEGLHVITCEIK 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G        K GE +  ++ W+P + I +S+ + +  +  ++E LED+DDVQ V  N 
Sbjct: 181 DFGKVRDAFYAKFGEPELARLSWQPKDLIEISDKELIDKLSALVEELEDNDDVQYVEGNF 240

Query: 238 EIADDI 243
              D +
Sbjct: 241 TFVDKL 246


>gi|58699373|ref|ZP_00374140.1| conserved hypothetical protein TIGR01033 [Wolbachia endosymbiont of
           Drosophila ananassae]
 gi|58534114|gb|EAL58346.1| conserved hypothetical protein TIGR01033 [Wolbachia endosymbiont of
           Drosophila ananassae]
          Length = 248

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 150/246 (60%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +S+ F+KL REITV+AK    +P  NPRLR AI  A+ ++
Sbjct: 3   MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPELNPRLRSAIFAARKEN 62

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AIK A  +  G NY  I+YEG+GP G A+I+ ALT+NRNRTAS +R IF++ 
Sbjct: 63  LPKDKIETAIKNATGNVAGENYEEIQYEGHGPSGTALIVHALTNNRNRTASEVRYIFSRK 122

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
            G+LG TGS +  F+ +G I+Y +   + +      IE +   V   D+E  ++  C+  
Sbjct: 123 GGNLGETGSVSYLFDHVGLIVYKAEGVNFDDLFSHGIELEVLNVEENDKEGLHVITCEIK 182

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G        K GE +  ++ W+P + I +S+ + +  +  ++E LED+DDVQ V  N 
Sbjct: 183 DFGKVRDAFYAKFGEPELARLSWQPKDLIEISDKELIDKLSALVEELEDNDDVQYVEGNF 242

Query: 238 EIADDI 243
              D +
Sbjct: 243 TFVDKL 248


>gi|78221963|ref|YP_383710.1| hypothetical protein Gmet_0743 [Geobacter metallireducens GS-15]
 gi|119369548|sp|Q39XN9|Y743_GEOMG RecName: Full=UPF0082 protein Gmet_0743
 gi|78193218|gb|ABB30985.1| protein of unknown function DUF28 [Geobacter metallireducens GS-15]
          Length = 247

 Score =  192 bits (489), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 157/241 (65%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + K+F+K+ +EITV+AKL G +P  NPRLR A+  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKVFTKIIKEITVAAKLGGGDPNGNPRLRSAVDKAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK   +  G NY  I YEGYGP GVA+++E +TDNRNRT   +RS FTK 
Sbjct: 61  MPKDNIERAIKKGTGELEGVNYEEIVYEGYGPGGVAVLVECMTDNRNRTVGDVRSTFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G TG  +  F++ G I+  S   D     EVA+E+ A +V  E+++Y    D ++ 
Sbjct: 121 NGNMGETGCVSWMFDKKGLIVV-SKDADFEKLFEVALEAGAEDVADEEEQYEVLTDPSSF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + LE+     +S ++   P   ++L +    ++++K+++ LED+DDVQ+VY+N +I
Sbjct: 180 MEVREALEKAGFAHESAEITMIPQTMVKL-DGKNAENMLKLMDRLEDNDDVQNVYANFDI 238

Query: 240 A 240
           +
Sbjct: 239 S 239


>gi|307266574|ref|ZP_07548106.1| protein of unknown function DUF28 [Thermoanaerobacter wiegelii
           Rt8.B1]
 gi|306918428|gb|EFN48670.1| protein of unknown function DUF28 [Thermoanaerobacter wiegelii
           Rt8.B1]
          Length = 246

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 163/249 (65%), Gaps = 13/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE+ DA K +IF+KL+++I  +AK  G +P  N +LR AI+ AK  +
Sbjct: 1   MSGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPNTNSKLRDAIEKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIKK G+ +LG  N   + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 61  LPNENIQRAIKK-GTGELGGANLEEVIYEGYGPSGTAIIVEALTDNKNRTAGEIRHIFDR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             GSLG+ GS T  F+++G II   N  I +  LAM VAI++ A +   ED+E+    + 
Sbjct: 120 HGGSLGAAGSVTWMFDKVGIIIVEKNDSIDEDELAM-VAIDAGAQDFSAEDEEFEIITEP 178

Query: 177 NNVGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +N     + +E+   KI EA+   V   P N I+LS  D  K   K+I+ LE++DDVQ+V
Sbjct: 179 SNFQEVKEAIEKAGYKISEAE---VTMLPKNTIQLSPEDYEK-FEKLIDKLEENDDVQNV 234

Query: 234 YSNLEIADD 242
           Y N+EI D+
Sbjct: 235 YHNVEIEDE 243


>gi|322420880|ref|YP_004200103.1| hypothetical protein GM18_3392 [Geobacter sp. M18]
 gi|320127267|gb|ADW14827.1| protein of unknown function DUF28 [Geobacter sp. M18]
          Length = 247

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + K+F+KL +EITV+AKL G +   NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKVFTKLIKEITVAAKLGGGDADGNPRLRTAIDKAKAEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIKK  G  +  NY    YEGYGP G A+++E +TDNRNRT S +RSIF+K 
Sbjct: 61  MPKDNVERAIKKGVGGLEGVNYEETTYEGYGPGGTAVLVEVMTDNRNRTVSEVRSIFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G TG  +  F++ G +++  +  D +   E +IE+ A +V  ED++Y    D    
Sbjct: 121 NGNMGETGCVSWLFDKKGLLVFPKST-DFDKLFEASIEAGADDVTNEDEQYEVLTDPTAF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LEE   +A++ ++   P   ++L   +  ++++K+++ +ED+DDVQ+VY+N +I
Sbjct: 180 HQVKTALEEAGFKAENAEITMIPQTMVKLEGKN-AENMLKLMDRMEDNDDVQNVYANFDI 238

Query: 240 ADD 242
           +++
Sbjct: 239 SEE 241


>gi|188996624|ref|YP_001930875.1| protein of unknown function DUF28 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|226708017|sp|B2V8P8|Y685_SULSY RecName: Full=UPF0082 protein SYO3AOP1_0685
 gi|188931691|gb|ACD66321.1| protein of unknown function DUF28 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 251

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 102/249 (40%), Positives = 161/249 (64%), Gaps = 8/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI ++K + DA+K ++F+K+ +EIT++A+L G +P  NPRLR+AI+ AK  +
Sbjct: 1   MAGHSRWHNIKNKKAKADAIKGRMFTKVIKEITIAARLGGGDPEANPRLRIAIEKAKEVN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP EN+ERAIK+   +  G NY  ++YEGYGP GVAI++EA TDNRNRT + IR IF+K 
Sbjct: 61  MPMENVERAIKRGTGELEGVNYEEVQYEGYGPGGVAIVVEATTDNRNRTTAEIRHIFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEY----IFYCD 175
            G+LGS+G  +  FE  G I    +    +   E AIE+ A +V+ +D EY        +
Sbjct: 121 GGNLGSSGCVSFSFEDKGIINVPKDKYSEDEIFEKAIEAGAEDVIMDDPEYYEIRTAPSE 180

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
              V    +K+  +I +A+  K+   P   +++++ +    ++K+++ LED+DDVQ VY+
Sbjct: 181 LYKVRENLEKMGVEIAKAELTKI---PTTTVQITDEETATKLMKLLDALEDNDDVQKVYA 237

Query: 236 NLEIADDII 244
           N +I + I+
Sbjct: 238 NFDIPESIL 246


>gi|77460631|ref|YP_350138.1| hypothetical protein Pfl01_4410 [Pseudomonas fluorescens Pf0-1]
 gi|119392002|sp|Q3K7V7|Y4410_PSEPF RecName: Full=UPF0082 protein Pfl01_4410
 gi|77384634|gb|ABA76147.1| conserved hypothetical protein [Pseudomonas fluorescens Pf0-1]
          Length = 248

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+ +  N   + YEGYGP GVA+++E +TDNRNRTA+++R  F+K 
Sbjct: 61  MSRDIIDRAVARGAGATEADNVEELTYEGYGPGGVAVMVECMTDNRNRTAAAVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + D +   E A+E+DA +V+  ED     +  F +
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGV-DEDALTEAALEADADDVVSHEDGSIDVFTSFTS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +    +++ +P     L + +  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEAAGFKGDDAEIVMQPTTSAEL-DLEGAEKVLKLIDMLEDLDDVQNVYSNAD 238

Query: 239 IADDI 243
           I +D+
Sbjct: 239 IPEDV 243


>gi|167746569|ref|ZP_02418696.1| hypothetical protein ANACAC_01279 [Anaerostipes caccae DSM 14662]
 gi|167653529|gb|EDR97658.1| hypothetical protein ANACAC_01279 [Anaerostipes caccae DSM 14662]
          Length = 242

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 153/242 (63%), Gaps = 5/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+KL REI V+ K  G +P  N RLR  +  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAKKGKIFTKLGREIAVAVKEGGADPENNSRLRDIVAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+R+IKKA  D +  NY +I YEGYGP GVAII+EALTDN+NRTAS++RS FTK 
Sbjct: 61  MPNDTIDRSIKKAAGDANAVNYESITYEGYGPSGVAIIVEALTDNKNRTASNVRSAFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           +GS+G+ G  +  FE+ G+II       + + +L M  A+++ A +   E+  Y    D 
Sbjct: 121 SGSIGTPGCVSYNFEKKGQIIIAKEDCQMDEDDLMM-TALDAGAEDFAAEEDSYEIVTDP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           ++     + LE +  E  S +V   P   + L++ D +K++ K ++ LE+DDDVQ V+ N
Sbjct: 180 DDFSKVREALEAESIEMASAEVTMIPNTMVELASEDDIKNLQKTLDLLEEDDDVQDVWHN 239

Query: 237 LE 238
            +
Sbjct: 240 WD 241


>gi|326390108|ref|ZP_08211669.1| protein of unknown function DUF28 [Thermoanaerobacter ethanolicus
           JW 200]
 gi|325993756|gb|EGD52187.1| protein of unknown function DUF28 [Thermoanaerobacter ethanolicus
           JW 200]
          Length = 246

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 116/249 (46%), Positives = 163/249 (65%), Gaps = 13/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE+ DA K +IF+KL+++I  +AK  G +P  N +LR AI+ AK  +
Sbjct: 1   MSGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPNTNSKLRDAIEKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIKK G+ +LG  N   + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 61  LPNENIQRAIKK-GTGELGGANLEEVIYEGYGPAGTAIIVEALTDNKNRTAGEIRHIFDR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             GSLG+ GS T  F+++G II   N  I +  LAM VAI++ A +   ED+E+    + 
Sbjct: 120 HGGSLGAAGSVTWMFDKVGIIIVEKNDSIDEDELAM-VAIDAGAQDFSAEDEEFEIITEP 178

Query: 177 NNVGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +N     + +E+   KI EA+   V   P N I+LS  D  K   K+I+ LE++DDVQ+V
Sbjct: 179 SNFQEVKEAIEKAGYKISEAE---VTMLPKNTIQLSPEDYEK-FEKLIDKLEENDDVQNV 234

Query: 234 YSNLEIADD 242
           Y N+EI D+
Sbjct: 235 YHNVEIEDE 243


>gi|53804482|ref|YP_113684.1| hypothetical protein MCA1220 [Methylococcus capsulatus str. Bath]
 gi|67462035|sp|Q609L3|Y1220_METCA RecName: Full=UPF0082 protein MCA1220
 gi|53758243|gb|AAU92534.1| conserved hypothetical protein TIGR01033 [Methylococcus capsulatus
           str. Bath]
          Length = 248

 Score =  192 bits (487), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 156/246 (63%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+KL REITV+++  G +P  NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIQHRKGAQDAKRGKLFTKLIREITVASRTGGPDPGNNPRLRTAIDKALVAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERAIKK +G+ D  NY  +RYEGYGP G+A++++ LTDNRNRT + +R  F+KA
Sbjct: 61  MSKDTIERAIKKGSGAADGDNYEEVRYEGYGPGGIAVLVDCLTDNRNRTVAEVRHAFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F + G + + +++G+  + ME A+++ A +V+  ED         + 
Sbjct: 121 GGNLGTDGSVAYLFSKTGVVSFSADLGEDRV-MEPALDAGADDVVVNEDGSVDVLTAPDQ 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE      +S +V  +    ++L   D  K +I+++E LED DDVQ+VYSN +
Sbjct: 180 FEAVRDALEAAGLTPESAEVTMRASTSVKLDKEDAEK-MIRLLERLEDLDDVQNVYSNAD 238

Query: 239 IADDII 244
           I++DI+
Sbjct: 239 ISEDIL 244


>gi|163785080|ref|ZP_02179796.1| hypothetical protein HG1285_07991 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879653|gb|EDP73441.1| hypothetical protein HG1285_07991 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 250

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 161/250 (64%), Gaps = 10/250 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K + DA + +IF+KL REIT++A+  G +P  NPRLR+AI+ AK  +
Sbjct: 1   MAGHSKWHNIRHKKAKMDAKRGQIFTKLIREITIAARQGGGDPEFNPRLRIAIEKAKEHN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIK+   +  G NY  I YEGYGPEGVA+I+E +TDNRNRT   IR +F+K 
Sbjct: 61  MPAENIERAIKRGTGELEGVNYEEITYEGYGPEGVAVIVECVTDNRNRTTGEIRHLFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY-HSNIGDSNLAMEVAIESDAFEVLFEDQEY----IFYC 174
            G+LGS+G  +  FE  G I+    NI +  +  E AIE+ A +V+ +D+ Y        
Sbjct: 121 GGNLGSSGCVSFLFEDKGVILVPKENISEEEI-FEKAIEAGAEDVITDDENYYEIRTAPE 179

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           D  +V    +K    I +A+  K+   P   + + +++  + ++K+++ LE+ DDVQ VY
Sbjct: 180 DLYSVKEALEKEGVSIEKAELTKI---PTTTVEIKDSETAEKLMKLLDALEEQDDVQKVY 236

Query: 235 SNLEIADDII 244
           SN +++++++
Sbjct: 237 SNFDMSNELM 246


>gi|330502217|ref|YP_004379086.1| hypothetical protein MDS_1303 [Pseudomonas mendocina NK-01]
 gi|328916503|gb|AEB57334.1| hypothetical protein MDS_1303 [Pseudomonas mendocina NK-01]
          Length = 249

 Score =  192 bits (487), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 153/246 (62%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KIF+KL RE+TV+AK  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKGRQDAKRGKIFTKLIRELTVAAKHGGPIPADNPRLRLAVDKALTNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M +E I+RAI + AG+++  N     YEGY P GVAII+E +TDNRNRTA+ +R  FTK 
Sbjct: 61  MSREVIDRAIARGAGNNEADNVVEFSYEGYAPSGVAIIVEVMTDNRNRTAAEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F++ G+I +   + D +  ME A+E+ A +V + ED   +    F  
Sbjct: 121 GGNLGTDGSVAYMFDRKGQISFAPGV-DEDALMEAALEAGADDVEMGEDGSALVSTSFTE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               ++ L     + +  ++   P     +++ +  + + K+I+ LED DDVQ+VY N E
Sbjct: 180 FHAVNEALSAAGFKGEEAEIAMIPSISAPITDLETAQKVFKLIDMLEDLDDVQNVYHNAE 239

Query: 239 IADDII 244
           +AD+I+
Sbjct: 240 VADEIM 245


>gi|307718819|ref|YP_003874351.1| hypothetical protein STHERM_c11330 [Spirochaeta thermophila DSM
           6192]
 gi|306532544|gb|ADN02078.1| hypothetical protein STHERM_c11330 [Spirochaeta thermophila DSM
           6192]
          Length = 246

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 107/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K   DA + K+F+KL +EI+V+A+  G +P  NPRLR AI  AK  +
Sbjct: 1   MSGHSKWATIRHKKAAMDAKRGKVFTKLIKEISVAARTGGGDPEANPRLRTAILKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIKK  G  +  +YT I YE YGP GVAIIIEALTDN+NRTAS +R I +K 
Sbjct: 61  MPKENIERAIKKGTGELEGADYTEIVYEAYGPGGVAIIIEALTDNKNRTASEVRHILSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG TG  +  F++ G I + +     +  +E A+E+ A +V  + +      D ++ 
Sbjct: 121 GGSLGETGCVSYLFKKRGLITFDATKYTEDEIIEAALEAGAEDVSSDGEVIEVLTDPSSF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L EK  E ++ ++   P   I + + +  + ++K+IE LED+DDVQSV +NLE+
Sbjct: 181 EEVQQGLTEKGFEYETAEISLIPDARITV-DKETAEKVLKLIEALEDNDDVQSVSTNLEL 239

Query: 240 ADDI 243
            DD+
Sbjct: 240 PDDL 243


>gi|42520352|ref|NP_966267.1| hypothetical protein WD0484 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|49036514|sp|P62043|Y484_WOLPM RecName: Full=UPF0082 protein WD_0484
 gi|42410090|gb|AAS14201.1| conserved hypothetical protein TIGR01033 [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 246

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 149/246 (60%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +S+ F+KL REITV+AK    +P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLPDPELNPRLRSAIFAARKEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AIK A  +  G NY  I+YEG+GP G A+I+  LT+NRNRTAS +R IF++ 
Sbjct: 61  LPKDKIETAIKNATGNVAGENYEEIQYEGHGPSGTALIVHVLTNNRNRTASEVRYIFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
            G+LG TGS +  F+ +G I+Y +   + +      IE +   V   D+E  ++  C+  
Sbjct: 121 GGNLGETGSVSYLFDHVGLIVYKAEGVNFDDLFSHGIELEVLNVEENDKEGLHVITCEIK 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G        K GE +  ++ W+P + I +S+ + +  +  ++E LED+DDVQ V  N 
Sbjct: 181 DFGKVRDAFYAKFGEPELARLSWQPKDLIEISDKELIDKLSALVEELEDNDDVQYVEGNF 240

Query: 238 EIADDI 243
              D +
Sbjct: 241 TFVDAV 246


>gi|67921603|ref|ZP_00515121.1| Protein of unknown function DUF28 [Crocosphaera watsonii WH 8501]
 gi|67856715|gb|EAM51956.1| Protein of unknown function DUF28 [Crocosphaera watsonii WH 8501]
          Length = 256

 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 116/252 (46%), Positives = 158/252 (62%), Gaps = 10/252 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +KER DA K K F++LSR I V+AK    +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKERVDAKKGKTFAQLSRAIIVAAKHGIADPAGNFQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P ENIERAI K AG+  +D   Y  IRYEGYG  GVAI+IEA TDNRNRTA+ +RS FT
Sbjct: 61  IPNENIERAIAKGAGTYENDDTIYEEIRYEGYGVGGVAILIEAFTDNRNRTAADLRSAFT 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI--ESDAFEVLFED---QEYIF 172
           K  G+LG TG     FEQ G +     I D N  +E ++  E+D++E L++D   Q    
Sbjct: 121 KNGGNLGETGCVGWMFEQKGVVRVEGAI-DENALLEASMEGEADSYE-LYDDVGEQGAEI 178

Query: 173 YCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
           + D  N+   S+ L E+       ++ W P N I + + ++ KSIIK+IE LE  DDVQ+
Sbjct: 179 FTDMTNLDRLSQTLNEQHFNVTEAELRWIPNNLIEIEDNEQAKSIIKLIEALESLDDVQN 238

Query: 233 VYSNLEIADDII 244
           V +N E+AD+++
Sbjct: 239 VTANFEMADELM 250


>gi|118581084|ref|YP_902334.1| hypothetical protein Ppro_2673 [Pelobacter propionicus DSM 2379]
 gi|166228423|sp|A1ASF6|Y2673_PELPD RecName: Full=UPF0082 protein Ppro_2673
 gi|118503794|gb|ABL00277.1| protein of unknown function DUF28 [Pelobacter propionicus DSM 2379]
          Length = 247

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 153/243 (62%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + K+F+KL +EI+V+AKL G +P  NPRLR A+  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKVFTKLIKEISVAAKLGGGDPAANPRLRTAVDKAKAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK AG  +   Y  I YEGYGP G A+++E +TDNRNR+ S IRSIFTKA
Sbjct: 61  MPKDNIERAIKKGAGGMEGVTYEEIVYEGYGPGGAAVLVEVMTDNRNRSVSEIRSIFTKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G  G     F + G I +   + D     E AIE+ A +V  ED+++    D ++ 
Sbjct: 121 NGNMGEAGCVAWMFSKKGLITFDKGL-DFEQLFEAAIEAGAEDVSEEDEQFEVTTDPSSF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L  K     + +V   P   + L    + +S++K+++ LED+DDVQ+VYSN +I
Sbjct: 180 IEVREALVAKGFSFANAEVTMIPQTMVAL-EGKQAESMLKLMDKLEDNDDVQNVYSNFDI 238

Query: 240 ADD 242
           + D
Sbjct: 239 SAD 241


>gi|262277496|ref|ZP_06055289.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
 gi|262224599|gb|EEY75058.1| conserved hypothetical protein [alpha proteobacterium HIMB114]
          Length = 247

 Score =  191 bits (484), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 110/244 (45%), Positives = 149/244 (61%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + D  +SK+FSKLSREITVSAKL   +P  NPRLR A+Q AK  +
Sbjct: 1   MAGHSHWAGIKHKKGKADKQRSKLFSKLSREITVSAKLGMPDPSMNPRLRSAVQAAKEAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKK+   D  NY  I YEG+GP G  II+EALTDN+NRT S++RSIF K  
Sbjct: 61  MPKDNIDRAIKKSQGGDEANYEAIVYEGFGPSGTGIIVEALTDNKNRTISNVRSIFEKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
            SLGS GS +  FE  G I    +    +   E +    A +   E   Y  + + N++ 
Sbjct: 121 CSLGSEGSVSYQFEICGLIRIKKDSCAEDEIFEQSTNYGASDFKVEGDFYEIFSEKNDLH 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
               +LE+K  +     +I+ P N I++ + +  + II  I+ LE+DDDVQ VYSN E+ 
Sbjct: 181 TLQIELEKKY-DLSFCGIIYNPKNTIKI-DKEGFEKIINFIDALEEDDDVQKVYSNFEVD 238

Query: 241 DDII 244
             I+
Sbjct: 239 QKIL 242


>gi|218246848|ref|YP_002372219.1| hypothetical protein PCC8801_2028 [Cyanothece sp. PCC 8801]
 gi|257059890|ref|YP_003137778.1| hypothetical protein Cyan8802_2054 [Cyanothece sp. PCC 8802]
 gi|226701132|sp|B7JYY6|Y2028_CYAP8 RecName: Full=UPF0082 protein PCC8801_2028
 gi|218167326|gb|ACK66063.1| protein of unknown function DUF28 [Cyanothece sp. PCC 8801]
 gi|256590056|gb|ACV00943.1| protein of unknown function DUF28 [Cyanothece sp. PCC 8802]
          Length = 255

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 164/251 (65%), Gaps = 8/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +KER DA K K F++LSR I V+A+    +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKERVDAKKGKTFAQLSRAIIVAARHGLPDPTGNFQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P ENIERAI K AG+  +D   Y  IRYEGYGP GVAI+IEALTDNRNRTA+ +R+ F+
Sbjct: 61  IPNENIERAIAKGAGTYENDDTIYEEIRYEGYGPGGVAILIEALTDNRNRTAADLRAAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIE--SDAFEVLFEDQEYI--FY 173
           K  G+LG TG  +  F+Q G I+    + +  L +E ++E  +D++E+  ED+E     +
Sbjct: 121 KRGGNLGETGCVSWMFDQKGVILIEGEVNEDRL-LEASVEGGADSYELFSEDEEIGAEVF 179

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            +  N+   ++ L+EK       ++ W P N + +++ ++ +S++K+I+ LE  DDVQ+V
Sbjct: 180 TEVTNLERLTQTLKEKQFNVTEAELRWIPNNRMDVNDPEQARSLLKLIDALESLDDVQNV 239

Query: 234 YSNLEIADDII 244
            +N EIA++++
Sbjct: 240 TANFEIAEELM 250


>gi|328948462|ref|YP_004365799.1| hypothetical protein Tresu_1602 [Treponema succinifaciens DSM 2489]
 gi|328448786|gb|AEB14502.1| UPF0082 protein yeeN [Treponema succinifaciens DSM 2489]
          Length = 247

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 154/245 (62%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H K   DA +  +F+K  +EI+++AK+ G +P  NPRLR A+  AK  S
Sbjct: 1   MSGHSKWSTIKHAKGIADAKRGALFTKFIKEISIAAKMGGGDPDSNPRLRTAMLKAKAAS 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NIERAIKK G+ +LG  +Y  + YEGY P GVA++++ LTDN+NR A+ +R+IF K
Sbjct: 61  MPKDNIERAIKK-GTGELGAVSYEELVYEGYAPGGVAVLVDVLTDNKNRAAADVRNIFNK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+LG+TGST+R FE+ G I Y +     +  M VA+E+ A +V+ ED       D  +
Sbjct: 120 NGGNLGTTGSTSRMFERKGVIEYDAEKVSEDDVMSVAVEAGAEDVVNEDGVITVTTDPAS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L+ K  E  S  V   P NY  + + +  K + K+++ LE++DDVQ+VYS +E
Sbjct: 180 FDAVLEALQSKEWETLSAAVSMVPFNYTAV-DVETAKKVQKLLDKLEENDDVQNVYSTVE 238

Query: 239 IADDI 243
             +D 
Sbjct: 239 YPEDF 243


>gi|148263484|ref|YP_001230190.1| hypothetical protein Gura_1416 [Geobacter uraniireducens Rf4]
 gi|189038690|sp|A5G9Y5|Y1416_GEOUR RecName: Full=UPF0082 protein Gura_1416
 gi|146396984|gb|ABQ25617.1| protein of unknown function DUF28 [Geobacter uraniireducens Rf4]
          Length = 247

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 158/243 (65%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + KIF+KL +EITV+AKL G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKIFTKLIKEITVAAKLGGGDPEGNPRLRTAIDKAKGEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK  G  D   Y    YEGYGP G A+++E +TDNRNRT S +RSIFTK 
Sbjct: 61  MPKDNIERAIKKGTGGMDGVVYEETTYEGYGPGGAAVLVEVMTDNRNRTVSDVRSIFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G +G  +  F++ G +++  ++ D +   E AIE+ A +V  E+++     D  + 
Sbjct: 121 NGNMGESGCVSWMFDKKGLMVFPKSV-DFDKLFEAAIEAGAEDVSDEEEQIEVTTDPVSF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE+   + +S +V   P   ++L    + ++++K+++ +ED+DDVQ+VY+N +I
Sbjct: 180 MEVRDTLEKAGFKPESAEVTMIPQTMVKLE-GKQAENMLKLMDRMEDNDDVQNVYANFDI 238

Query: 240 ADD 242
           +++
Sbjct: 239 SEE 241


>gi|315187233|gb|EFU20990.1| protein of unknown function DUF28 [Spirochaeta thermophila DSM
           6578]
          Length = 246

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 155/244 (63%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K   DA + K+F+KL +EI+V+A+  G +P  NPRLR AI  AK  +
Sbjct: 1   MSGHSKWATIRHKKAAMDAKRGKVFTKLIKEISVAARTGGGDPEANPRLRTAILKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIKK  G  +  +YT I YE YGP GVAIIIEALTDN+NRTAS +R I +K 
Sbjct: 61  MPKENIERAIKKGTGELEGADYTEIVYEAYGPGGVAIIIEALTDNKNRTASEVRHILSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG TG  +  F++ G I + +     +  +E A+E+ A +V  + +      D ++ 
Sbjct: 121 GGSLGETGCVSYLFKKRGLITFDATKYTEDEIIEAALEAGAEDVSSDGEVIEVLTDPSSF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L EK  E ++ ++   P   I + + +  + ++++IE LED+DDVQSV +NLE+
Sbjct: 181 EEVQQGLTEKGFEYETAEISLIPDARITV-DKETAEKVLRLIEALEDNDDVQSVSTNLEL 239

Query: 240 ADDI 243
            DD+
Sbjct: 240 PDDM 243


>gi|167037422|ref|YP_001665000.1| hypothetical protein Teth39_1009 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167040089|ref|YP_001663074.1| hypothetical protein Teth514_1449 [Thermoanaerobacter sp. X514]
 gi|256752594|ref|ZP_05493448.1| protein of unknown function DUF28 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300914172|ref|ZP_07131488.1| protein of unknown function DUF28 [Thermoanaerobacter sp. X561]
 gi|307724592|ref|YP_003904343.1| hypothetical protein Thet_1453 [Thermoanaerobacter sp. X513]
 gi|320115835|ref|YP_004185994.1| hypothetical protein Thebr_1035 [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|226734048|sp|B0K951|Y1009_THEP3 RecName: Full=UPF0082 protein Teth39_1009
 gi|226734168|sp|B0K0L3|Y1449_THEPX RecName: Full=UPF0082 protein Teth514_1449
 gi|166854329|gb|ABY92738.1| protein of unknown function DUF28 [Thermoanaerobacter sp. X514]
 gi|166856256|gb|ABY94664.1| protein of unknown function DUF28 [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256748532|gb|EEU61582.1| protein of unknown function DUF28 [Thermoanaerobacter ethanolicus
           CCSD1]
 gi|300889107|gb|EFK84253.1| protein of unknown function DUF28 [Thermoanaerobacter sp. X561]
 gi|307581653|gb|ADN55052.1| protein of unknown function DUF28 [Thermoanaerobacter sp. X513]
 gi|319928926|gb|ADV79611.1| protein of unknown function DUF28 [Thermoanaerobacter brockii
           subsp. finnii Ako-1]
          Length = 246

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 163/249 (65%), Gaps = 13/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE+ DA K +IF+KL+++I  +AK  G +P  N +LR AI+ AK  +
Sbjct: 1   MSGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPNTNSKLRDAIEKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIKK G+ +LG  N   + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 61  LPNENIQRAIKK-GTGELGGANLEEVIYEGYGPSGTAIIVEALTDNKNRTAGEIRHIFDR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             GSLG+ GS T  F+++G II   +  I +  LAM VAI++ A +   ED+E+    + 
Sbjct: 120 HGGSLGAAGSVTWMFDKVGIIIVEKDNSIDEDELAM-VAIDAGAQDFSAEDEEFEIITEP 178

Query: 177 NNVGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +N     + +E+   KI EA+   V   P N I+LS  D  K   K+I+ LE++DDVQ+V
Sbjct: 179 SNFQEVKEAIEKAGYKISEAE---VTMLPKNTIQLSPEDYEK-FEKLIDKLEENDDVQNV 234

Query: 234 YSNLEIADD 242
           Y N+EI D+
Sbjct: 235 YHNVEIEDE 243


>gi|327399041|ref|YP_004339910.1| hypothetical protein Hipma_0881 [Hippea maritima DSM 10411]
 gi|327181670|gb|AEA33851.1| UPF0082 protein yeeN [Hippea maritima DSM 10411]
          Length = 252

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 159/256 (62%), Gaps = 22/256 (8%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K ++DA +  IF+KL +EIT++A+L G +P  NPRLR+AI+ AK  +
Sbjct: 1   MSGHNKWSTIKHKKAKEDAKRGAIFTKLIKEITIAARLGGGDPESNPRLRMAIEKAKEAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK   +  G  Y +I YEGYGP GVA+IIEA TDNR RT +S+R +  K 
Sbjct: 61  MPKQNIEKAIKKGTGELPGTTYEDIIYEGYGPGGVAMIIEATTDNRQRTTASVRHLLNKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA-----------FEVLFEDQ 168
            GSLG  G  +  F+ +G + +  +  +     E A+E+ A           FEV+ E +
Sbjct: 121 GGSLGENGCVSWMFDYVGYMTFDKDSTEEEALFEAALEAGASDVRENEEDGVFEVITEPK 180

Query: 169 EYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDD 228
           E++            + LEE   + Q+ ++   P N ++L   +K  S++K++E LE+DD
Sbjct: 181 EFM---------AVKEALEEHGFKPQTAELTRIPQNTVKLE-GEKAISMLKLMEALEEDD 230

Query: 229 DVQSVYSNLEIADDII 244
           DV +VY+N +I+D+++
Sbjct: 231 DVSNVYANFDISDEVM 246


>gi|332977888|gb|EGK14637.1| glucose-1-phosphate adenylyltransferase [Desmospora sp. 8437]
          Length = 275

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 152/243 (62%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI HRK R+DAL+ K+F+KL+REI+V+A+  G +P +N RLRLAI  A++Q+
Sbjct: 27  MAGHSKWKNIQHRKGRQDALRGKLFAKLAREISVAAREGGGDPDQNQRLRLAISKARSQN 86

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERAI +  G++   NY  + YEGYGP G A++ EALTDNRNRTA+ +R IF+K 
Sbjct: 87  MPNDNIERAIHRGTGAEGGSNYEAVTYEGYGPGGAAVMAEALTDNRNRTAADVRHIFSKR 146

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GS+G  G     F++ G +      G D +  M   +E+ A +    +  +      + 
Sbjct: 147 GGSMGEAGCVAWMFDKKGLLRIDREAGQDEDEMMLQVLEAGAEDFEASEDAFEITTSPDQ 206

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE +     + +V   P N + L+  D+V  +++++E LED DD+Q+VY+N+E
Sbjct: 207 FEEVKASLEGEGFHFSTAEVTMVPQNTVTLT-GDQVTQMLQLLEALEDHDDIQNVYANVE 265

Query: 239 IAD 241
           I D
Sbjct: 266 IDD 268


>gi|70732091|ref|YP_261847.1| hypothetical protein PFL_4766 [Pseudomonas fluorescens Pf-5]
 gi|119372135|sp|Q4K7D6|Y4766_PSEF5 RecName: Full=UPF0082 protein PFL_4766
 gi|68346390|gb|AAY93996.1| conserved hypothetical protein TIGR01033 [Pseudomonas fluorescens
           Pf-5]
          Length = 248

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 154/248 (62%), Gaps = 10/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAARQGGGDPNSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK----AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           M ++ I+RAI +    AGSDD+     + YEGYGP GVA+++E +TDNRNRTA+++R  F
Sbjct: 61  MSRDIIDRAIARGTGAAGSDDV---VELTYEGYGPNGVAVMVECMTDNRNRTAAAVRHAF 117

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCD 175
           +K  G+LG+ GS    FE+ G+I +   + D +  ME A+E+DA +V+  ED     +  
Sbjct: 118 SKCGGNLGTDGSVAYLFERKGQITFAEGV-DEDALMEAAMEADADDVVSNEDGSIDVFTS 176

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F         LE     A   +++  P     L + +  + ++K+I+ LED DDVQ+VYS
Sbjct: 177 FAGFYGVRNALEAAGFTAADAEIVMLPTTSAEL-DLEGAEKVLKLIDMLEDLDDVQNVYS 235

Query: 236 NLEIADDI 243
           N +I + +
Sbjct: 236 NADIPESV 243


>gi|88811439|ref|ZP_01126694.1| hypothetical protein NB231_11909 [Nitrococcus mobilis Nb-231]
 gi|88791328|gb|EAR22440.1| hypothetical protein NB231_11909 [Nitrococcus mobilis Nb-231]
          Length = 247

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 153/241 (63%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK+ +DA + KIF+KL REITV+A++ G NP  NPRLRLAI  A + +
Sbjct: 1   MAGHSKWANIQHRKKAQDAKRGKIFTKLIREITVAARVGGPNPDLNPRLRLAIDRALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIK+ AG+D+L +Y   R+EGYGP GVAI+ + +TDNRNRT S +R  F+K 
Sbjct: 61  MPKDNIERAIKRGAGTDELESYEEPRFEGYGPAGVAIMADCMTDNRNRTVSEVRFAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ G     F + G  ++  +  D +  +EVA+E+ A ++   D   +       +
Sbjct: 121 GGNLGTDGCVAYLFRRQGVFVFPPH-SDEDRILEVALEAGAEDIANSDDGSVEVLSSPEH 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + LE         ++  +P   + L  A++ + ++K+IE+LED DDVQ VY+N E
Sbjct: 180 YDAVKQALELADLHPADAEITMRPETTVVLG-AEEGRKVLKIIEHLEDLDDVQHVYTNAE 238

Query: 239 I 239
           I
Sbjct: 239 I 239


>gi|262037457|ref|ZP_06010917.1| conserved hypothetical protein TIGR01033 [Leptotrichia goodfellowii
           F0264]
 gi|261748492|gb|EEY35871.1| conserved hypothetical protein TIGR01033 [Leptotrichia goodfellowii
           F0264]
          Length = 249

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 157/245 (64%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + K F++L +E+ ++A++ G N   NPRLRLAI  AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDKQRGKAFTRLGKELMIAARIGGGNVDFNPRLRLAIDKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ IERAIKK   +  G +Y  IRYEGYGP G+A +++ +TDN+NR+AS++R  F++ 
Sbjct: 61  MPKDTIERAIKKGTGELEGVDYIEIRYEGYGPGGIAFLVDVVTDNKNRSASTVRMNFSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG TGS    F++ G   +     D    ME+A+E+ A +V  ++   +   D N+ 
Sbjct: 121 DGNLGETGSVAFMFDRKGIFEFEKGKVDEEKLMEIALEAGAEDVADKENSLVVITDPNDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + LE++  + +  ++   P N I +++ +    I+K+ ++LED++DVQ +Y+N  I
Sbjct: 181 ETVKETLEKEGLKTEEAEITMYPQNEIDITDTETATKILKLYDDLEDNEDVQEIYANFNI 240

Query: 240 ADDII 244
           +D+++
Sbjct: 241 SDEVL 245


>gi|330811395|ref|YP_004355857.1| hypothetical protein PSEBR_a4443 [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379503|gb|AEA70853.1| Conserved hypothetical protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 248

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 155/245 (63%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA + KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKRGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+ + AG+ +  N   + YEGYGP GVA+++E +TDNRNRTA+++R  F+K 
Sbjct: 61  MSRDIIDRAVARGAGATEADNVEELTYEGYGPGGVAVMVECMTDNRNRTAAAVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +   + D +   E A+E+DA +V+  ED  +  +  F +
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGL-DEDALTEAALEADADDVVSHEDGSFDVFTSFAS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +    +++ +P     L + +  + ++K+I+ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEAAGFKPADAEIVMQPTTSAEL-DLEGAEKVLKLIDMLEDLDDVQNVYSNAD 238

Query: 239 IADDI 243
           I + +
Sbjct: 239 IPESV 243


>gi|239827861|ref|YP_002950485.1| hypothetical protein GWCH70_2524 [Geobacillus sp. WCH70]
 gi|259646866|sp|C5D5F1|Y2524_GEOSW RecName: Full=UPF0082 protein GWCH70_2524
 gi|239808154|gb|ACS25219.1| protein of unknown function DUF28 [Geobacillus sp. WCH70]
          Length = 246

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 153/242 (63%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKTGGGDPASNPALRLVIEKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  NY  +RYEGYGP GVA+++  LTDN+NRTAS++R  F+K 
Sbjct: 61  MPNENIERAIKKATGTQEHTNYEEVRYEGYGPGGVAVMVVCLTDNKNRTASNVRVAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHS---NIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  F++ G ++      +I + ++ ++ AIE+ A E+   +  +  Y   
Sbjct: 121 GGNLGETGCVSYLFDRKGLLVIAREGLDIDEDDMLLQ-AIEAGAEEMETTEDSFEIYTTP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  ++LE+      S ++   P  Y  L+  D +K ++K+I+ LEDDDDVQ VY N
Sbjct: 180 EAFEEVKEQLEKNGFTFASAEITMIPQTYTTLA-GDDLKKMLKLIDTLEDDDDVQEVYHN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|126656798|ref|ZP_01728012.1| hypothetical protein CY0110_24206 [Cyanothece sp. CCY0110]
 gi|126622018|gb|EAZ92726.1| hypothetical protein CY0110_24206 [Cyanothece sp. CCY0110]
          Length = 256

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/251 (44%), Positives = 159/251 (63%), Gaps = 8/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +KER DA K K F++LSR I V+AK    +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKERVDAKKGKTFAQLSRAIIVAAKHGIPDPTGNFQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+  +D   Y  IRYEGYG  GVAI+IEA TDNRNRTA+ +RS F 
Sbjct: 61  IPNDNIERAIAKGAGTYENDDTVYEEIRYEGYGVGGVAILIEAFTDNRNRTAADLRSAFN 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI--ESDAFEVLFE--DQEYIFY 173
           K  G+LG TG  +  FEQ G +    NI D N  +E ++  E+D++E+  E  +Q    +
Sbjct: 121 KNGGNLGETGCVSWMFEQKGVVRIEGNI-DENTLLEASMEGEADSYELYEEGDEQAAEVF 179

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            +  N+ + S+   +K      I++ W P N I + + ++ K+IIK+IE LE  DDVQ+V
Sbjct: 180 TEMTNLDILSQTFNDKNFNVTEIELRWIPNNLIYIEDDEQAKAIIKLIEALESLDDVQNV 239

Query: 234 YSNLEIADDII 244
            +N E+AD+++
Sbjct: 240 TTNFEMADELM 250


>gi|153875113|ref|ZP_02003050.1| protein containing DUF28 [Beggiatoa sp. PS]
 gi|152068422|gb|EDN66949.1| protein containing DUF28 [Beggiatoa sp. PS]
          Length = 248

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 155/249 (62%), Gaps = 10/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+KL REIT+SA++ G     NPRLR AI NA   +
Sbjct: 1   MAGHSKWANIQHRKGAQDAKRGKLFTKLIREITISARMGGGEAASNPRLRAAIDNALVSN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERAIK+ AG+ D  NY  I YEGYGP GVA++++ +TDNRNRT + IR  F+K 
Sbjct: 61  MTKDTIERAIKRGAGTQDAENYEEITYEGYGPGGVAVMVDCMTDNRNRTVAEIRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
            G+LG+ GS    FE++G + + S   D +  ME+A+E+ A +V+  D + I       D
Sbjct: 121 GGNLGTDGSVAYLFEKVGLLSFPSG-SDEDHIMEIALEAGAQDVVHNDDDSIDVLTLSED 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V    +K +    +A+ I +       + L NA K   ++ +   LED DDVQ+VYS
Sbjct: 180 FYQVKDAMEKAKLMPTQAE-ITMRASTNTTLDLDNASK---MVNLFNRLEDLDDVQTVYS 235

Query: 236 NLEIADDII 244
           N +I+D+II
Sbjct: 236 NADISDNII 244


>gi|82703835|ref|YP_413401.1| hypothetical protein Nmul_A2722 [Nitrosospira multiformis ATCC
           25196]
 gi|119391326|sp|Q2Y5G2|Y2722_NITMU RecName: Full=UPF0082 protein Nmul_A2722
 gi|82411900|gb|ABB76009.1| Protein of unknown function DUF28 [Nitrosospira multiformis ATCC
           25196]
          Length = 240

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 151/241 (62%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K  +DA + KIF++L +EITV+A+L G +P  NPRLRLA+  A  Q+
Sbjct: 1   MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGGGDPNSNPRLRLAVDKAYEQN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKEN+ERAIK+   D  G NY  IRYEGYG  G A++++ +TDNR RT + +R  FTK 
Sbjct: 61  MPKENVERAIKRGSGDLEGVNYEEIRYEGYGIAGAAVLVDCMTDNRVRTVADVRHAFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    F+  G++++     +  L MEVA+E+ A +++  D   I        
Sbjct: 121 GGNLGTDGSVGFLFKHCGQLLFAPGTDEDKL-MEVALEAGAEDIIAHDDGSIEVITAPYE 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            +  K+  EK G +A+  +V  KP+N   L+  D VK + K+++ LE  DDVQ VY+   
Sbjct: 180 FVAVKEALEKAGFKAELAEVTMKPVNETELTGDDSVK-MQKLLDALESIDDVQEVYTTAV 238

Query: 239 I 239
           I
Sbjct: 239 I 239


>gi|295399356|ref|ZP_06809338.1| protein of unknown function DUF28 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|312110084|ref|YP_003988400.1| hypothetical protein GY4MC1_0976 [Geobacillus sp. Y4.1MC1]
 gi|294978822|gb|EFG54418.1| protein of unknown function DUF28 [Geobacillus thermoglucosidasius
           C56-YS93]
 gi|311215185|gb|ADP73789.1| protein of unknown function DUF28 [Geobacillus sp. Y4.1MC1]
          Length = 246

 Score =  189 bits (481), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 103/242 (42%), Positives = 154/242 (63%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK  G +P  NP LRLA++ A+  +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKTGGGDPAANPALRLAVEKARAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA GS +  NY  +RYEGYGP GVA+++  LTDN+NRTAS++R  F+K 
Sbjct: 61  MPNENIERAIKKATGSQEQTNYEEVRYEGYGPGGVAVMVVCLTDNKNRTASNVRVAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHS---NIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG  G  +  F++ G ++      +I + ++ ++ AIE+ A E+   +  +  Y   
Sbjct: 121 GGNLGEAGCVSYLFDRKGLLVIAREGLDIDEDDMLLQ-AIEAGAEEMETTEDSFEIYTTP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  ++LE++     S ++   P  Y  L+  D +K ++K+I+ LEDDDDVQ VY N
Sbjct: 180 ETFEEVKEQLEKQGFSFVSAEITMIPQTYTTLA-GDDLKKMLKLIDALEDDDDVQEVYHN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|292490333|ref|YP_003525772.1| hypothetical protein Nhal_0175 [Nitrosococcus halophilus Nc4]
 gi|291578928|gb|ADE13385.1| protein of unknown function DUF28 [Nitrosococcus halophilus Nc4]
          Length = 248

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/246 (43%), Positives = 149/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI +RK  +DA + K+F+KL REITV+A+L G +P  +PRLR+AI  A   +
Sbjct: 1   MAGHSKWANIQYRKGAQDAKRGKLFTKLIREITVAARLEGGDPATSPRLRIAIDKALAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIK+   D  G  Y  IRYEGYGP GVA++++ +TDNRNRT + +R +F+K 
Sbjct: 61  MPKDNIERAIKRGTGDMEGVAYEEIRYEGYGPHGVAVMVDCMTDNRNRTVAEVRHVFSKW 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F + G II +    D    MEVAIE+ A +V+  ED     + +   
Sbjct: 121 GGNLGTDGSVAYLFSKKG-IISYPKGSDEEAIMEVAIEAGAEDVVTNEDGSIDVFTEPEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                K LEE   +     V       + L   D VK ++  +E LED DDVQ VYSN +
Sbjct: 180 FSAVKKALEEADLKPAQADVTQHASTIVSLELED-VKKMLTFLETLEDLDDVQQVYSNAD 238

Query: 239 IADDII 244
            +++ +
Sbjct: 239 FSEETL 244


>gi|114321639|ref|YP_743322.1| hypothetical protein Mlg_2492 [Alkalilimnicola ehrlichii MLHE-1]
 gi|114228033|gb|ABI57832.1| protein of unknown function DUF28 [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 250

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 156/249 (62%), Gaps = 14/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK+ +DA + KIF+K  +EITV+A++ G +P  NPRLRLAI  A  Q+
Sbjct: 5   MAGHSKWSNIQHRKKAQDAKRGKIFTKHIKEITVAARMGGPDPDSNPRLRLAIDRAFAQN 64

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIK+ AG D+   Y  +RYEGYGP G A++++ +TDNRNRT S +R  FTK 
Sbjct: 65  MPKDNVERAIKRGAGLDESVEYEELRYEGYGPSGAALMVDCMTDNRNRTVSDVRHAFTKC 124

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G+LG+ GS +  F+  G ++Y     +  L ME A+E+ A +++  D + +       D
Sbjct: 125 GGNLGTDGSVSYLFQHRGVLLYPPGTDEDRL-MEAALEAGAEDIVHNDDDSLEVLTTPED 183

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +  V   L +  LE     A+S  V  +P   + +   D  +   ++I+ LED DDVQ V
Sbjct: 184 YRPVRDALVAAGLE----PAES-DVTMRPDIMVTVEGED-ARRTARLIDMLEDLDDVQRV 237

Query: 234 YSNLEIADD 242
           Y+N +IA++
Sbjct: 238 YTNADIAEE 246


>gi|313901943|ref|ZP_07835360.1| protein of unknown function DUF28 [Thermaerobacter subterraneus DSM
           13965]
 gi|313467789|gb|EFR63286.1| protein of unknown function DUF28 [Thermaerobacter subterraneus DSM
           13965]
          Length = 248

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 153/247 (61%), Gaps = 5/247 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK R+DA K KIFSKL+REI  + +  G +P  NPRLRLA++ A+  S
Sbjct: 1   MAGHSKWANRKHRKARQDAKKGKIFSKLAREIITAVRQGGGDPEANPRLRLALERARQFS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIK+  G  +  NY  + YEGYGP GVA+++E LTDNRNR+A  IR IF K 
Sbjct: 61  MPAENIERAIKRGLGESEAENYEELVYEGYGPGGVALMLEILTDNRNRSAGEIRHIFAKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            G+LG +G     F++ G I   +     + +L + +A+E+ A ++  ED  ++ Y D +
Sbjct: 121 GGNLGESGCVAWMFDRKGVITVSAQGAPAEDDLLL-LAVEAGAEDLKAEDGSFVIYTDPD 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++    + LE+     +   +   P   +++   +  + ++++++ LED DDVQ +Y N 
Sbjct: 180 DLHRVREALEKAGVPVEDAGLRMVPKTEVKVEGKE-AEQLLRLLDALEDHDDVQEIYGNF 238

Query: 238 EIADDII 244
           E+ D+++
Sbjct: 239 ELPDELL 245


>gi|15606702|ref|NP_214082.1| hypothetical protein aq_1575 [Aquifex aeolicus VF5]
 gi|6226456|sp|O67517|Y1575_AQUAE RecName: Full=UPF0082 protein aq_1575
 gi|2983942|gb|AAC07491.1| hypothetical protein aq_1575 [Aquifex aeolicus VF5]
          Length = 249

 Score =  189 bits (480), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 154/246 (62%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + DA + K+FSKL REI V+ +L G NP  NPRLR AI+ AK  +
Sbjct: 1   MAGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKK AG  +   +  + YEGY P GVA+++ A TDNRNRT S +R +FTK 
Sbjct: 61  MPWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVMVLATTDNRNRTTSEVRHVFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LG++G  +  FE+ G I +    + +  L +E AIE  A +V   ++ +I Y     
Sbjct: 121 GGNLGASGCVSYLFERKGYIEVPAKEVSEEEL-LEKAIEVGAEDVQPGEEVHIIYTVPEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    + LE+     +  ++ WKP++ +++++ +  + +IK++  LE+ DDVQ V +N E
Sbjct: 180 LYEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFE 239

Query: 239 IADDII 244
           I ++I+
Sbjct: 240 IPEEIL 245


>gi|320352801|ref|YP_004194140.1| hypothetical protein Despr_0673 [Desulfobulbus propionicus DSM
           2032]
 gi|320121303|gb|ADW16849.1| protein of unknown function DUF28 [Desulfobulbus propionicus DSM
           2032]
          Length = 249

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/250 (42%), Positives = 161/250 (64%), Gaps = 11/250 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA + KIF+KL +EIT++AK+ G +P  NPRLR AI  AK+++
Sbjct: 1   MSGHSKWSTIKRKKGANDAKRGKIFTKLIKEITIAAKMGGGDPEGNPRLRSAITVAKSEN 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPKENI+RAIKK G+ DLG   Y  I YEGYGP GVA+++E +TDN+NRT + IR  F K
Sbjct: 61  MPKENIDRAIKK-GTGDLGGAVYEEILYEGYGPGGVAVLVETMTDNKNRTVADIRHFFAK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC--- 174
           + G+LG +G     F++ G I +  + + +  L M+VA+E+ A +V+ E+  +       
Sbjct: 120 SGGNLGESGCVAWMFDKKGTISVDKAGVNEEQL-MDVALEAGAEDVVEEEDSFQIITAPE 178

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
            FN+V    +K + K  EA    V   P N I ++     +S++++++NLED DDVQ V+
Sbjct: 179 SFNDVVDQLEKGKIKFAEATLSMV---PKNTIEVTEEKAARSLLRLLDNLEDHDDVQKVH 235

Query: 235 SNLEIADDII 244
           +N +I D+++
Sbjct: 236 ANFDITDELM 245


>gi|189218663|ref|YP_001939304.1| hypothetical protein Minf_0651 [Methylacidiphilum infernorum V4]
 gi|226707992|sp|B3E045|Y651_METI4 RecName: Full=UPF0082 protein Minf_0651
 gi|189185521|gb|ACD82706.1| Uncharacterized conserved protein [Methylacidiphilum infernorum V4]
          Length = 249

 Score =  189 bits (479), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 155/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  + H+K   D  K K+FSKLSREI+++A+L G +P  N RLR AI NAK++ 
Sbjct: 1   MAGHSHWAKVKHQKGLTDIRKGKLFSKLSREISIAARLGGGDPTFNSRLRRAIANAKDEG 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P ENI RAI+K   +  G +Y ++ YEGYGP GVA++IEA TDNRNRT + IR++F+K 
Sbjct: 61  VPLENITRAIQKGTGEIAGSHYEDVLYEGYGPGGVAVLIEAATDNRNRTTAEIRNLFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F++ G I+   +  D +   EVA+E+ A +V  +  E    C    +
Sbjct: 121 GGNLGAAGSVSWIFQKKGRIVLDGDQNDFDRVFEVALEAGAEDVEQKGSEIEVICLPEKL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               K L+      +S ++ + P N I +++ +  KS+ ++++ LED DDVQ+VY+N + 
Sbjct: 181 DELQKHLDTAGLTIKSSQITYLPKNSISVTDKETFKSLYRLLDILEDHDDVQNVYANFDA 240

Query: 240 ADDII 244
             +++
Sbjct: 241 PQELL 245


>gi|163781653|ref|ZP_02176653.1| hypothetical protein HG1285_02183 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882873|gb|EDP76377.1| hypothetical protein HG1285_02183 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 250

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 152/246 (61%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + DA + K+FSKL REITV+A+L G NP  NPRLR AI+ AK  +
Sbjct: 1   MAGHSHWAQIKHKKAKVDAQRGKLFSKLIREITVAARLGGSNPEFNPRLRTAIEQAKKAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP E IERAIKK   +  G  Y  + YEGY P GVA+++ A TDNRNRT++ ++  F+K 
Sbjct: 61  MPLETIERAIKKGSGELEGETYEEVIYEGYAPGGVAVMVLATTDNRNRTSAEVKHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSLGS+G  +  FE+ G I +  S + +  L  E A+E+ A ++    + ++ Y     
Sbjct: 121 GGSLGSSGCVSYLFERKGAIEVPASEVSEDEL-FEKAVEAGAEDIQSGSEVHLVYTSPEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    + LE+     +   + W P++ + + +A+  K ++++I+ L+D +DVQ V +N E
Sbjct: 180 LYQVKEGLEKAGVPVEKAHITWIPVSTVSVEDAETAKKVLRLIDALDDLEDVQQVIANFE 239

Query: 239 IADDII 244
           I ++++
Sbjct: 240 IPEEVL 245


>gi|167629894|ref|YP_001680393.1| hypothetical protein HM1_1824 [Heliobacterium modesticaldum Ice1]
 gi|226695946|sp|B0TF65|Y1757_HELMI RecName: Full=UPF0082 protein Helmi_17570
 gi|167592634|gb|ABZ84382.1| conserved hypothetical protein [Heliobacterium modesticaldum Ice1]
          Length = 255

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 102/251 (40%), Positives = 153/251 (60%), Gaps = 7/251 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK + DA K KIF+K+ RE+ V+A+  G +P  N RL++AIQ AK  +
Sbjct: 1   MAGHSKWANIKHRKAKVDAQKGKIFTKIGRELIVAARQGGPDPNSNFRLKIAIQKAKENN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAI++ AG  +  NY  + YEGYGP GVAI+IEA+TDNRNRTA  IR +F+K+
Sbjct: 61  MPNDNIQRAIQRGAGGTEGANYEELTYEGYGPGGVAIMIEAMTDNRNRTAGEIRHLFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH------SNIGDSNLAMEVAIESDAFEVLFEDQEYIFY 173
            G+LG TG  +  FE  G I         + + D +  M VA+E+ A ++  E+ E   +
Sbjct: 121 GGNLGETGCVSWIFEPKGVIRLAVTPEAGAKVVDEDELMLVALETGALDIAVEEDEAEVF 180

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
                +    + L +      S +V   P N + +++ D    +IK+++ LE+ DDVQ+ 
Sbjct: 181 TLPEELEGVRQALADAGYAVLSAEVTLVPKNTMEVTDKDIATKLIKLMDALEEHDDVQNA 240

Query: 234 YSNLEIADDII 244
           Y+N  I D ++
Sbjct: 241 YANFNIDDAVM 251


>gi|289578206|ref|YP_003476833.1| hypothetical protein Thit_1001 [Thermoanaerobacter italicus Ab9]
 gi|297544487|ref|YP_003676789.1| hypothetical protein Tmath_1058 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
 gi|289527919|gb|ADD02271.1| protein of unknown function DUF28 [Thermoanaerobacter italicus Ab9]
 gi|296842262|gb|ADH60778.1| protein of unknown function DUF28 [Thermoanaerobacter mathranii
           subsp. mathranii str. A3]
          Length = 246

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 114/249 (45%), Positives = 162/249 (65%), Gaps = 13/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE+ DA K +IF+KL+++I  +AK  G +P  N +LR AI+ AK  +
Sbjct: 1   MSGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPNTNSKLRDAIEKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIKK G+ +LG  N   + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 61  LPNENIQRAIKK-GTGELGGANLEEVIYEGYGPAGTAIIVEALTDNKNRTAGEIRHIFDR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             GSLG+ GS T  F+++G I    +  I +  LAM VAI++ A +   ED+E+    + 
Sbjct: 120 NGGSLGAAGSVTWMFDKVGIITVRKDDSIDEEELAM-VAIDAGAEDFSAEDEEFEIITEP 178

Query: 177 NNVGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +N     + +E+   KI EA+   V   P N I+LS  D  K   K+I+ LE++DDVQ+V
Sbjct: 179 SNFQEVKEAIEKAGYKISEAE---VTMLPKNTIQLSPEDYQK-FEKLIDKLEENDDVQNV 234

Query: 234 YSNLEIADD 242
           Y N+EI D+
Sbjct: 235 YHNVEIEDE 243


>gi|190571591|ref|YP_001975949.1| hypothetical protein WPa_1214 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|213018996|ref|ZP_03334803.1| hypothetical protein C1A_768 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
 gi|226696279|sp|B3CNE0|Y1214_WOLPP RecName: Full=UPF0082 protein WP1214
 gi|190357863|emb|CAQ55322.1| hypothetical protein WP1214 [Wolbachia endosymbiont of Culex
           quinquefasciatus Pel]
 gi|212995105|gb|EEB55746.1| hypothetical protein C1A_768 [Wolbachia endosymbiont of Culex
           quinquefasciatus JHB]
          Length = 246

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 148/246 (60%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +S+ F+KL REITV+AK    +P  NPRLR AI +A+ ++
Sbjct: 1   MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREITVAAKQGLTDPELNPRLRSAIFSARKEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AIK A  +  G +Y  I+YEG GP G A+I+ ALT+NRNRTAS IR IF++ 
Sbjct: 61  LPKDKIETAIKNAAGNVAGESYEEIQYEGCGPSGAALIVHALTNNRNRTASEIRYIFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
            G+LG TG  +  F+ +G I+Y +   +        IE +   V   ++E  Y+  C   
Sbjct: 121 GGNLGETGCVSYLFDHVGLIVYKAEGINFEDLFNYGIELEVLNVEENNKEELYVITCGVK 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G        K GE +  ++ W+P + I +S+ + +  +  ++E LED+DDVQ V  N 
Sbjct: 181 DFGRVRDAFYTKFGEPELARLSWQPKDLIEVSDKELIDKLSILVEELEDNDDVQYVEGNF 240

Query: 238 EIADDI 243
             AD +
Sbjct: 241 IFADKL 246


>gi|121535576|ref|ZP_01667383.1| protein of unknown function DUF28 [Thermosinus carboxydivorans
           Nor1]
 gi|121305816|gb|EAX46751.1| protein of unknown function DUF28 [Thermosinus carboxydivorans
           Nor1]
          Length = 247

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 159/248 (64%), Gaps = 6/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK + DAL+ KI +KLSREITV+ ++ G +P  N RL+LA+Q AK  +
Sbjct: 1   MAGHSKWANIKHRKGKMDALRGKITTKLSREITVAVRMGGADPAGNMRLKLALQKAKENN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PKENI+RAI+K  G+ + GNY  + YEGYGP GVA++++ +TDNRNRTA+ IR +F K 
Sbjct: 61  IPKENIQRAIQKGLGAQEGGNYEEMTYEGYGPGGVAVMLDIMTDNRNRTAADIRHLFAKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN---IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  F++ G  + +++   + + ++ M V +E+ A +   ED +Y      
Sbjct: 121 GGNLGETGCVSWMFKKKGFFVVNASEAKVSEEDMMMLV-LEAGAEDFRSEDGQYEIITAP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +     + L+       + ++   P   + LS  D  K ++K+++ LE+ DDVQ+VY+N
Sbjct: 180 EDFEAVQQALQAHNIATATAEITMLPDTTVALSGDDAAK-MMKLMDALEEHDDVQNVYAN 238

Query: 237 LEIADDII 244
            +I D+++
Sbjct: 239 FDIPDEML 246


>gi|210612602|ref|ZP_03289393.1| hypothetical protein CLONEX_01595 [Clostridium nexile DSM 1787]
 gi|210151527|gb|EEA82534.1| hypothetical protein CLONEX_01595 [Clostridium nexile DSM 1787]
          Length = 243

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 156/245 (63%), Gaps = 10/245 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSG-QNPLENPRLRLAIQNAKNQ 59
           M+GHS+F NI H+KE+ DA++ KIF+K+ RE+ V+ K  G  +P  N RLR  I  AK  
Sbjct: 1   MSGHSKFANIKHKKEKNDAVRGKIFTKIGRELAVAVKEGGGPDPANNSRLRDVIAKAKAN 60

Query: 60  SMPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +MP +NIER+IKKA  D D  NY ++ YEGYGP G AII++ALTDN+NRTAS++R+ FTK
Sbjct: 61  NMPNDNIERSIKKAAGDADASNYEHVTYEGYGPNGTAIIVDALTDNKNRTASNVRNAFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCD- 175
            +G++G+ G  +  F++ G+II        D++  M  A+++ A + + E+  +    D 
Sbjct: 121 GSGNVGTPGCVSFMFDKKGQIIVAKEECEMDADDLMMTALDAGAEDFVEEEDSFEILTDP 180

Query: 176 --FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
             F+ V LT   LEE      S +V   P  +++L++   +K+I K ++ LE+DDDVQ V
Sbjct: 181 DSFSEVRLT---LEEAGIPMASAEVTMIPQTWVQLTDETDLKNIQKTLDLLEEDDDVQEV 237

Query: 234 YSNLE 238
           Y N E
Sbjct: 238 YHNWE 242


>gi|114330308|ref|YP_746530.1| hypothetical protein Neut_0281 [Nitrosomonas eutropha C91]
 gi|122314646|sp|Q0AJA6|Y281_NITEC RecName: Full=UPF0082 protein Neut_0281
 gi|114307322|gb|ABI58565.1| protein of unknown function DUF28 [Nitrosomonas eutropha C91]
          Length = 241

 Score =  188 bits (477), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 152/238 (63%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K  +DA + KIF++L +EITV+A+L G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARLGGGDPGSNPRLRLAMDKAFGHN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIK+   +  G NY  IRYEGYG  G A++++ +TDNR RT + +R  FTK 
Sbjct: 61  MPKDNVERAIKRGCGELEGVNYEEIRYEGYGVSGAAVMVDCMTDNRTRTVADVRHAFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F   G++++  +I ++ L +EVA+ + A +V+  D   +      + 
Sbjct: 121 GGNLGTDGSVSYLFTHCGQLLFAPDIDEARL-LEVALNAGAEDVIDNDDGSLEVITSPDT 179

Query: 180 GLTSK-KLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +  + +LE+   +A+  +V WKP N I L   D  K + K+++ LED DDVQ VY+ 
Sbjct: 180 FVAVRDELEKAAFKAELAEVTWKPENEILLQGDDAAK-MQKLLDALEDIDDVQDVYTT 236


>gi|104773767|ref|YP_618747.1| hypothetical protein Ldb0677 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116513771|ref|YP_812677.1| hypothetical protein LBUL_0609 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|118574391|sp|Q1GAZ3|Y677_LACDA RecName: Full=UPF0082 protein Ldb0677
 gi|122275459|sp|Q04BD3|Y609_LACDB RecName: Full=UPF0082 protein LBUL_0609
 gi|103422848|emb|CAI97506.1| Conserved hypothetical protein [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC 11842]
 gi|116093086|gb|ABJ58239.1| hypothetical protein LBUL_0609 [Lactobacillus delbrueckii subsp.
           bulgaricus ATCC BAA-365]
 gi|325125428|gb|ADY84758.1| Hypothetical conserved protein [Lactobacillus delbrueckii subsp.
           bulgaricus 2038]
          Length = 243

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 102/238 (42%), Positives = 149/238 (62%), Gaps = 5/238 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +PL NPRLRLA+  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPLGNPRLRLAVDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA  +   +Y  + YEGY P GVAI++EALTDN+NRTASS+R  FT+  
Sbjct: 61  MPKDNIQRAIKKAEGNSDEHYDEVTYEGYAPGGVAILVEALTDNKNRTASSVRVAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           GSLG+TGS    F++ G I+   +  D++   + M+V +E+   ++   D  Y  Y D  
Sbjct: 121 GSLGATGSVAYMFDRKGYIVIDRSTTDADEDQMLMDV-MEAGGDDLQTSDDAYEIYTDAK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           +       LE+   +    ++   P N   +  ADK +   K+++ LEDDDDV +VY+
Sbjct: 180 SFTAVRDALEKAGYQLAVSELTMVPQNTTPVP-ADKKEQFEKLVDALEDDDDVSNVYT 236


>gi|291286411|ref|YP_003503227.1| hypothetical protein Dacet_0473 [Denitrovibrio acetiphilus DSM
           12809]
 gi|290883571|gb|ADD67271.1| protein of unknown function DUF28 [Denitrovibrio acetiphilus DSM
           12809]
          Length = 249

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 152/249 (61%), Gaps = 22/249 (8%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA K K F+K+++E+TV+AK+ G +P  NPRLR+A+  AK+ +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKKGKAFTKVAKELTVAAKIGGADPEMNPRLRVALDKAKSAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+N+ERAIKK  G  +   Y ++ YEGYGP GVAI+++ALT+N+NRT + +RS  +K 
Sbjct: 61  LPKDNVERAIKKGTGEGNDAVYEDMVYEGYGPGGVAILVKALTENKNRTVAEVRSTMSKK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIES---------DAFEVLFEDQEY 170
            GS+G  G     FE  G I  + +  D    ME+A+E+         D F+V+ E  EY
Sbjct: 121 GGSMGEPGCVAWIFENKGLIEINKDSVDEETLMELALEAGADDVVDEGDVFQVVTEPSEY 180

Query: 171 IFYCDFNNVGLTSKKLEEKIGEAQSI-KVIWKPLNYIRLSNADKVKSIIKMIENLEDDDD 229
                      T K   E+ G A S  +V  KP N I LS +D +K +  + E LED DD
Sbjct: 181 ----------FTVKNAIEEKGLAMSFSEVSMKPKNTIPLSGSD-LKKLFTITEALEDLDD 229

Query: 230 VQSVYSNLE 238
           VQ V+SN E
Sbjct: 230 VQEVFSNFE 238


>gi|110597084|ref|ZP_01385373.1| Protein of unknown function DUF28 [Chlorobium ferrooxidans DSM
           13031]
 gi|110341275|gb|EAT59740.1| Protein of unknown function DUF28 [Chlorobium ferrooxidans DSM
           13031]
          Length = 250

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 151/244 (61%), Gaps = 5/244 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A+  S
Sbjct: 1   MSGHSKWATIKRKKAATDQKRGSLFTKLVKEITIAAKMGGGDPNGNPRLRLAIDTARANS 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RA+KK   +  G  Y  I YEGYGP G+A+IIE  TDNRNRT + IR I ++ 
Sbjct: 61  MPMDNIQRAVKKGTGELEGVTYDEITYEGYGPAGIALIIETATDNRNRTVADIRHIMSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
           NGSLG +GS    F++ G +    +  D +  ME+ +++   E L +D +  Y    D  
Sbjct: 121 NGSLGESGSVAWMFQRKGTVDVLKSAADEDQLMEILLDA-GLEDLSDDDDNYYTVITDVR 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
            +    K L+E     ++ K+   P NYI L  AD  + +IK+I+ LE++DD+Q+VYSN+
Sbjct: 180 QLEDVKKVLDEAAIAYENAKIDLLPENYIELE-ADDAEKVIKLIDALENNDDIQAVYSNM 238

Query: 238 EIAD 241
           EI++
Sbjct: 239 EISE 242


>gi|325681511|ref|ZP_08161036.1| DNA-binding regulatory protein, YebC/PmpR family [Ruminococcus
           albus 8]
 gi|324106778|gb|EGC01069.1| DNA-binding regulatory protein, YebC/PmpR family [Ruminococcus
           albus 8]
          Length = 247

 Score =  187 bits (476), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 152/242 (62%), Gaps = 7/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+++NI  +K   DA ++KIF+K+ REI V  K+ G +P  N +LR  I  AK+ +
Sbjct: 1   MSGHSKWENIKRKKGATDAARAKIFTKIGREIAVVVKMGGPDPSGNAKLRDLIAKAKSNN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NIER IKKA  D D  NY ++ YEGYGP GVA+I+E LTDN+NRTA+ +RS F K 
Sbjct: 61  VPNDNIERIIKKAAGDGDKNNYESMVYEGYGPCGVAVIVECLTDNKNRTAADVRSYFNKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++GSTG  +  F  +G ++  +N  D +  M+   E+ A +   E+      C  N+V
Sbjct: 121 GGNMGSTGCVSYLFSDVGTVVIENNGADEDKIMDDVFEAGADDFNVEEDVIEIACSPNSV 180

Query: 180 GLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           G   + LE    K+  A++ K+   P  Y+ +++ D +K +  +++NLED+DDVQ+V+ N
Sbjct: 181 GSVRETLEGMGYKVLSAEADKI---PSTYVTITDEDAMKKMGLLLDNLEDNDDVQNVFHN 237

Query: 237 LE 238
            E
Sbjct: 238 WE 239


>gi|269926074|ref|YP_003322697.1| protein of unknown function DUF28 [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269789734|gb|ACZ41875.1| protein of unknown function DUF28 [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 252

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 157/248 (63%), Gaps = 7/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++  I  +KE  DA K +IF+K+SREI V+ +  G +P  N RLRLAIQ A++ +
Sbjct: 1   MAGHSKWAQIKRKKEATDARKGQIFTKISREIAVAVRQGGPDPEANYRLRLAIQKARSIN 60

Query: 61  MPKENIERAIKKAGSD--DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NI+RAI++A  +  +  NY  I YEGYGP GVA+++E LTDNRNRT S IR++F +
Sbjct: 61  MPADNIKRAIERAAGEGSNATNYEEITYEGYGPAGVAVLVETLTDNRNRTVSEIRNVFNR 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDS--NLAMEVAIESDAFEVL-FEDQEYIFYCD 175
           + G LG +GS +  F++ G I+   +   +  ++A+  AIE+ A +V   ED     Y  
Sbjct: 121 SGGRLGESGSVSWIFDEKGLIVVEPDNQHTADDIAL-AAIEAGAEDVTPLEDGTVEVYTQ 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F ++    + LE+   +  S + ++ P  Y+  S+ D  +SI+K IE LED DDVQ VY+
Sbjct: 180 FQDLKSVEESLEQMGFKVASAEKVYIPNTYVEPSDTD-AQSILKFIEKLEDLDDVQEVYT 238

Query: 236 NLEIADDI 243
           N++   D+
Sbjct: 239 NMKTEADV 246


>gi|85858584|ref|YP_460786.1| hypothetical protein SYN_02974 [Syntrophus aciditrophicus SB]
 gi|119369547|sp|Q2LRB1|Y739_SYNAS RecName: Full=UPF0082 protein SYNAS_07390
 gi|85721675|gb|ABC76618.1| hypothetical cytosolic protein [Syntrophus aciditrophicus SB]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 158/247 (63%), Gaps = 5/247 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D+ + KIF+K+ +EIT++A+L G +   N RLR AI  AKN++
Sbjct: 1   MSGHSKWSTIKRKKGAIDSKRGKIFTKIIKEITLAARLGGGDTEGNSRLRQAILAAKNEN 60

Query: 61  MPKENIERAIKKAGSDDLG---NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           MP++NI+RAIKK G+ ++G   +Y  + YEGYGP GVA+++E +TDN+NRT + IR IF+
Sbjct: 61  MPRDNIDRAIKK-GTGEIGGGESYEEVTYEGYGPGGVAVLVEVMTDNKNRTVAEIRHIFS 119

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           K  G+LG  G  +  FE+ G I++  ++ D +  ME+A+E+ A ++  E+ +     D +
Sbjct: 120 KHGGNLGGNGCVSWLFEKKGSIVFDRDLIDEDALMELALEAGAEDIREEESQMDVITDPS 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                   LE K  +     +   P N IRL    K + ++KMIE LED+DDVQ+VY+N 
Sbjct: 180 MFDKVRDVLEGKGMKYVQASIEMVPQNTIRLDEG-KAEQMLKMIEKLEDNDDVQNVYANF 238

Query: 238 EIADDII 244
           +I D+I+
Sbjct: 239 DIPDEIM 245


>gi|310779486|ref|YP_003967819.1| protein of unknown function DUF28 [Ilyobacter polytropus DSM 2926]
 gi|309748809|gb|ADO83471.1| protein of unknown function DUF28 [Ilyobacter polytropus DSM 2926]
          Length = 250

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 150/245 (61%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +D  ++K+F+KL +E+T+SAK  G +   NPRLRLA++ A++ +
Sbjct: 1   MAGHSKWSNIKHRKGAQDKKRAKLFTKLGKELTISAKEGGGDINFNPRLRLALEKARSGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAIKK   +  G  Y  IRYEGYGP G A I++ +TDN+NR+ASS+RS F+K 
Sbjct: 61  MPKDNIDRAIKKGTGELEGVEYVEIRYEGYGPSGTAFIVDVVTDNKNRSASSVRSTFSKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LGS G+    F + G I   +   D    M  A+E+ A +V  ED+ +    D  + 
Sbjct: 121 GGNLGSDGAVAWMFNKNGLIEIPAEGIDEEELMMTALEAGAEDVKLEDETFEVITDPADF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L E   + +  +V   P N + +++ D  K +  + E LED DDV  VYSN +I
Sbjct: 181 QTVLDSLVEAGYKYEEAEVTMIPENKVEITDEDTAKKVFGLFEALEDIDDVDDVYSNFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIM 245


>gi|156345602|ref|XP_001621415.1| hypothetical protein NEMVEDRAFT_v1g222013 [Nematostella vectensis]
 gi|156207322|gb|EDO29315.1| predicted protein [Nematostella vectensis]
          Length = 249

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 157/251 (62%), Gaps = 13/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KIF+K+ RE+TV+AK  G  P +NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKGRQDAKRGKIFTKIIRELTVAAKHGGPIPADNPRLRLAVDKALTSN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI + AG+++  N   + YEGY   GVAII+EA+TDNRNRTA+ +R  FTK 
Sbjct: 61  MSRDVIDRAIARGAGNNEADNVAELSYEGYALGGVAIIVEAMTDNRNRTAAEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIF---YCD 175
            G+LG+ GS    F++ G++ +   + +  L ME A+E+ A +V + ED   +    + D
Sbjct: 121 GGNLGTDGSVAYMFDRKGQLSFAPGVSEDAL-MEAALEAGADDVEMAEDGSALVSTSFAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F+ V   L++   +    E   I  I  P     +++ +  + +IK+I+ LED DDVQ V
Sbjct: 180 FHGVNEALSTAGFKADEAEIAMIPSISAP-----VADLETAQKVIKLIDMLEDLDDVQEV 234

Query: 234 YSNLEIADDII 244
           Y N EI D+I+
Sbjct: 235 YHNAEIPDEIM 245


>gi|254428271|ref|ZP_05041978.1| conserved hypothetical protein TIGR01033 [Alcanivorax sp. DG881]
 gi|196194440|gb|EDX89399.1| conserved hypothetical protein TIGR01033 [Alcanivorax sp. DG881]
          Length = 248

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 149/239 (62%), Gaps = 5/239 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+TV+AK+ G  P +NPRLR AI  A  Q+
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIRELTVAAKMGGGEPNDNPRLRAAIDKALGQN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+K+ AG DD GN   I YEGYG  GVA+++E +TDN NRT + +R  F+K 
Sbjct: 61  MTRDTIDRAVKRGAGGDDDGNMDEITYEGYGKGGVAVLVETMTDNVNRTVAEVRHAFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV--LFEDQEYIFYCDFN 177
            G+LG++GS    F + GEI + S + +  L MEVA+E+ A +V  + +D   +      
Sbjct: 121 AGNLGTSGSVAFLFTKRGEIFFESGVDEEKL-MEVALEAGAEDVEEVGDDGFVVTTTPDK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           + G     L E   E    +V   P     + +AD  +++ KMI+ LED DDVQ+VY+N
Sbjct: 180 SFGEVVDALREAGLEFAEAEVTMHPSTEAEM-DADTAETVQKMIDMLEDLDDVQNVYTN 237


>gi|162319775|ref|YP_378486.2| hypothetical protein Cag_0165 [Chlorobium chlorochromatii CaD3]
 gi|118574097|sp|Q3AU82|Y165_CHLCH RecName: Full=UPF0082 protein Cag_0165
          Length = 250

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 156/245 (63%), Gaps = 7/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A++ S
Sbjct: 1   MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGGDPTGNPRLRLAIDTARSNS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKK  G  D  ++  I YEGYGP G+A+IIE  TDNRNRT + +R I ++ 
Sbjct: 61  MPMDNIQRAIKKGTGELDGVSWDEITYEGYGPAGIALIIETATDNRNRTVADLRHIMSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC--DF 176
           NGSLG +GS    F++ G + + HS + +  L ME+ +++   E L +D E  F    D 
Sbjct: 121 NGSLGESGSVAWMFQRKGSLDVPHSAVSEEQL-MELLLDA-GLEDLDQDDENYFTVITDI 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++    K L+E     ++ K+   P NYI L +AD    ++K+I+ LE +DDVQ+VYSN
Sbjct: 179 KDLESAKKALDEAGIAYENAKIDLIPDNYIEL-DADDAAKVMKLIDALESNDDVQAVYSN 237

Query: 237 LEIAD 241
           +E+++
Sbjct: 238 MELSE 242


>gi|208779421|ref|ZP_03246767.1| conserved hypothetical protein [Francisella novicida FTG]
 gi|208745221|gb|EDZ91519.1| conserved hypothetical protein [Francisella novicida FTG]
          Length = 248

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 153/246 (62%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDTLMEVALEAGAEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L +A+  + ++ +I+ LED DDVQSVYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DAETAEKVMALIDKLEDLDDVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|78170347|gb|ABB27443.1| Protein of unknown function DUF28 [Chlorobium chlorochromatii CaD3]
          Length = 262

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 156/245 (63%), Gaps = 7/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A++ S
Sbjct: 13  MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGGDPTGNPRLRLAIDTARSNS 72

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKK  G  D  ++  I YEGYGP G+A+IIE  TDNRNRT + +R I ++ 
Sbjct: 73  MPMDNIQRAIKKGTGELDGVSWDEITYEGYGPAGIALIIETATDNRNRTVADLRHIMSRN 132

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC--DF 176
           NGSLG +GS    F++ G + + HS + +  L ME+ +++   E L +D E  F    D 
Sbjct: 133 NGSLGESGSVAWMFQRKGSLDVPHSAVSEEQL-MELLLDA-GLEDLDQDDENYFTVITDI 190

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++    K L+E     ++ K+   P NYI L +AD    ++K+I+ LE +DDVQ+VYSN
Sbjct: 191 KDLESAKKALDEAGIAYENAKIDLIPDNYIEL-DADDAAKVMKLIDALESNDDVQAVYSN 249

Query: 237 LEIAD 241
           +E+++
Sbjct: 250 MELSE 254


>gi|254372983|ref|ZP_04988472.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|254374434|ref|ZP_04989916.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151570710|gb|EDN36364.1| conserved hypothetical protein [Francisella novicida GA99-3549]
 gi|151572154|gb|EDN37808.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|332678324|gb|AEE87453.1| hypothetical protein FNFX1_1067 [Francisella cf. novicida Fx1]
          Length = 248

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 153/246 (62%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L +A+  + ++ +I+ LED DDVQSVYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DAETAEKVMALIDKLEDLDDVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|256028461|ref|ZP_05442295.1| hypothetical protein PrD11_10799 [Fusobacterium sp. D11]
 gi|289766382|ref|ZP_06525760.1| conserved hypothetical protein [Fusobacterium sp. D11]
 gi|289717937|gb|EFD81949.1| conserved hypothetical protein [Fusobacterium sp. D11]
          Length = 249

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 160/249 (64%), Gaps = 9/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGGDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS IR  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEIRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
           +G+LG+ G+ +  F++ G I   S   D++  M  A+E+ A E + ED  Y      Y +
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKSEGIDADEFMMAALEAGA-EDVEEDDGYFEVTTEYTE 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V    K +  +  EA+ I +I  P N + +++ +  K ++ + + LED DD Q+VYS
Sbjct: 180 FQTVLENLKNVGYQYEEAE-ISMI--PENTVEITDLETAKKVMALYDALEDLDDSQNVYS 236

Query: 236 NLEIADDII 244
           N +I D+I+
Sbjct: 237 NFDIPDEIL 245


>gi|256846085|ref|ZP_05551543.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
 gi|256719644|gb|EEU33199.1| conserved hypothetical protein [Fusobacterium sp. 3_1_36A2]
          Length = 249

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 156/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   +   D++  M  A+E+ A +V  +D  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKAEGIDTDEFMMAALEAGAEDVTEDDGYFEVTTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N + +S+ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEEAEISMIPENTVEISDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIL 245


>gi|91228186|ref|ZP_01262168.1| hypothetical protein V12G01_20563 [Vibrio alginolyticus 12G01]
 gi|91188175|gb|EAS74476.1| hypothetical protein V12G01_20563 [Vibrio alginolyticus 12G01]
          Length = 248

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 148/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REI V+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIFTKLIREIVVAAKEGGGEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RA+ + AG +   N   + YEGYGP G A+++E +TDNRNRT S +R  F+K+
Sbjct: 61  MTRDTVNRAVSRGAGGEGDDNMETVIYEGYGPGGTAVMVECMTDNRNRTVSGVRHAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F++ G I Y   + D +  MEVA+ES A ++   ED     Y    +
Sbjct: 121 GGNLGTDGSVNYLFDKKGVISYGPGL-DEDAVMEVALESGADDIETAEDGSIDVYTAPGD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            GL    L+    EA++ +V   P     L +AD    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGLVKDALDAAGFEAENAEVSLIPSTKADL-DADTAPKLLRLIDALEDLDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+DD+
Sbjct: 239 ISDDV 243


>gi|269967683|ref|ZP_06181733.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
 gi|269827770|gb|EEZ82054.1| conserved hypothetical protein [Vibrio alginolyticus 40B]
          Length = 248

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 148/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REI V+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIFTKLIREIVVAAKEGGGEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RA+ + AG +   N   + YEGYGP G A+++E +TDNRNRT S +R  F+K+
Sbjct: 61  MTRDTVNRAVSRGAGGEGDDNMETVIYEGYGPGGTAVMVECMTDNRNRTVSGVRHAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F++ G I Y   + D +  MEVA+ES A ++   ED     Y    +
Sbjct: 121 GGNLGTDGSVNYLFDKKGVISYGPGL-DEDAVMEVALESGADDIETAEDGSIDVYTAPGD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            GL    L+    EA++ +V   P     L +AD    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGLVKDALDAAGFEAENAEVSLIPSTKADL-DADNAPKLLRLIDALEDLDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+DD+
Sbjct: 239 ISDDV 243


>gi|15604319|ref|NP_220835.1| hypothetical protein RP455 [Rickettsia prowazekii str. Madrid E]
 gi|6226375|sp|Q9ZD88|Y455_RICPR RecName: Full=UPF0082 protein RP455
 gi|3861011|emb|CAA14911.1| unknown [Rickettsia prowazekii]
 gi|292572070|gb|ADE29985.1| hypothetical protein rpr22_CDS445 [Rickettsia prowazekii Rp22]
          Length = 252

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/247 (43%), Positives = 150/247 (60%), Gaps = 6/247 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN-PLENPRLRLAIQNAKNQ 59
           MAGHS+FKNI HRK  +D  KSK+F+KL REI  + K    N P  NPRLR A+  A++Q
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKKSKVFTKLIREIVTAVKTGASNVPENNPRLRKALNAARSQ 60

Query: 60  SMPKENIERAIKKAGSDDLGN---YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           ++PKE I++AI  A  +D  N   Y  IRYEGY P G+AII+EALTDN+NRTAS +RS F
Sbjct: 61  NLPKERIDKAINSA--NDASNNESYMEIRYEGYAPNGIAIIVEALTDNKNRTASEVRSSF 118

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           TK  G LG TGS    F   G I Y  NI  +    E AI++   +++ +   +  Y D 
Sbjct: 119 TKYGGILGETGSVNYLFNHCGVIQYPINIASNEDIFEAAIQAGGNDIISDYITHTIYTDI 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            N       L +K G  +   + W P+N I + + +K K ++K+I  LE++DDVQ V+ N
Sbjct: 179 ENFYKALGFLTDKYGIPEDSYIGWIPVNTIIIDDKEKAKKLLKLIAVLEENDDVQRVFGN 238

Query: 237 LEIADDI 243
             +++D+
Sbjct: 239 YMLSEDV 245


>gi|300112850|ref|YP_003759425.1| hypothetical protein Nwat_0126 [Nitrosococcus watsonii C-113]
 gi|299538787|gb|ADJ27104.1| protein of unknown function DUF28 [Nitrosococcus watsonii C-113]
          Length = 249

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 154/246 (62%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI +RK  +DA + K+F++L REITV+A+L G +P  +PRLR AI  A   +
Sbjct: 1   MAGHSKWANIQYRKGAQDAKRGKLFTRLIREITVAARLEGGDPATSPRLRTAIDKAFAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIK+   D  G  Y  +RYEGYGP GVA++++ +TDNRNRT + IR +F+K 
Sbjct: 61  MPKDNIERAIKRGTGDLEGVAYEEVRYEGYGPHGVAVMVDCMTDNRNRTVAEIRHVFSKW 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    F + G II ++   + +  MEVAIE  A +V+  +   I        
Sbjct: 121 GGNLGTDGSVAYLFSKKG-IISYAKESNEDAIMEVAIEGGAEDVVTNEDSSIDVFTEPEE 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            LT KK  +K G +A+  ++       + L+  +  + ++  ++ LED DDVQ VYSN +
Sbjct: 180 FLTVKKALDKAGLKAEQAEITQHASTSVSLALLEDARKMLDFLDALEDLDDVQQVYSNAD 239

Query: 239 IADDII 244
            +++I+
Sbjct: 240 FSEEIL 245


>gi|325290234|ref|YP_004266415.1| UPF0082 protein yeeN [Syntrophobotulus glycolicus DSM 8271]
 gi|324965635|gb|ADY56414.1| UPF0082 protein yeeN [Syntrophobotulus glycolicus DSM 8271]
          Length = 251

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/250 (40%), Positives = 158/250 (63%), Gaps = 11/250 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K R DA K K+++KL+REI ++A+    +P  N RL++AI NAK  +
Sbjct: 1   MSGHSKWANIKHKKARTDAAKGKLYTKLAREIFIAARAGSPDPNNNFRLKIAIDNAKAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P ENI+RA++K +G+ D  NY  +RYEGYGP GVAI+   LTDNRNR+AS +R IF+K 
Sbjct: 61  LPNENIQRAVQKGSGTGDDTNYEELRYEGYGPGGVAIMATILTDNRNRSASEMRHIFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAME------VAIESDAFEVLFEDQEYIFY 173
            G++G +G     F + G++    +I    LA+        A+E+ A ++  ED+ Y  +
Sbjct: 121 GGNMGDSGCVGWMFAEKGQL----SIAKEGLALNEDDLLLFALEAGAEDIETEDEGYEVF 176

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
               N+    + L +   + Q+  V   P N + +S+ D+ K IIK+I+ LE+ DDVQ+V
Sbjct: 177 TAPENMEQVRQSLIDGGIQIQTANVSLIPENRMEISDLDQAKKIIKLIDTLEEHDDVQNV 236

Query: 234 YSNLEIADDI 243
           Y+N ++A+ I
Sbjct: 237 YTNFDLAEGI 246


>gi|189346018|ref|YP_001942547.1| hypothetical protein Clim_0475 [Chlorobium limicola DSM 245]
 gi|226707596|sp|B3EG35|Y475_CHLL2 RecName: Full=UPF0082 protein Clim_0475
 gi|189340165|gb|ACD89568.1| protein of unknown function DUF28 [Chlorobium limicola DSM 245]
          Length = 250

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 150/244 (61%), Gaps = 5/244 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT+SAK+ G +P  NPRLRLA+  A+  S
Sbjct: 1   MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITISAKMGGGDPSGNPRLRLAVDTARANS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKK  G  D   Y  I YEGYGP G+A+IIE  TDNRNRT + IR I ++ 
Sbjct: 61  MPMDNIQRAIKKGTGELDGATYDEITYEGYGPAGIALIIETATDNRNRTVADIRHIMSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
           NGSLG +GS +  F++ G +    +    +  ME+ +++   E L  D E  Y    D  
Sbjct: 121 NGSLGESGSVSWMFQRKGSLDVPKSAMQEDALMELLLDA-GLEDLDGDDEVYYTVVTDIR 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++    K L+E     ++ KV   P NYI L  AD  + +I++I+ LE++DDVQ VY+N+
Sbjct: 180 DLENAKKALDEAGIAYENAKVDLIPENYIELE-ADDAEKVIRLIDALENNDDVQVVYTNM 238

Query: 238 EIAD 241
           EI++
Sbjct: 239 EISE 242


>gi|297569181|ref|YP_003690525.1| protein of unknown function DUF28 [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296925096|gb|ADH85906.1| protein of unknown function DUF28 [Desulfurivibrio alkaliphilus
           AHT2]
          Length = 249

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 152/245 (62%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK   DA + KIF++L +EI V+A+L G +   NPRLR A+  AK ++
Sbjct: 1   MAGHSKWANIKHRKGAMDAKRGKIFTRLIKEIMVAARLGGGDIDGNPRLRTAVAAAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK   +  G  Y  I YEGYGP GVA+++E +TDNR RT + +R +F+KA
Sbjct: 61  MPKDNIERAIKKGTGELEGVAYEEITYEGYGPGGVAVMVECMTDNRVRTVADVRFMFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG +   +  F++ G+I+        +  ME A+E+ A +V+ E+  +    + ++ 
Sbjct: 121 GGNLGESNCVSWMFDRKGQILVEREATSEDELMEAALEAGAEDVVVEESTFQVLTEPDDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
              S+ L+ K        +   P N + + +    + ++K++++LED+DDVQ V++N +I
Sbjct: 181 AAVSEALQAKGIAFLEASIAMIPKNTVEVGDEQTARQLMKLLDSLEDNDDVQHVHANFDI 240

Query: 240 ADDII 244
            D ++
Sbjct: 241 PDAVM 245


>gi|78187497|ref|YP_375540.1| hypothetical protein Plut_1643 [Chlorobium luteolum DSM 273]
 gi|119391278|sp|Q3B2D4|Y1643_PELLD RecName: Full=UPF0082 protein Plut_1643
 gi|78167399|gb|ABB24497.1| Protein of unknown function DUF28 [Chlorobium luteolum DSM 273]
          Length = 250

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 153/245 (62%), Gaps = 7/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A++ S
Sbjct: 1   MSGHSKWATIKRKKAVTDQKRGSLFTKLVKEITIAAKMGGGDPSGNPRLRLAIDTARSNS 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NI+RA+KK G+ +L    Y  I YEGYGP G+A+IIE  TDNRNRT + +R I ++
Sbjct: 61  MPMDNIQRAVKK-GTGELEGVIYDEITYEGYGPAGIALIIETATDNRNRTVADLRHIMSR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFED--QEYIFYCDF 176
            NGSLG +GS +  F++ G +    +       ME  +E+   E L  D  + Y    D 
Sbjct: 120 NNGSLGESGSVSWMFQRKGSLEVPVSAASEEALMEALLEA-GLEDLSNDGGETYTVITDV 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++    K LEE+    ++ K+   P NYI L  A+  + +IK+I+ LE++DDVQ+VYSN
Sbjct: 179 RDLEAAKKALEEQAIAFENAKMDLIPENYIEL-EAEDARKVIKLIDALEENDDVQAVYSN 237

Query: 237 LEIAD 241
           +EI++
Sbjct: 238 MEISE 242


>gi|33517052|sp|Q8RAR7|Y1135_THETN RecName: Full=UPF0082 protein TTE1135
          Length = 243

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 162/249 (65%), Gaps = 13/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+KE+ DA K +IF+KL+++I  +AK  G +P  N +L+LAI+ AK  +
Sbjct: 1   MAGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPETNSKLKLAIERAKAFN 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIK+ G+ +LG      + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 61  LPSENIQRAIKR-GTGELGGAKLEEVIYEGYGPAGTAIIVEALTDNKNRTAGEIRHIFDR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYH--SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             G+LG+ GS T  F+++G I+     +I + +L M VAIE+ A +   ++ E+    D 
Sbjct: 120 NGGTLGAAGSVTWMFDKVGVIVVEKTDSINEEDLMM-VAIEAGAEDFSADEGEFEIITDP 178

Query: 177 NNVGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +N     + +E+   KI EA+   +   P N I+LS  D  K   K+I+ LED+DDVQ+V
Sbjct: 179 SNFQEVREAIEKAGYKISEAE---ITMLPKNTIKLSPEDYEK-FEKLIDKLEDNDDVQNV 234

Query: 234 YSNLEIADD 242
           Y N+E+ D+
Sbjct: 235 YHNVELEDE 243


>gi|260495037|ref|ZP_05815166.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
 gi|260197480|gb|EEW94998.1| conserved hypothetical protein [Fusobacterium sp. 3_1_33]
          Length = 249

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 156/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGGDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS IR  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEIRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   S   D++  M  A+E+ A +V  +D  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKSEGIDADEFMMAALEAGAEDVEEDDGYFEITTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N + +++ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEEAEISMIPENTVEITDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIL 245


>gi|332711354|ref|ZP_08431286.1| conserved hypothetical protein TIGR01033 [Lyngbya majuscula 3L]
 gi|332349903|gb|EGJ29511.1| conserved hypothetical protein TIGR01033 [Lyngbya majuscula 3L]
          Length = 255

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 163/253 (64%), Gaps = 12/253 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA+K K F+K+SREI V+A+    +P  N +LR A++ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAVKGKTFAKISREIIVAARNGIPDPEGNFQLRQAVEKAKAAG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTN----IRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           +P ENIERAI K G+  LGN ++    IRYEGYGP GVAI+IEA TDNRNRTA+ +RS F
Sbjct: 61  IPNENIERAIAK-GAGTLGNESDNLEEIRYEGYGPGGVAILIEAFTDNRNRTAADLRSGF 119

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLFEDQEYI--- 171
           TK  G+LG TG  +  FEQ G +    +I + +L  E ++E  A  +E L ED E +   
Sbjct: 120 TKNGGNLGETGCVSWMFEQKGVVTLTGDITEDHL-FEASLEGGAQTYE-LNEDSEGVTAE 177

Query: 172 FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
            + + +N+   S+ L+ +  E    ++ W P N + +++ D  ++++K+++ LED +DVQ
Sbjct: 178 VFTEVSNLENLSQILKNQGFEVSEAQLRWIPSNTVEVTDPDLARTLLKLMDALEDLEDVQ 237

Query: 232 SVYSNLEIADDII 244
           +V +N E++D ++
Sbjct: 238 NVTANFEMSDQLM 250


>gi|20807595|ref|NP_622766.1| hypothetical protein TTE1135 [Thermoanaerobacter tengcongensis MB4]
 gi|20516134|gb|AAM24370.1| conserved hypothetical protein [Thermoanaerobacter tengcongensis
           MB4]
          Length = 245

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 162/249 (65%), Gaps = 13/249 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+KE+ DA K +IF+KL+++I  +AK  G +P  N +L+LAI+ AK  +
Sbjct: 3   MAGHSKWANIKHKKEKMDAKKGRIFTKLTKDIIKAAKEGGGDPETNSKLKLAIERAKAFN 62

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIK+ G+ +LG      + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 63  LPSENIQRAIKR-GTGELGGAKLEEVIYEGYGPAGTAIIVEALTDNKNRTAGEIRHIFDR 121

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYH--SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             G+LG+ GS T  F+++G I+     +I + +L M VAIE+ A +   ++ E+    D 
Sbjct: 122 NGGTLGAAGSVTWMFDKVGVIVVEKTDSINEEDLMM-VAIEAGAEDFSADEGEFEIITDP 180

Query: 177 NNVGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           +N     + +E+   KI EA+   +   P N I+LS  D  K   K+I+ LED+DDVQ+V
Sbjct: 181 SNFQEVREAIEKAGYKISEAE---ITMLPKNTIKLSPEDYEK-FEKLIDKLEDNDDVQNV 236

Query: 234 YSNLEIADD 242
           Y N+E+ D+
Sbjct: 237 YHNVELEDE 245


>gi|254490177|ref|ZP_05103368.1| conserved hypothetical protein TIGR01033 [Methylophaga thiooxidans
           DMS010]
 gi|224464663|gb|EEF80921.1| conserved hypothetical protein TIGR01033 [Methylophaga thiooxydans
           DMS010]
          Length = 249

 Score =  186 bits (471), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 150/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+KL REITV+A++ G +P  NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIQHRKGAQDAKRGKLFTKLIREITVAARMGGSDPASNPRLRAAIDKALGNN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA K+   +  G NY  IRYEGYGP G AI+++ +TDN+NRT +++R++FTK 
Sbjct: 61  MTKDVIERATKRGAGELEGVNYEEIRYEGYGPNGTAIMVDCMTDNKNRTVAAVRNVFTKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ G     F + G I   + + +  + ME A+E+ A +++  D   I  +   ++
Sbjct: 121 GGNMGTDGCVAFLFNKKGIISLPAGLEEETV-MEAALEAGAEDIVTNDDGSIDVFTTPDD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  L+E   EA+S +V   P   + L   D  K  I MIE  E+ DDVQ VYSN +
Sbjct: 180 YAAVKDALDEAGLEAESSQVTMHPDTTVSLE-VDDAKKAIGMIEAFEELDDVQEVYSNAD 238

Query: 239 IADDII 244
            +D+++
Sbjct: 239 FSDEVM 244


>gi|39996176|ref|NP_952127.1| hypothetical protein GSU1074 [Geobacter sulfurreducens PCA]
 gi|49036508|sp|P62036|Y1074_GEOSL RecName: Full=UPF0082 protein GSU1074
 gi|39982941|gb|AAR34400.1| conserved hypothetical protein TIGR01033 [Geobacter sulfurreducens
           PCA]
 gi|298505190|gb|ADI83913.1| protein of unknown function DUF28 [Geobacter sulfurreducens KN400]
          Length = 247

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 154/241 (63%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + K+F+KL +EITV+AK+ G +P  NPRLR A+  AK ++
Sbjct: 1   MSGHNKWSTIRHKKGAADAKRGKVFTKLIKEITVAAKIGGGDPNGNPRLRAAVDKAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK   +  G +Y  I YEGYGP GVA+++E +TDNRNRT   +RS FTK 
Sbjct: 61  MPKDNIERAIKKGTGELEGVSYEEIIYEGYGPGGVAVLVECMTDNRNRTVGEVRSTFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G  G  +  F++ G I+   ++ D     E A+E+ A +V  E+++Y    D    
Sbjct: 121 NGNMGEAGCVSWMFDKKGLIVLSKDV-DFEKLFETALEAGADDVADEEEQYEVLTDPAAF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + LE+     +S ++   P   ++L +    ++++K+++ LED+DDVQ+VY+N +I
Sbjct: 180 IDVREALEKAGFPFESAEITMIPQTMVKL-DGKNAENMLKLMDRLEDNDDVQNVYANFDI 238

Query: 240 A 240
           +
Sbjct: 239 S 239


>gi|19704982|ref|NP_602477.1| hypothetical protein FN1661 [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|296329236|ref|ZP_06871737.1| glucose-1-phosphate adenylyltransferase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
 gi|33517054|sp|Q8RIE0|Y1661_FUSNN RecName: Full=UPF0082 protein FN1661
 gi|19712888|gb|AAL93776.1| Hypothetical cytosolic protein [Fusobacterium nucleatum subsp.
           nucleatum ATCC 25586]
 gi|296153592|gb|EFG94409.1| glucose-1-phosphate adenylyltransferase [Fusobacterium nucleatum
           subsp. nucleatum ATCC 23726]
          Length = 249

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 156/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGGDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   +   D++  M  A+E+ A +V  +D  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGVITVKAEGIDADEFMMAALEAGAEDVTEDDGYFEVTTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N + +++ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEEAEISMIPENTVEITDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIL 245


>gi|288939914|ref|YP_003442154.1| hypothetical protein Alvin_0153 [Allochromatium vinosum DSM 180]
 gi|288895286|gb|ADC61122.1| protein of unknown function DUF28 [Allochromatium vinosum DSM 180]
          Length = 249

 Score =  186 bits (471), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/251 (40%), Positives = 155/251 (61%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +D  + K+++KL RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDKQRGKVWTKLIREVTVAAREGGGDPGANPRLRLAMDKAFGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP++ +ERAIK+ AG  +  NY  IRYEGYGP GVAI+++ ++DNRNRTAS +R  FTK 
Sbjct: 61  MPRDTVERAIKRGAGGTEGENYEEIRYEGYGPGGVAIMVDCMSDNRNRTASEVRHAFTKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G+LG+ GS +  F + G I +     + +  ME A+E+ A +V+  D   +       D
Sbjct: 121 GGNLGTDGSVSYLFTKQGIISFQPGTSE-DAVMEAALEAGAEDVVVNDDGSLDVVTTPED 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F  V   LT    + ++ E     + +     + L +A+  + ++K++E LED DDVQ V
Sbjct: 180 FAAVKEALTKAGFDTEVAE-----IGFNAATQVEL-DAETAEKLLKLVEMLEDLDDVQDV 233

Query: 234 YSNLEIADDII 244
           Y N +I+D+I+
Sbjct: 234 YHNADISDEIM 244


>gi|307545149|ref|YP_003897628.1| hypothetical protein HELO_2559 [Halomonas elongata DSM 2581]
 gi|307217173|emb|CBV42443.1| hypothetical protein HELO_2559 [Halomonas elongata DSM 2581]
          Length = 250

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 148/246 (60%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+TV+A+  G  P +NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIRELTVAARHGGGEPNDNPRLRAAIDKALANN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ I+RA+ + AG+ +  +   + YEGYGPEGVA+++EA+TDNRNRT S +R  F K 
Sbjct: 61  MTKDTIQRAVDRGAGNSEGDDMEEVVYEGYGPEGVAVMVEAMTDNRNRTVSEVRHAFNKQ 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+TGS    F + G +       +   AME  +E++  E+   ED         ++
Sbjct: 121 GGNLGTTGSVAFMFHRQGRLTLPEGATEE-AAMEATLEAEPEEIETLEDGRLEVVTSPDS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L E   E  +  V   P NY R+ + +  + IIK+++ LED DDVQ+VY+N +
Sbjct: 180 FGAVKDALVEAGLEPTASDVGLYPDNYARIEDVELGQRIIKLVDRLEDLDDVQNVYTNAD 239

Query: 239 IADDII 244
            AD I+
Sbjct: 240 FADAIM 245


>gi|262394696|ref|YP_003286550.1| hypothetical protein VEA_003925 [Vibrio sp. Ex25]
 gi|262338290|gb|ACY52085.1| hypothetical protein VEA_003925 [Vibrio sp. Ex25]
          Length = 248

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 149/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REI V+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIFTKLIREIVVAAKEGGGEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RA+ + AG +   N   + YEGYGP G A+++E +TDNRNRT S +R  F+K+
Sbjct: 61  MTRDTVNRAVSRGAGGEGDDNMETVIYEGYGPGGTAVMVECMTDNRNRTVSGVRHAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F++ G I Y   + D ++ MEVA+ES A ++   ED     Y   ++
Sbjct: 121 GGNLGTDGSVNYLFDKKGVISYAPGL-DEDVVMEVALESGADDIETSEDGSIDVYTAPSD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            GL    L+    EA++ +V   P     L + D    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGLVKDALDAAGFEAENAEVSLIPSTKAEL-DVDTAPKLLRLIDALEDLDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+DD+
Sbjct: 239 ISDDV 243


>gi|238919500|ref|YP_002933015.1| hypothetical protein NT01EI_1596 [Edwardsiella ictaluri 93-146]
 gi|259646443|sp|C5B9S9|Y1596_EDWI9 RecName: Full=UPF0082 protein NT01EI_1596
 gi|238869069|gb|ACR68780.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 248

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD GN   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDGNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  M+ A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFTKKGVISYAPGL-DEDAVMDAALEAGADDVVTYDDGAIDVYTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     + +AD    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGQVKDALDAAGLVAESAEVSMIPSTQADM-DADTAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|293608324|ref|ZP_06690627.1| hypothetical protein HMPREF0013_00452 [Acinetobacter sp. SH024]
 gi|292828897|gb|EFF87259.1| hypothetical protein HMPREF0013_00452 [Acinetobacter sp. SH024]
 gi|325121942|gb|ADY81465.1| hypothetical protein BDGL_000879 [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 249

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 151/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +AKL G +P  NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGGDPASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   + YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGEDNDDLKEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS +  F + GEI +  ++   +  MEVA+E+ A ++   + E +        
Sbjct: 121 NGNLGTAGSVSYLFTKRGEITFE-DVSLEDKIMEVALEAGAEDIEVSEDEILVITSPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+  ED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALTAAGLKSDNAEVVMSPSTKAEITDVDQAKQILKMIDMFEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +D+++
Sbjct: 240 SDEVL 244


>gi|237739913|ref|ZP_04570394.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
 gi|229423521|gb|EEO38568.1| conserved hypothetical protein [Fusobacterium sp. 2_1_31]
          Length = 249

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 162/250 (64%), Gaps = 11/250 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  F++ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIF-----YC 174
           +G+LG+ G+ +  F++ G I   S   D++  M  A+E+ A +V  E+ + +F     Y 
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKSEGIDTDEFMMAALEAGAEDV--EESDGVFEVTTEYT 178

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           +F  V    K    +  EA+ I +I  P N + +++ +  K ++ + + LED DD Q+VY
Sbjct: 179 EFQTVLENLKNAGYQYEEAE-ITMI--PENTVEITDLETAKKVMALYDALEDLDDSQNVY 235

Query: 235 SNLEIADDII 244
           SN +I+D+I+
Sbjct: 236 SNFDISDEIL 245


>gi|218439724|ref|YP_002378053.1| hypothetical protein PCC7424_2775 [Cyanothece sp. PCC 7424]
 gi|226701513|sp|B7K8I7|Y2775_CYAP7 RecName: Full=UPF0082 protein PCC7424_2775
 gi|218172452|gb|ACK71185.1| protein of unknown function DUF28 [Cyanothece sp. PCC 7424]
          Length = 255

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 102/251 (40%), Positives = 163/251 (64%), Gaps = 8/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA K K F++LSR I V+A+    +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAKKGKTFTQLSRAIIVAARNGLPDPAANLQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+  +D  N   IRYEGYGP GVAI+IEALTDNRNRTA+ +R+ F+
Sbjct: 61  IPNDNIERAIAKGAGTYGNDENNLEEIRYEGYGPGGVAILIEALTDNRNRTAADLRAAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIE--SDAFEVLFEDQEYI--FY 173
           K  G+LG TG  +  F+Q G +I    + +  + ++ ++E  +D +E+   D+E     +
Sbjct: 121 KNGGNLGETGCVSWMFDQKGVVILEGKV-EEEVLLDASVEGGADTYEIFDSDEEQGAEVF 179

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            + +N+   ++ L+EK    +  ++ W P N I +++ ++ +S++K+++ LE  DDVQ+V
Sbjct: 180 TEVSNLETLNQTLQEKGLPVKEAELRWIPNNSIEVTDPEQGRSLLKLMDALESLDDVQNV 239

Query: 234 YSNLEIADDII 244
            +N ++AD++I
Sbjct: 240 TANFDMADELI 250


>gi|199597322|ref|ZP_03210753.1| hypothetical protein LRH_05549 [Lactobacillus rhamnosus HN001]
 gi|258507981|ref|YP_003170732.1| hypothetical protein LGG_00986 [Lactobacillus rhamnosus GG]
 gi|258539235|ref|YP_003173734.1| hypothetical protein LC705_01044 [Lactobacillus rhamnosus Lc 705]
 gi|199591838|gb|EDY99913.1| hypothetical protein LRH_05549 [Lactobacillus rhamnosus HN001]
 gi|257147908|emb|CAR86881.1| Integrase [Lactobacillus rhamnosus GG]
 gi|257150911|emb|CAR89883.1| Integrase [Lactobacillus rhamnosus Lc 705]
 gi|259649308|dbj|BAI41470.1| conserved hypothetical protein [Lactobacillus rhamnosus GG]
          Length = 243

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 144/244 (59%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSRE+ ++AK  G +P  NP LRL +  AK  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKLSRELYMAAKQGGPDPSGNPSLRLVMDKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   D  NY  + YEGYGP GVAI++EALTDNRNRT+SS+R   T+  
Sbjct: 61  MPKDNIKRALDKASDRDAANYDEVTYEGYGPGGVAILVEALTDNRNRTSSSVRVAITRHG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G++ + G+ +  F++ G ++        D +  +E A+E+ A ++   D  Y  Y D   
Sbjct: 121 GNMAAAGAVSYMFDRKGYLVISREAYDVDEDQMLEDALEAGAEDMQTSDDAYEIYTDPKE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEEK  +    ++   P N   +   DKV+    MI+ LEDDDDVQ VY+  +
Sbjct: 181 FAQVRDALEEKGYKFVQNELTMVPQNLTPIPK-DKVEQFQAMIDQLEDDDDVQEVYTAGD 239

Query: 239 IADD 242
             DD
Sbjct: 240 WPDD 243


>gi|163857411|ref|YP_001631709.1| hypothetical protein Bpet3099 [Bordetella petrii DSM 12804]
 gi|226703704|sp|A9ITM2|Y3099_BORPD RecName: Full=UPF0082 protein Bpet3099
 gi|163261139|emb|CAP43441.1| conserved hypothetical protein [Bordetella petrii]
          Length = 243

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 146/239 (61%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGPDPDSNPRLRMAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG  D  NY  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIQRAIQRGAGGADGANYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     + ++ ME A+E+ A +V  +D+  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFVFAPGTAE-DVVMEAALEAGAEDVTTDDEGVIEVICAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                +  E    +A+   +I KP N   L+  D VK + K+++ LE  DDVQ VY+ +
Sbjct: 180 YAAVRQAFEAAGLKAEVEGIIMKPQNETELTGEDAVK-MQKLLDALEGLDDVQEVYTTV 237


>gi|58584927|ref|YP_198500.1| hypothetical protein Wbm0670 [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|67461872|sp|Q5GRW6|Y670_WOLTR RecName: Full=UPF0082 protein Wbm0670
 gi|58419243|gb|AAW71258.1| Uncharacterized conserved protein, YebC family [Wolbachia
           endosymbiont strain TRS of Brugia malayi]
          Length = 249

 Score =  185 bits (469), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 145/243 (59%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI +RK  +DA +S+ F+KL REITV+AK    +P  NPRLR A+  A+ ++
Sbjct: 1   MAGHSQFSNIKYRKGAQDAKRSQRFTKLIREITVAAKQGLPDPEFNPRLRSAVFAARKEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AIK A  +  G NY  I+YEG+GP G A+I+  LT+NRNR AS +R IF++ 
Sbjct: 61  LPKDRIETAIKNAAGNVAGENYEEIQYEGHGPFGTALIVHVLTNNRNRAASEVRYIFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
           NGSLG TGS +  F+ +G I+Y +   + +      IE +   V   + E  Y+  C   
Sbjct: 121 NGSLGETGSVSYLFDHVGLIVYKAESVNFDDLFSHGIELEVLNVEENNIEGLYVITCRVK 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G        K GE +  ++ W+P + I +S+   +  +  ++E LED+DDVQ V  N 
Sbjct: 181 DFGKVRNAFYAKFGEPELARLSWQPKDLIEISDKKLIDKLSALVEELEDNDDVQYVEGNF 240

Query: 238 EIA 240
             A
Sbjct: 241 AFA 243


>gi|229551834|ref|ZP_04440559.1| protein of hypothetical function DUF28 [Lactobacillus rhamnosus
           LMS2-1]
 gi|229314778|gb|EEN80751.1| protein of hypothetical function DUF28 [Lactobacillus rhamnosus
           LMS2-1]
          Length = 249

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 144/244 (59%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSRE+ ++AK  G +P  NP LRL +  AK  +
Sbjct: 7   MSGHSKWHNIQGRKNAQDAKRGKIFQKLSRELYMAAKQGGPDPSGNPSLRLVMDKAKAAN 66

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   D  NY  + YEGYGP GVAI++EALTDNRNRT+SS+R   T+  
Sbjct: 67  MPKDNIKRALDKASDRDAANYDEVTYEGYGPGGVAILVEALTDNRNRTSSSVRVAITRHG 126

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G++ + G+ +  F++ G ++        D +  +E A+E+ A ++   D  Y  Y D   
Sbjct: 127 GNMAAAGAVSYMFDRKGYLVISREAYDVDEDQMLEDALEAGAEDMQTSDDAYEIYTDPKE 186

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEEK  +    ++   P N   +   DKV+    MI+ LEDDDDVQ VY+  +
Sbjct: 187 FAQVRDALEEKGYKFVQNELTMVPQNLTPIPK-DKVEQFQAMIDQLEDDDDVQEVYTAGD 245

Query: 239 IADD 242
             DD
Sbjct: 246 WPDD 249


>gi|118497619|ref|YP_898669.1| hypothetical protein FTN_1028 [Francisella tularensis subsp.
           novicida U112]
 gi|195536320|ref|ZP_03079327.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
 gi|166228361|sp|A0Q6Q0|Y1028_FRATN RecName: Full=UPF0082 protein FTN_1028
 gi|118423525|gb|ABK89915.1| conserved protein of unknown function [Francisella novicida U112]
 gi|194372797|gb|EDX27508.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida FTE]
          Length = 248

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 105/246 (42%), Positives = 152/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D  +
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPYD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L +A+  + ++ +I+ LED DDVQSVYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DAETAEKVMALIDKLEDLDDVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|134302041|ref|YP_001122010.1| hypothetical protein FTW_1073 [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|166228141|sp|A4IY88|Y1073_FRATW RecName: Full=UPF0082 protein FTW_1073
 gi|134049818|gb|ABO46889.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 248

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 152/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHTFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L + +  + ++ +I+ LED DDVQSVYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DTETAEKVMALIDKLEDLDDVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|237743343|ref|ZP_04573824.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
 gi|229433122|gb|EEO43334.1| conserved hypothetical protein [Fusobacterium sp. 7_1]
          Length = 249

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 156/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGGDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS IR  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEIRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   +   D++  M  A+E+ A +V  +D  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKAEGIDADEFMMAALEAGAEDVEEDDGYFEVTTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N + +++ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEEAEISMIPENTVEITDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIL 245


>gi|34763880|ref|ZP_00144784.1| Hypothetical Cytosolic Protein [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
 gi|27886343|gb|EAA23614.1| Hypothetical Cytosolic Protein [Fusobacterium nucleatum subsp.
           vincentii ATCC 49256]
          Length = 249

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 159/249 (63%), Gaps = 9/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
           +G+LG+ G+ +  F++ G I   +   D++  M  A+E+ A E + ED  Y      Y +
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKAEGIDADEFMMAALEAGA-EDITEDDGYFEVTTEYTE 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V    K    +  EA+ I +I  P N + +++ +  K ++ + + LED DD Q+VYS
Sbjct: 180 FQTVLENLKNAGYQYEEAE-ISMI--PENTVEITDLETAKKVMALYDALEDLDDSQNVYS 236

Query: 236 NLEIADDII 244
           N +I D+I+
Sbjct: 237 NFDIPDEIL 245


>gi|237736713|ref|ZP_04567194.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
 gi|229420575|gb|EEO35622.1| conserved hypothetical protein [Fusobacterium mortiferum ATCC 9817]
          Length = 249

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 153/245 (62%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI +RK  +D  ++K+F+K  +E+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MAGHSKWANIQYRKGAQDKKRAKLFTKFGKELTIAAKEGGGDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++  +RYEGYGP G A I++ +TDN+NR+AS +R  FT+ 
Sbjct: 61  MPKDILERAIKKGTGELEGVDFIEMRYEGYGPVGTAFIVDVVTDNKNRSASELRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ G+    F++ G I   S   D++  M  A+E+ A +V  ED  +    D+   
Sbjct: 121 GGNLGTDGAVAWMFKKQGVITVKSEGIDADEFMMAALEAGAEDVSEEDGVFEVITDYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+      +  ++   P N +++++ D  K ++ + E L+D DDVQ VY+N +I
Sbjct: 181 QTVLENLKAAGYNYEEAEIAMNPENKVQITDLDTAKKVMALYEALDDLDDVQEVYANFDI 240

Query: 240 ADDII 244
           ADDI+
Sbjct: 241 ADDIL 245


>gi|269138788|ref|YP_003295489.1| hypothetical protein ETAE_1437 [Edwardsiella tarda EIB202]
 gi|267984449|gb|ACY84278.1| hypothetical protein ETAE_1437 [Edwardsiella tarda EIB202]
 gi|304558780|gb|ADM41444.1| hypothetical protein ETAF_1332 [Edwardsiella tarda FL6-60]
          Length = 264

 Score =  184 bits (468), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 17  MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 76

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD GN   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 77  MTRDTLNRAIARGVGGDDDGNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKC 136

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  M+ A+E+ A +V+ ++D     Y  +  
Sbjct: 137 GGNLGTDGSVAYLFTKKGVISYAPGL-DEDAVMDAALEAGADDVVTYDDGAIDVYTPWET 195

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     + +AD    ++++I+ LED DDVQ VY N E
Sbjct: 196 FGQVKDALDAAGLVAESAEVSMIPSTQADM-DADTAPKLLRLIDMLEDCDDVQEVYHNGE 254

Query: 239 IADDI 243
           I+D++
Sbjct: 255 ISDEV 259


>gi|77919929|ref|YP_357744.1| hypothetical protein Pcar_2335 [Pelobacter carbinolicus DSM 2380]
 gi|119391302|sp|Q3A233|Y2335_PELCD RecName: Full=UPF0082 protein Pcar_2335
 gi|77546012|gb|ABA89574.1| conserved hypothetical protein TIGR01033 [Pelobacter carbinolicus
           DSM 2380]
          Length = 248

 Score =  184 bits (467), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 112/246 (45%), Positives = 154/246 (62%), Gaps = 9/246 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL +EITV+AK+ G +   N RLRLA+  AK  +
Sbjct: 1   MAGHSKWANIKHRKGAQDAKRGKIFTKLIKEITVAAKIGGGDLEANARLRLAVDKAKQAN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK   D D   Y    +EGYGP GVA+I+E +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIERAIKKGTGDLDGVTYEEGTFEGYGPGGVAVIVEFMTDNRTRTVADVRHSFNKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFED--QEYIFY-CDF 176
            GSLG +GS    F++ G+II+  N  D     EVA+E+ A +V  ED   E I    DF
Sbjct: 121 GGSLGVSGSVAFMFDRKGQIIFGEN-SDFEKIFEVALEAGAEDVNDEDGVTEVITAPADF 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
             V  T   L E+    +S +V   P N   +    + +S++KMI+ LED+DDVQ+V++N
Sbjct: 180 ETVRNT---LAEQGLTPESAEVTMIPQNMTAVE-GKQAESLMKMIDMLEDNDDVQNVFAN 235

Query: 237 LEIADD 242
            +I+D+
Sbjct: 236 FDISDE 241


>gi|218780798|ref|YP_002432116.1| hypothetical protein Dalk_2958 [Desulfatibacillum alkenivorans
           AK-01]
 gi|226701573|sp|B8FL13|Y2958_DESAA RecName: Full=UPF0082 protein Dalk_2958
 gi|218762182|gb|ACL04648.1| protein of unknown function DUF28 [Desulfatibacillum alkenivorans
           AK-01]
          Length = 247

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 155/254 (61%), Gaps = 20/254 (7%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I H+K   DA + K+FSKL +EIT++A++ G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHNKWSTIKHKKGAADAKRGKVFSKLIKEITIAARMGGGDPDANPRLRTAINAAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N ERAIKK   +  G NY   +YEGYGP G A+++E+LTDN+NR A+ IR IF+K 
Sbjct: 61  MPKDNWERAIKKGTGELEGVNYEEFQYEGYGPGGGAVLVESLTDNKNRAAAEIRHIFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIES---------DAFEVLFEDQEY 170
            GSLG  G     F++ G I+ + ++ D +  ME+A+E+         D FEV+ +  +Y
Sbjct: 121 GGSLGEAGCVAWMFDKKGYIVVNQSVTDEDTLMEIALEAGAEDVREAGDVFEVITQPDDY 180

Query: 171 IFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDV 230
               D     + +  +     E +   V   P N + ++  +  + ++++++ L+D DDV
Sbjct: 181 ----DAVKEAIDAAGI-----ETEDASVTKLPQNTVEVTGKE-AEQMVRLLQTLDDCDDV 230

Query: 231 QSVYSNLEIADDII 244
           Q+VY++ +I DD I
Sbjct: 231 QNVYTSADIPDDAI 244


>gi|262066092|ref|ZP_06025704.1| glucose-1-phosphate adenylyltransferase [Fusobacterium
           periodonticum ATCC 33693]
 gi|291380187|gb|EFE87705.1| glucose-1-phosphate adenylyltransferase [Fusobacterium
           periodonticum ATCC 33693]
          Length = 249

 Score =  184 bits (467), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 156/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  F++ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   S   D++  M  A+E+ A +V   D  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKSEGIDTDEFMMAALEAGAEDVEETDGVFEVTTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N + +++ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEDAEITMIPENTVEITDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
           +D+I+
Sbjct: 241 SDEIL 245


>gi|254303430|ref|ZP_04970788.1| hypothetical protein FNP_1082 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
 gi|148323622|gb|EDK88872.1| hypothetical protein FNP_1082 [Fusobacterium nucleatum subsp.
           polymorphum ATCC 10953]
          Length = 249

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 157/245 (64%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  F++ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   +   D++  M  A+E+ A +V  E+  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKAEGIDTDEFMMAALEAGAEDVTEEEGYFEVTTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N +++++ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEEAEISMIPENTVQITDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIL 245


>gi|323706509|ref|ZP_08118068.1| protein of unknown function DUF28 [Thermoanaerobacterium
           xylanolyticum LX-11]
 gi|323534139|gb|EGB23931.1| protein of unknown function DUF28 [Thermoanaerobacterium
           xylanolyticum LX-11]
          Length = 244

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 110/246 (44%), Positives = 155/246 (63%), Gaps = 8/246 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE+ DA K KIF+KL+++I ++AK  G +P  N +LR AI+ AK  +
Sbjct: 1   MSGHSKWANIKHKKEKMDAQKGKIFTKLTKDIIMAAK-EGGDPETNSKLRDAIEKAKANN 59

Query: 61  MPKENIERAIKKAGSDDL--GNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENI+RAIKK G+ +L  GN   + YEGYGP G AII+EALTDN+NRTA  IR IF +
Sbjct: 60  LPNENIQRAIKK-GTGELSGGNLEEVVYEGYGPAGSAIIVEALTDNKNRTAGDIRHIFDR 118

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYH--SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
           + GSLGSTG     F++ G I      NI +  LAM VAI++ A +   +  EY    D 
Sbjct: 119 SGGSLGSTGCVAWMFDKKGIITVEKSDNIDEDELAM-VAIDAGADDFSSDGDEYEILTDP 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           +N       + +      S ++   P N ++LS++D  K   K IE LE++DDVQ VY N
Sbjct: 178 SNFQAVKDAINKAGYVMSSAEITMIPQNRVKLSDSDYEK-FEKFIEKLEENDDVQEVYHN 236

Query: 237 LEIADD 242
           +++ DD
Sbjct: 237 VDMPDD 242


>gi|195952876|ref|YP_002121166.1| protein of unknown function DUF28 [Hydrogenobaculum sp. Y04AAS1]
 gi|226707647|sp|B4U7S7|Y501_HYDS0 RecName: Full=UPF0082 protein HY04AAS1_0501
 gi|195932488|gb|ACG57188.1| protein of unknown function DUF28 [Hydrogenobaculum sp. Y04AAS1]
          Length = 249

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 142/245 (57%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + DA K K+F KL REITV+ KL G +P  NPRLR+AI+ A+  S
Sbjct: 1   MAGHSHWAQIKHKKAKVDAQKGKLFGKLIREITVATKLGGPDPNANPRLRIAIEAARKVS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + IE+AIK+  G+D  G    I YEGYGP G AI++   TDNRN+  S +R  F+K 
Sbjct: 61  MPMDTIEKAIKRGTGNDKEGALEEIVYEGYGPGGTAIMVVVATDNRNKATSEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LGS+G  +  FEQ G I       D    ME A+E+ A +V   +  +I Y +  +V
Sbjct: 121 GGNLGSSGCVSYLFEQKGVIEIPKEATDEEKLMEAALEAGADDVESTEDMFIVYTNPKDV 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L  K    +S K    P   + + + D  K ++ ++E+L++ D+VQ V SN EI
Sbjct: 181 YTIKDILASKGFTIESAKTSLIPTTTVEIKDVDTAKKLLNLLEHLDELDEVQEVISNFEI 240

Query: 240 ADDII 244
             DI+
Sbjct: 241 DKDIL 245


>gi|332184198|gb|AEE26452.1| hypothetical protein FN3523_1149 [Francisella cf. novicida 3523]
          Length = 248

 Score =  184 bits (466), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 151/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K  G D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGVGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L + +  + ++ +I+ LED DDVQSVYSN  
Sbjct: 180 FSDIQEALIEKGFNSENAEVTFDAETKAEL-DTETAEKVMALIDKLEDLDDVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|290967722|ref|ZP_06559277.1| DNA-binding regulatory protein, YebC/PmpR family [Megasphaera
           genomosp. type_1 str. 28L]
 gi|290782238|gb|EFD94811.1| DNA-binding regulatory protein, YebC/PmpR family [Megasphaera
           genomosp. type_1 str. 28L]
          Length = 241

 Score =  183 bits (465), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 147/240 (61%), Gaps = 2/240 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +K + DA+++KI +K+ REIT++ ++ G +P+ N RL+LA+Q AK  +
Sbjct: 1   MSGHSKWANIKRKKGKNDAIRAKITTKIGREITIAVRMGGADPVGNMRLKLALQKAKENN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PKENI+RAI+K AG+ +  NY  I YEGYGP GVA+ +  LTDNRNRTA+ +R +F+K 
Sbjct: 61  IPKENIKRAIQKGAGATEGQNYEEIVYEGYGPAGVAVTVNVLTDNRNRTAADVRHVFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
             S+G TG     F   G  I    + D +  ME+A+++ A +V   D+E+       N 
Sbjct: 121 GSSMGETGCVGWMFHSKGIFIVDKAVTDEDTVMELALDAGADDVKTGDEEFEIITAPENF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               K L E     +  ++   P N I+L NA+  + +  +I+ LED DDVQ VY N + 
Sbjct: 181 DSVEKALAEHNIATEHAQITMVPDNLIKL-NAEDAEKMETLIDALEDLDDVQDVYHNWDC 239


>gi|237742690|ref|ZP_04573171.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|294784785|ref|ZP_06750073.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
 gi|229430338|gb|EEO40550.1| conserved hypothetical protein [Fusobacterium sp. 4_1_13]
 gi|294486499|gb|EFG33861.1| conserved hypothetical protein [Fusobacterium sp. 3_1_27]
          Length = 249

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 159/249 (63%), Gaps = 9/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T ++YEGYGP G A I+EA+TDN+NRTAS +R  FT+ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMKYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFTRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
           +G+LG+ G+ +  F++ G I   +   D++  M  A+E+ A E + ED  Y      Y +
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKAEGIDADEFMMAALEAGA-EDITEDDGYFEVTTEYTE 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V    K    +  EA+ I +I  P N + +++ +  K ++ + + LED DD Q+VYS
Sbjct: 180 FQTVLENLKNAGYQYEEAE-ISMI--PENTVEITDLETAKKVMALYDALEDLDDSQNVYS 236

Query: 236 NLEIADDII 244
           N +I D+I+
Sbjct: 237 NFDIPDEIL 245


>gi|270290945|ref|ZP_06197168.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|304385212|ref|ZP_07367557.1| glucose-1-phosphate adenylyltransferase [Pediococcus acidilactici
           DSM 20284]
 gi|270280341|gb|EFA26176.1| conserved hypothetical protein [Pediococcus acidilactici 7_4]
 gi|304328419|gb|EFL95640.1| glucose-1-phosphate adenylyltransferase [Pediococcus acidilactici
           DSM 20284]
          Length = 245

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 143/244 (58%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF ++SREI V+ K  G +P  NP+LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQRISREIYVAVKAGGPDPSANPQLRLMMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI K       NY  I YEGYGP G AII+ ALTDN+NRTA+++RS FT   
Sbjct: 61  MPKDNIKRAIDKGSGTGGANYEEITYEGYGPAGTAIIVSALTDNKNRTAAAVRSAFTHHG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           GSLG+TGS +  F++ G I+        D +  ME AIE+ A +V   D+ +  Y D   
Sbjct: 121 GSLGATGSVSYMFDRKGYIVIKREGLDKDEDQMMEDAIEAGADDVQTSDEVFEIYTDPKE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE K  +  + ++   P    ++  ADKVK    +I+ LE++DDV  VY    
Sbjct: 181 FAAVRDALEAKGYDLANAELTMIPETETQVP-ADKVKQYTGLIDELENNDDVSEVYEAAV 239

Query: 239 IADD 242
           + DD
Sbjct: 240 LPDD 243


>gi|52081262|ref|YP_080053.1| hypothetical protein BL01150 [Bacillus licheniformis ATCC 14580]
 gi|52786641|ref|YP_092470.1| hypothetical protein BLi02909 [Bacillus licheniformis ATCC 14580]
 gi|319644772|ref|ZP_07999005.1| hypothetical protein HMPREF1012_00038 [Bacillus sp. BT1B_CT2]
 gi|67462036|sp|Q65GN7|Y2909_BACLD RecName: Full=UPF0082 protein BLi02909/BL01150
 gi|52004473|gb|AAU24415.1| conserved protein YrbC [Bacillus licheniformis ATCC 14580]
 gi|52349143|gb|AAU41777.1| YrbC [Bacillus licheniformis ATCC 14580]
 gi|317392581|gb|EFV73375.1| hypothetical protein HMPREF1012_00038 [Bacillus sp. BT1B_CT2]
          Length = 240

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 150/241 (62%), Gaps = 6/241 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + KIF KL++EI V+AK  G +P  N  LRL I  AKN +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKIFMKLAKEIYVAAKEGGPDPESNASLRLVIDKAKNAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKKA GS D  +Y  I YEGYGP GVA++++ LTDN+NRTA+S+R+ F+K 
Sbjct: 61  MPNDNIDRAIKKASGSQDGKSYEEITYEGYGPSGVAVMVKCLTDNKNRTATSVRTAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHS---NIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            GSLG TG  +  F++ G I        I +    +EV I++ A E+   ++ +  Y + 
Sbjct: 121 GGSLGETGCVSYMFDRKGYIAIEREDLEIDEEEFMLEV-IDAGAEELETSEELFEIYTEP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  K LEE+  +  + ++   P  Y  +  A + K + K+I+ LEDDDDVQ VY+N
Sbjct: 180 EQFEEVKKSLEERGYKLATSEITMVPQTYAEVDEALQEK-VEKLIDVLEDDDDVQEVYTN 238

Query: 237 L 237
           +
Sbjct: 239 V 239


>gi|56707777|ref|YP_169673.1| hypothetical protein FTT_0655 [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110670248|ref|YP_666805.1| hypothetical protein FTF0655 [Francisella tularensis subsp.
           tularensis FSC198]
 gi|224456848|ref|ZP_03665321.1| hypothetical protein FtultM_03574 [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|254370276|ref|ZP_04986281.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254874589|ref|ZP_05247299.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|67461900|sp|Q5NH19|Y655_FRATT RecName: Full=UPF0082 protein FTT_0655
 gi|118574389|sp|Q14IH1|Y655_FRAT1 RecName: Full=UPF0082 protein FTF0655
 gi|54113927|gb|AAV29597.1| NT02FT1046 [synthetic construct]
 gi|56604269|emb|CAG45288.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis SCHU S4]
 gi|110320581|emb|CAL08671.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC198]
 gi|151568519|gb|EDN34173.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis FSC033]
 gi|254840588|gb|EET19024.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|282158949|gb|ADA78340.1| hypothetical protein NE061598_03750 [Francisella tularensis subsp.
           tularensis NE061598]
          Length = 248

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 152/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L + +  + ++ +I+ LED DDVQ+VYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DTETAEKVMALIDKLEDLDDVQNVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|294782999|ref|ZP_06748323.1| glucose-1-phosphate adenylyltransferase [Fusobacterium sp.
           1_1_41FAA]
 gi|294479877|gb|EFG27654.1| glucose-1-phosphate adenylyltransferase [Fusobacterium sp.
           1_1_41FAA]
          Length = 249

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 155/245 (63%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +D  ++K+F+K  RE+T++AK  G +P  NPRLRLAI+ AK  +
Sbjct: 1   MSGHSKWNNIQHRKGAQDKKRAKLFTKFGRELTIAAKEGGSDPNFNPRLRLAIEKAKAGN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ERAIKK   +  G ++T +RYEGYGP G A I+EA+TDN+NRTAS +R  F++ 
Sbjct: 61  MPKDILERAIKKGSGELEGVDFTEMRYEGYGPAGTAFIVEAVTDNKNRTASEMRMTFSRK 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ G+ +  F++ G I   S   D +  M  A+E+ A +V   D  +    ++   
Sbjct: 121 DGNLGADGAVSWMFKKKGIITVKSEGIDMDEFMMAALEAGAEDVEENDGVFEVTTEYTEF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+    + +  ++   P N + +++ +  K ++ + + LED DD Q+VYSN +I
Sbjct: 181 QTVLENLKNAGYQYEDAEITMIPENTVEITDLETAKKVMALYDALEDLDDSQNVYSNFDI 240

Query: 240 ADDII 244
           +D+I+
Sbjct: 241 SDEIL 245


>gi|291544519|emb|CBL17628.1| conserved hypothetical protein TIGR01033 [Ruminococcus sp. 18P13]
          Length = 243

 Score =  183 bits (464), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 148/248 (59%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +KE  DA K KIF+K+ REI V  K SG +P  N +LR  I  AK  +
Sbjct: 1   MSGHSKWNNIKRKKEATDAAKGKIFTKIGREIMVCVKESGPDPNSNSKLRDLIAKAKANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NI+R IKKA G DD  +Y ++ YEGYGP GVA+I+E LTDN+NRTA  +R  F K 
Sbjct: 61  VPNDNIDRVIKKAAGGDDKNSYESMVYEGYGPNGVAVIVECLTDNKNRTAGDVRHYFDKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++G  +  F Q G +I  +   D +  ME  ++    +  F++      C  +++
Sbjct: 121 GGNLGTSGCVSFMFSQKGVVILENTGLDEDTVMEDCMDCGGDDFSFDEDTVEITCAPSDL 180

Query: 180 -----GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
                GLT+K  +    E + I     P  Y  L++ D++K +  ++ENLED DDVQ+VY
Sbjct: 181 HALREGLTAKGYKVLSAEVEQI-----PSTYTTLTDEDQIKKMNLLLENLEDHDDVQNVY 235

Query: 235 SNLEIADD 242
            N E+ ++
Sbjct: 236 HNWEMPEE 243


>gi|187931872|ref|YP_001891857.1| hypothetical protein FTM_1203 [Francisella tularensis subsp.
           mediasiatica FSC147]
 gi|226696271|sp|B2SH70|Y1203_FRATM RecName: Full=UPF0082 protein FTM_1203
 gi|187712781|gb|ACD31078.1| conserved hypothetical protein [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 248

 Score =  182 bits (463), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 151/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+   +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGVEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L + +  + ++ +I+ LED DDVQSVYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DTETAEKVMALIDKLEDLDDVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|127513006|ref|YP_001094203.1| hypothetical protein Shew_2078 [Shewanella loihica PV-4]
 gi|126638301|gb|ABO23944.1| protein of unknown function DUF28 [Shewanella loihica PV-4]
          Length = 248

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 150/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  D      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELDGQVLETIMYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    FE+ G +I ++   D +  M+ A+++ A +V+  D   I  Y     
Sbjct: 121 GGNLGTDGSVAYLFEKRG-VISYAEGSDEDTIMDAALDAGAEDVVTNDDTSIDVYTTPEA 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A + +V   P     L +A+     +++I+NLED DDVQ VY N E
Sbjct: 180 FGTVKDALDAAGLDAVNAEVTMVPSTKAEL-DAETAPKFLRLIDNLEDHDDVQEVYHNAE 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIL 244


>gi|222099181|ref|YP_002533749.1| hypothetical protein CTN_0207 [Thermotoga neapolitana DSM 4359]
 gi|221571571|gb|ACM22383.1| Hypothetical Protein CTN_0207 [Thermotoga neapolitana DSM 4359]
          Length = 254

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 151/243 (62%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA KSKIF+KL REI V+A+  G NP  NPRLR AI+ A+ ++
Sbjct: 2   MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNPETNPRLRAAIERARAEN 61

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIE+AIK+   +  G +Y  + YEGY P GVA+ I ALTDN+NRTA  +R +F+K 
Sbjct: 62  MPKENIEKAIKRGTGELEGVDYQEVVYEGYAPGGVAVYIRALTDNKNRTAQELRHLFSKH 121

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS +  FE+ G I I    + D    M +AI++ A ++   +          +
Sbjct: 122 GGSLAESGSVSWIFERKGVIEIAKDKVKDLEELMMLAIDAGAEDIKDTEDPIQIITAPED 181

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    ++LEE  G     KV + P N +R++  D  K +++++  LED DDVQ VYSN E
Sbjct: 182 LSEVKRQLEEA-GYEVDAKVTFIPKNTVRVTGKDAEK-VLELLNALEDMDDVQEVYSNFE 239

Query: 239 IAD 241
           + D
Sbjct: 240 MDD 242


>gi|77163675|ref|YP_342200.1| hypothetical protein Noc_0137 [Nitrosococcus oceani ATCC 19707]
 gi|254435466|ref|ZP_05048973.1| conserved hypothetical protein TIGR01033 [Nitrosococcus oceani
           AFC27]
 gi|119391262|sp|Q3JES6|Y137_NITOC RecName: Full=UPF0082 protein Noc_0137
 gi|76881989|gb|ABA56670.1| Protein of unknown function DUF28 [Nitrosococcus oceani ATCC 19707]
 gi|207088577|gb|EDZ65849.1| conserved hypothetical protein TIGR01033 [Nitrosococcus oceani
           AFC27]
          Length = 248

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 154/246 (62%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI +RK  +DA + K+F++L REITV+A+L G +P  +PRLR AI  A   +
Sbjct: 1   MAGHSKWANIQYRKGAQDAKRGKLFTRLIREITVAARLEGGDPATSPRLRTAIDKAFAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIK+   D  G  Y  +RYEGYGP GVA++++ +TDNRNRT + IR +F+K 
Sbjct: 61  MPKDNIERAIKRGTGDLEGVAYEEVRYEGYGPYGVAVMVDCMTDNRNRTVAEIRHVFSKW 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F + G II +S   + +  MEVAIE  A +V+  ED     + +   
Sbjct: 121 GGNLGTDGSVAYLFSKKG-IISYSKESNEDAIMEVAIEGGAEDVVTNEDSSIDVFTEPEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                K L+E   +A+  ++       + L+  ++ + ++  ++ LE+ DDVQ VYSN +
Sbjct: 180 FSTVKKALDEAGLKAEQAEITQHASTSVSLA-LEEARKMLDFLDALEELDDVQQVYSNAD 238

Query: 239 IADDII 244
            +++I+
Sbjct: 239 FSEEIL 244


>gi|21730736|pdb|1LFP|A Chain A, Crystal Structure Of A Conserved Hypothetical Protein
           Aq1575 From Aquifex Aeolicus
          Length = 249

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 151/245 (61%), Gaps = 3/245 (1%)

Query: 2   AGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQSM 61
           AGHS +  I H+K + DA + K+FSKL REI V+ +L G NP  NPRLR AI+ AK  + 
Sbjct: 2   AGHSHWAQIKHKKAKVDAQRGKLFSKLIREIIVATRLGGPNPEFNPRLRTAIEQAKKANX 61

Query: 62  PKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           P ENIERAIKK AG  +   +  + YEGY P GVA+ + A TDNRNRT S +R +FTK  
Sbjct: 62  PWENIERAIKKGAGELEGEQFEEVIYEGYAPGGVAVXVLATTDNRNRTTSEVRHVFTKHG 121

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           G+LG++G  +  FE+ G I +    + +  L +E AIE  A +V   ++ +I Y     +
Sbjct: 122 GNLGASGCVSYLFERKGYIEVPAKEVSEEEL-LEKAIEVGAEDVQPGEEVHIIYTVPEEL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + LE+     +  ++ WKP++ +++++ +  + +IK++  LE+ DDVQ V +N EI
Sbjct: 181 YEVKENLEKLGVPIEKAQITWKPISTVQINDEETAQKVIKLLNALEELDDVQQVIANFEI 240

Query: 240 ADDII 244
            ++I+
Sbjct: 241 PEEIL 245


>gi|331084959|ref|ZP_08334046.1| hypothetical protein HMPREF0987_00349 [Lachnospiraceae bacterium
           9_1_43BFAA]
 gi|330408659|gb|EGG88124.1| hypothetical protein HMPREF0987_00349 [Lachnospiraceae bacterium
           9_1_43BFAA]
          Length = 243

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 154/245 (62%), Gaps = 10/245 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSG-QNPLENPRLRLAIQNAKNQ 59
           M+GHS+F NI H+KE+ DA K KIF+K+ RE+ V+ K  G  +P  N RLR  I  AK  
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTKIGRELAVAVKEGGGPDPANNSRLRDVIAKAKAN 60

Query: 60  SMPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +MP +NI+R+IKKA G     NY +I YEGYGP G AII++ALTDN+NRTAS++R+ FTK
Sbjct: 61  NMPNDNIDRSIKKAAGEGSADNYEHITYEGYGPNGTAIIVKALTDNKNRTASNVRNAFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYC-- 174
            +G++G+ G  +  F++ G+II        DS+  M +A+++ A + + E+  Y      
Sbjct: 121 GSGNVGTPGCVSFMFDEKGQIIIAKEDCDMDSDELMMLALDAGAEDFVEEEDSYEVLTVP 180

Query: 175 -DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            DF+ V L   KLEE      + +V   P  ++ L++   +K+I K ++ LE+DDDVQ V
Sbjct: 181 EDFSEVRL---KLEEAGIPMANAEVTMIPQTWVELTDEQDLKNIQKTLDLLEEDDDVQEV 237

Query: 234 YSNLE 238
           Y N +
Sbjct: 238 YHNWD 242


>gi|117923793|ref|YP_864410.1| hypothetical protein Mmc1_0479 [Magnetococcus sp. MC-1]
 gi|166227286|sp|A0L4W1|Y479_MAGSM RecName: Full=UPF0082 protein Mmc1_0479
 gi|117607549|gb|ABK43004.1| protein of unknown function DUF28 [Magnetococcus sp. MC-1]
          Length = 250

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 93/246 (37%), Positives = 157/246 (63%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF++L +EITVSA++ G +   NPRLR AI  A+ Q+
Sbjct: 1   MAGHSKWANIKHRKGAQDAKRGKIFTRLIKEITVSARMGGGDAATNPRLRSAITAARAQN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ +++AIK+   +  G NY  +R+EGYGP GVAII++ LTDN NRT + +R IF K 
Sbjct: 61  LPKDTMDKAIKRGTGELEGVNYEEVRFEGYGPGGVAIIVDCLTDNNNRTVADVRHIFNKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G+ G     F++ G+I++ +   + +  +E A+E+ A +V+ E   +    D N+ 
Sbjct: 121 GGNMGTHGCVAFMFDKKGQIMFDAEGINEDAIIEAALEAGAEDVVHEGDSFEVLTDPNDF 180

Query: 180 GLTSKKLEEK-IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               + L           +V+ +P N  +L +  +  +++K+ E LE+++DVQ++Y+N +
Sbjct: 181 SDVLEALATAGFATPSEAEVVMRPQNLQQL-DEQQASTMLKLYEKLEENEDVQNIYANFD 239

Query: 239 IADDII 244
           I+D+I+
Sbjct: 240 ISDEIM 245


>gi|189502034|ref|YP_001957751.1| hypothetical protein Aasi_0624 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|226707974|sp|B3ES20|Y624_AMOA5 RecName: Full=UPF0082 protein Aasi_0624
 gi|189497475|gb|ACE06022.1| hypothetical protein Aasi_0624 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 244

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 146/241 (60%), Gaps = 6/241 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK   DA K+K F KL REIT + K SG +   NPRLRLAIQNAK  +
Sbjct: 1   MAGHSKWANIKHRKGANDAKKAKYFGKLIREITAAVKQSGNDIEVNPRLRLAIQNAKGAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPKENI+RAI K  + D  ++T++ YEG    GVA+I+E  TDN NRT +++R+ F+K  
Sbjct: 61  MPKENIDRAINKGSTADTADFTSVVYEGNASHGVALIVECTTDNLNRTVANVRAAFSKHG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFY---CDF 176
           GSLG  GS +  F++ G   I  +++ D        IE+ A E +  DQE  +Y      
Sbjct: 121 GSLGKNGSVSFLFDRKGTFSINAADVKDEEALTLALIEAGA-EAIEHDQEEGYYHIISSL 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            + G   K+L+    E  S  + + P N + L N + +  ++K+IE LED+DDVQ VY N
Sbjct: 180 EDFGSVQKELDNLHLEPVSASLQYIPQNQVEL-NEETLSKVMKLIEALEDNDDVQKVYHN 238

Query: 237 L 237
           +
Sbjct: 239 I 239


>gi|62257419|gb|AAX77715.1| unknown protein [synthetic construct]
          Length = 283

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 152/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 27  MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 86

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERA+ K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 87  MSKDTIERAVVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 146

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 147 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPHD 205

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L + +  + ++ +I+ LED DDVQ+VYSN  
Sbjct: 206 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DTETAEKVMALIDKLEDLDDVQNVYSNAN 264

Query: 239 IADDII 244
              ++I
Sbjct: 265 FTQELI 270


>gi|282883309|ref|ZP_06291903.1| DNA-binding regulatory protein, YebC/PmpR family [Peptoniphilus
           lacrimalis 315-B]
 gi|300813878|ref|ZP_07094183.1| DNA-binding regulatory protein, YebC/PmpR family [Peptoniphilus sp.
           oral taxon 836 str. F0141]
 gi|281296813|gb|EFA89315.1| DNA-binding regulatory protein, YebC/PmpR family [Peptoniphilus
           lacrimalis 315-B]
 gi|300512065|gb|EFK39260.1| DNA-binding regulatory protein, YebC/PmpR family [Peptoniphilus sp.
           oral taxon 836 str. F0141]
          Length = 243

 Score =  182 bits (462), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 109/252 (43%), Positives = 157/252 (62%), Gaps = 20/252 (7%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI ++K ++DA K K+F+KL+R ITV+ +  G NP  NP+L++AI  AK ++
Sbjct: 1   MSGHSKWNNIKNKKGKEDARKGKVFTKLARLITVATRQGGANPDFNPQLKVAIDKAKAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NIERAIKK AG DD  N+  I YEGYGP G+A++++ LTDNRNRTA  IR IF K 
Sbjct: 61  LPNDNIERAIKKGAGEDDSSNFETITYEGYGPSGIAVMVKCLTDNRNRTAPDIRHIFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGD------SNL---AMEVAIESDAFEVLFEDQE 169
            G+LG+ G  +  F++ G I I  S+  D      S L   A +V    DA E++   + 
Sbjct: 121 GGNLGTPGCVSFMFQEKGIIGILKSDDMDLDEFILSALDYGAEDVVDRGDAVEIVTVPES 180

Query: 170 YIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDD 229
           Y      ++V    KKLEE   E     + +   NY +LS+ D +K + K+I+ LED+DD
Sbjct: 181 Y------HDV---RKKLEEDGYEFVESDITFVAQNYSKLSDEDDIKKMDKLIDALEDNDD 231

Query: 230 VQSVYSNLEIAD 241
           VQ VY+N +  D
Sbjct: 232 VQDVYTNWDQED 243


>gi|206889587|ref|YP_002249658.1| hypothetical protein THEYE_A1868 [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|226696157|sp|B5YHS2|Y1868_THEYD RecName: Full=UPF0082 protein THEYE_A1868
 gi|206741525|gb|ACI20582.1| conserved hypothetical protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 251

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 104/245 (42%), Positives = 154/245 (62%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++  I H+K + DA K KIF+KL +EI+V+A+L G +P +NPRLR+AI+ A+  +
Sbjct: 1   MAGHSKWAQIKHKKAQVDAKKGKIFTKLVKEISVAARLGGGDPEKNPRLRVAIEKAREVN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAI K   +  G  Y  + YEGYGP GVAI+IEA+TDN+NRT S IR + +K 
Sbjct: 61  MPMDNIKRAIMKGTGELAGTTYEEVIYEGYGPGGVAILIEAMTDNKNRTVSEIRHLLSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG +G  +  FE+ G I+      D +  + VA+E+   +V  + +E  +    +  
Sbjct: 121 GGSLGESGCVSWIFEKKGYILVDKKTIDEDTLISVALEAGVEDVKNDPKEENYEIIVSPE 180

Query: 180 GLTS-KKLEEKIGEAQSI-KVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
            L   K + EK G   S  +V   P NYI +   D  K ++K+++ LED DDVQ+VY+N 
Sbjct: 181 QLNQVKTIIEKAGIPVSFAQVTMLPKNYISIEGEDAEK-MLKLMDALEDHDDVQNVYANF 239

Query: 238 EIADD 242
           +I ++
Sbjct: 240 DIPEE 244


>gi|212638553|ref|YP_002315073.1| hypothetical protein Aflv_0709 [Anoxybacillus flavithermus WK1]
 gi|226708032|sp|B7GFM4|Y709_ANOFW RecName: Full=UPF0082 protein Aflv_0709
 gi|212560033|gb|ACJ33088.1| Uncharacterized conserved protein [Anoxybacillus flavithermus WK1]
          Length = 245

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 152/242 (62%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + K+F KL++EI V+AK+ G +P  N  LRLAI+ AK+ +
Sbjct: 1   MAGHSKWKNIQRRKNAQDAKRGKLFMKLAKEIYVAAKMGGGDPTTNATLRLAIEKAKSAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENIERAIKKA G+ +  +Y  IRYEGYGP GVA+++  LTDN+NRTAS++R  F+K 
Sbjct: 61  MPNENIERAIKKATGNQEHTHYEEIRYEGYGPGGVAVMVICLTDNKNRTASNVRVAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY---HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            G+LG TG  +  F++ G I+    + +I + ++ ++ AIE+ A E+   +  +  Y   
Sbjct: 121 GGNLGETGCVSYLFDRKGLIVIARENLHIDEDDMLLQ-AIEAGADEMETTEDSFEIYTSP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                    L  +     + ++   P  Y  L+  D  K ++K+I+ LEDDDDVQ +Y N
Sbjct: 180 EQFEQVKNTLAAQGFTFATAEITMIPQTYTTLTGDDLTK-MLKLIDMLEDDDDVQEIYHN 238

Query: 237 LE 238
           L+
Sbjct: 239 LD 240


>gi|194335779|ref|YP_002017573.1| protein of unknown function DUF28 [Pelodictyon phaeoclathratiforme
           BU-1]
 gi|226707997|sp|B4SDW5|Y657_PELPB RecName: Full=UPF0082 protein Ppha_0657
 gi|194308256|gb|ACF42956.1| protein of unknown function DUF28 [Pelodictyon phaeoclathratiforme
           BU-1]
          Length = 250

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 153/245 (62%), Gaps = 7/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A++ S
Sbjct: 1   MSGHSKWATIKRKKAVTDQKRGSLFTKLVKEITIAAKMGGGDPAGNPRLRLAIDTARDNS 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKK   +  G  +  I YEGYGP G+A+IIE  TDNRNRT + IR I ++ 
Sbjct: 61  MPMDNIQRAIKKGTGELEGVTWDEITYEGYGPAGIALIIETATDNRNRTVADIRHIMSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC--DF 176
           NGSLG +GS    F++ G + +  S  G+  L ME+ +E+   E L  D E  F    D 
Sbjct: 121 NGSLGESGSVAWMFQRKGTLDVPRSAAGEDQL-MELLLEA-GLEDLGSDDENYFTVITDV 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++    K L++     ++ K+   P NYI L  A+  + +IK+I+  E++DDVQ+VY+N
Sbjct: 179 KDLERVKKALDDAAIMYENAKIDLIPENYIELE-AEDARKVIKLIDAFENNDDVQAVYTN 237

Query: 237 LEIAD 241
           +EI++
Sbjct: 238 MEISE 242


>gi|82543703|ref|YP_407650.1| hypothetical protein SBO_1187 [Shigella boydii Sb227]
 gi|119392017|sp|Q322D6|YEBC_SHIBS RecName: Full=UPF0082 protein yebC
 gi|81245114|gb|ABB65822.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|332096563|gb|EGJ01557.1| hypothetical protein SB359474_1316 [Shigella boydii 3594-74]
          Length = 246

 Score =  182 bits (462), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVITFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D+I
Sbjct: 238 ISDEI 242


>gi|313891358|ref|ZP_07824974.1| DNA-binding regulatory protein, YebC/PmpR family [Dialister
           microaerophilus UPII 345-E]
 gi|329121411|ref|ZP_08250036.1| glucose-1-phosphate adenylyltransferase [Dialister micraerophilus
           DSM 19965]
 gi|313120133|gb|EFR43309.1| DNA-binding regulatory protein, YebC/PmpR family [Dialister
           microaerophilus UPII 345-E]
 gi|327469701|gb|EGF15168.1| glucose-1-phosphate adenylyltransferase [Dialister micraerophilus
           DSM 19965]
          Length = 240

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 154/240 (64%), Gaps = 2/240 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K + DAL+++I +K+S+EIT++A++ G +P+ N RL+LA+  AK  +
Sbjct: 1   MSGHSKWANIKHKKGKTDALRARITTKISKEITLAARMGGGDPVGNMRLKLALTKAKQNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PKENI+RAI K  G+     +  + YEGYGP GVAII+E  TDN+NRTA+ +R  FT  
Sbjct: 61  VPKENIQRAIAKGIGATSGEGFEEMSYEGYGPGGVAIIVECSTDNKNRTAADVRYAFTHH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GS+G+ G     F++ G II    + D +  M +A++S A +V   ++ Y    + +  
Sbjct: 121 GGSIGTPGCVGWMFKKKGIIIVDKEVADEDTLMLLALDSGAEDVQAHEEVYEIITEPDAF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
              S+ LE++  E +S +V   P N + L + +K +S+ KMIE LE+ DDVQ VY N ++
Sbjct: 181 IAVSEALEKEGIEVESSEVSMIPDNTVSL-DGEKAESMQKMIEALEEIDDVQEVYHNADM 239


>gi|284007616|emb|CBA73233.1| conserved hypothetical protein [Arsenophonus nasoniae]
          Length = 255

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +   NPRLR AI  A + +
Sbjct: 9   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDAASNPRLRAAIDKALSNN 68

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  GSD+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 69  MTRDTLNRAIARGVGSDENDNLETIIYEGYGPGGTAVMVECLSDNRNRTVSDVRHAFTKC 128

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   I + +L ME A+E+ A +V  ++D     Y    N
Sbjct: 129 GGNLGTDGSVAYLFTKRGVISYAPGIDEDSL-MEAALEAGADDVESYDDGAIDIYTTLEN 187

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A++ +V   P     L +AD    ++++I+ LED DDVQ VY N E
Sbjct: 188 FGSVKDALDATGFKAEAAEVTMIPSTKANL-DADTAPKLLRLIDMLEDSDDVQEVYHNGE 246

Query: 239 IADDI 243
           I+D++
Sbjct: 247 ISDEV 251


>gi|255020122|ref|ZP_05292192.1| hypothetical protein ACA_1331 [Acidithiobacillus caldus ATCC 51756]
 gi|254970415|gb|EET27907.1| hypothetical protein ACA_1331 [Acidithiobacillus caldus ATCC 51756]
          Length = 250

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 154/243 (63%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK  +DA K KIF++L REITV+A+  G +   NPRLR A+  A   +
Sbjct: 1   MAGHSKWANIKFRKAAQDAKKGKIFTRLIREITVAARAGGGDASSNPRLRTALDKAYANN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ +ERAIK+   +  G +Y  + YEGYGP GVAI+IE +TDNR RT + IR IF+K 
Sbjct: 61  MAKDTVERAIKRGTGELEGVDYEEVTYEGYGPSGVAILIETMTDNRVRTVAEIRHIFSKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++GS    F++ G I   +++G+  + +E A+E+ A +V+ ED   + Y +   +
Sbjct: 121 GGNLGTSGSVAYLFQRRGMISLAADVGEDRV-LEAALEAGAEDVVTEDGRIVVYTEATAL 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
              ++ L+      + I++   P   + +S  D  K +++++E LE++DDVQ+VY+N  +
Sbjct: 180 HGVAEALQNAGLTPEEIELTMIPETTVEVSGDDADK-LMRLLEALEENDDVQNVYANYSL 238

Query: 240 ADD 242
           +D+
Sbjct: 239 SDE 241


>gi|312880158|ref|ZP_07739958.1| protein of unknown function DUF28 [Aminomonas paucivorans DSM
           12260]
 gi|310783449|gb|EFQ23847.1| protein of unknown function DUF28 [Aminomonas paucivorans DSM
           12260]
          Length = 250

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 148/245 (60%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +DA K   + +L++ +  +AK  G +P  N RL++AI  A+  +
Sbjct: 1   MSGHSKWANIKHRKAAQDAKKGAAYQRLTKAVIAAAKAGGGDPNANFRLKVAIDRAREGN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NIERAIKK   +  G  Y  + YEGYGP GVAI++E LTDNRNRTA  +RS+FTK+
Sbjct: 61  VPMDNIERAIKKGSGEIEGAIYDEVTYEGYGPAGVAIMVETLTDNRNRTAPEMRSLFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G  G     FE+ G I       D    + VA E+ A ++  +D+ +  YCD +++
Sbjct: 121 GGAIGEAGCVAWNFERRGVIRVEGKGIDEEALLGVAAEAGADDLQGDDEGFDVYCDPSSL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L+      +S+++   P N + ++  D+   ++ M+E  E+ DDVQ+VY+N +I
Sbjct: 181 SEVGIALKGAGYPVESMEISMVPKNTVSITRKDEASKLLTMVERFEEHDDVQNVYANFDI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIL 245


>gi|330720193|gb|EGG98578.1| hypothetical protein imdm_2182 [gamma proteobacterium IMCC2047]
          Length = 244

 Score =  182 bits (461), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 150/246 (60%), Gaps = 9/246 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF++  RE+TV+A+  G +P +NPRLRLA+  AK+ +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTRFIRELTVAARAGGGDPEDNPRLRLAVDRAKSAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+ ++RAI +    +  N   I YEGYG  GVA+++E +TDNRNRT + +R  FTK  
Sbjct: 61  MPKDTMQRAIDRGVGGEGENLEEITYEGYGQAGVAVLVETMTDNRNRTVAEVRHAFTKFG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCDF 176
           G+LG+ GS +  F + G+I +     D +  ME A+E+ A +V+  D E I       +F
Sbjct: 121 GNLGTDGSVSYLFTKQGQITFEPG-ADEDAIMEAALEAGADDVVTNDDESIDVVTTPAEF 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           +NV      LE    E  + +V   P   + L + D    ++K+I+ LE+ DDVQ+V+ N
Sbjct: 180 SNV---KDALEAAGLEPVNAEVAMVPSTSVDL-DVDTATKVMKLIDMLEELDDVQNVFHN 235

Query: 237 LEIADD 242
            +I D+
Sbjct: 236 ADIPDE 241


>gi|83647605|ref|YP_436040.1| hypothetical protein HCH_04926 [Hahella chejuensis KCTC 2396]
 gi|119372143|sp|Q2SCK9|Y4926_HAHCH RecName: Full=UPF0082 protein HCH_04926
 gi|83635648|gb|ABC31615.1| uncharacterized conserved protein [Hahella chejuensis KCTC 2396]
          Length = 248

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 105/251 (41%), Positives = 153/251 (60%), Gaps = 15/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REITV+AK +G  P +NPRLR  I  A   +
Sbjct: 1   MAGHSKWANIKHRKASQDAKRGKIFTKLIREITVAAK-NGALPEDNPRLRAVIDKALTVN 59

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IE+AI++ AG  D  N+  + YEGYGP GVA+ +E +TDNRNRT + +R  F+K 
Sbjct: 60  MKKDTIEKAIQRGAGGGDDSNFDELTYEGYGPGGVAVYVEVMTDNRNRTVAEVRHAFSKH 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G+LG+ GS    F + G I++  ++ D +  ME A+E+ A +V+  D   +       D
Sbjct: 120 GGNLGTDGSVAYLFSKTGVILFAPDV-DEDAVMEAALEAGAQDVIANDDGSVEVQTSAED 178

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F  V   L +  L  +  +   +     PL+   + N +KV   +K+IE LED DDVQ+V
Sbjct: 179 FMAVKDALMAAGLTPESADVSMVPATMAPLD---VENGEKV---MKLIEMLEDLDDVQNV 232

Query: 234 YSNLEIADDII 244
           YSN +I D+++
Sbjct: 233 YSNADIPDEVL 243


>gi|191637963|ref|YP_001987129.1| hypothetical protein LCABL_11860 [Lactobacillus casei BL23]
 gi|227535500|ref|ZP_03965549.1| protein of hypothetical function DUF28 [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239631878|ref|ZP_04674909.1| hypothetical protein LBPG_00793 [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301066047|ref|YP_003788070.1| hypothetical protein LCAZH_0977 [Lactobacillus casei str. Zhang]
 gi|226696264|sp|B3WD20|Y1186_LACCB RecName: Full=UPF0082 protein LCABL_11860
 gi|190712265|emb|CAQ66271.1| UPF0082 protein LSEI_1022 [Lactobacillus casei BL23]
 gi|227186822|gb|EEI66889.1| protein of hypothetical function DUF28 [Lactobacillus paracasei
           subsp. paracasei ATCC 25302]
 gi|239526343|gb|EEQ65344.1| hypothetical protein LBPG_00793 [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438454|gb|ADK18220.1| conserved hypothetical protein [Lactobacillus casei str. Zhang]
 gi|327382039|gb|AEA53515.1| hypothetical protein LC2W_1181 [Lactobacillus casei LC2W]
 gi|327385193|gb|AEA56667.1| hypothetical protein LCBD_1169 [Lactobacillus casei BD-II]
          Length = 243

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 147/244 (60%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +D+ + KIF KLSRE+ ++AK  G +P  NP LRL +  AK  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDSKRGKIFQKLSRELYMAAKQGGPDPSGNPSLRLVMDKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   D  NY  + YEGYGP GVAI++EALTDNRNRT+S++R   T+  
Sbjct: 61  MPKDNIKRALDKASDRDAANYDEVTYEGYGPGGVAILVEALTDNRNRTSSTVRVAITRHG 120

Query: 121 GSLGSTGSTTRFFEQIGE-IIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G++ + G+ +  F++ G  +I   ++  D +  +E A+E+ A ++   D+ +  Y D   
Sbjct: 121 GNMAAAGAVSYMFDRKGYLVISRDDLDVDEDQMLEDALEAGAEDMQTSDEAFEIYTDPKE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEEK  +    ++   P N   +   DKV+    MI+ LEDDDDVQ VY+  +
Sbjct: 181 FAQVRDALEEKGYKFVQNELTMVPQNLTPIPE-DKVEQFQAMIDQLEDDDDVQEVYTAGD 239

Query: 239 IADD 242
             DD
Sbjct: 240 WPDD 243


>gi|260587636|ref|ZP_05853549.1| glucose-1-phosphate adenylyltransferase [Blautia hansenii DSM
           20583]
 gi|331084074|ref|ZP_08333181.1| hypothetical protein HMPREF0992_02105 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260541901|gb|EEX22470.1| glucose-1-phosphate adenylyltransferase [Blautia hansenii DSM
           20583]
 gi|330402436|gb|EGG82006.1| hypothetical protein HMPREF0992_02105 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 242

 Score =  181 bits (460), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 147/241 (60%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI V+ K  G +P  N +LR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAKKGKIFTVIGREIVVAVKEGGPDPANNSKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + IER IKKA  D +  N+  + YEGYGP GVAII+E LTDN+NRTA ++RS FTK 
Sbjct: 61  MPNDTIERGIKKAAGDSNADNFEVLTYEGYGPSGVAIIVETLTDNKNRTAGNVRSAFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           NG++G+ GS +  F++ G+II        D++  M +A+++ A +   ED  +      +
Sbjct: 121 NGNIGTPGSVSFMFDKKGQIIIDKEECEMDADDLMMIALDAGAEDFAEEDDSFEVLTAPD 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +     + LE++       +V   P NY+ LS+   +K++ K ++ LE+DDDV  V+ N 
Sbjct: 181 DFSAVREALEKEGIPMVEAQVAMIPQNYVTLSDEQDIKNLQKTLDLLENDDDVTDVWYNW 240

Query: 238 E 238
           E
Sbjct: 241 E 241


>gi|331647461|ref|ZP_08348553.1| protein YebC [Escherichia coli M605]
 gi|331043185|gb|EGI15323.1| protein YebC [Escherichia coli M605]
          Length = 246

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPSGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|307155183|ref|YP_003890567.1| hypothetical protein Cyan7822_5416 [Cyanothece sp. PCC 7822]
 gi|306985411|gb|ADN17292.1| protein of unknown function DUF28 [Cyanothece sp. PCC 7822]
          Length = 254

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 163/251 (64%), Gaps = 9/251 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA K K F++LSR I V+A+     P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAKKGKTFTQLSRAIIVAARNGLPEPAGNLQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS-DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P +NIERAI K AG+ ++  N   IRYEGYGP G+AI+IEALTDNRNRTA+ +R+ F+K
Sbjct: 61  IPNDNIERAIAKGAGTYENEANLEEIRYEGYGPGGIAILIEALTDNRNRTAADLRAAFSK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI--ESDAFEVLFED---QEYIFY 173
             G+LG TG  +  FEQ G ++    + +  + +E ++  E+D++E LF D   Q    +
Sbjct: 121 NGGNLGETGCVSWMFEQKGVVLLEGKL-EEEILLEASVEGEADSYE-LFNDEDEQGAEVF 178

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            +  N+   ++ L++K    +  ++ W P N + +++AD+ +S++K+++ LE  DDVQ+V
Sbjct: 179 TEVANLENLNQTLQKKGLPVKEAELRWIPNNTVEVTDADQARSLLKLMDALESLDDVQNV 238

Query: 234 YSNLEIADDII 244
            +N ++A++++
Sbjct: 239 TANFDMANELV 249


>gi|116494525|ref|YP_806259.1| hypothetical protein LSEI_1022 [Lactobacillus casei ATCC 334]
 gi|122264049|sp|Q03AF5|Y1022_LACC3 RecName: Full=UPF0082 protein LSEI_1022
 gi|116104675|gb|ABJ69817.1| hypothetical protein LSEI_1022 [Lactobacillus casei ATCC 334]
          Length = 243

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 147/244 (60%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +D+ + KIF KLSRE+ ++AK  G +P  NP LRL +  AK  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDSKRGKIFQKLSRELYMAAKQGGPDPSGNPSLRLVMDKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   D  NY  + YEGYGP GVAI++EALTDNRNRT+S++R   T+  
Sbjct: 61  MPKDNIKRALDKASDRDAANYDEVTYEGYGPGGVAILVEALTDNRNRTSSTVRVAITRHG 120

Query: 121 GSLGSTGSTTRFFEQIGE-IIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G++ + G+ +  F++ G  +I   ++  D +  +E A+E+ A ++   D+ +  Y D   
Sbjct: 121 GNMAAAGAVSYMFDRKGYLVISRDDLDVDEDQMLEDALEAGAEDMQTSDEAFEIYTDPKE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEEK  +    ++   P N   +   DKV+    MI+ LEDDDDVQ VY+  +
Sbjct: 181 FAQVRDALEEKGYKFVQNELTMVPQNLTPIPE-DKVEKFQAMIDQLEDDDDVQEVYTAGD 239

Query: 239 IADD 242
             DD
Sbjct: 240 WPDD 243


>gi|317056985|ref|YP_004105452.1| hypothetical protein Rumal_2338 [Ruminococcus albus 7]
 gi|315449254|gb|ADU22818.1| protein of unknown function DUF28 [Ruminococcus albus 7]
          Length = 247

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 150/242 (61%), Gaps = 7/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+++NI  +K   DA ++KIF+K+ REI V  K+ G +P  N +LR  I  AK  +
Sbjct: 1   MSGHSKWENIKRKKGATDAARAKIFTKIGREIAVVVKMGGPDPAGNAKLRDLIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NI+R IKKA  D D  NY ++ YEGYGP GVA+I+E LTDN+NRTA+ +RS F+K 
Sbjct: 61  VPNDNIDRIIKKAAGDGDKNNYESMVYEGYGPNGVAVIVECLTDNKNRTAADVRSYFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G++G  +  F  +G ++  +N  D +  M+   E+ A +   ++      C  N+V
Sbjct: 121 GGNMGNSGCVSYLFSDVGTVVIENNGADEDKIMDDVFEAGADDFNVDEDVIEIACAPNSV 180

Query: 180 GLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
               + LE    K+  A++ K+   P  Y+ L++ D +K +  ++E LED+DDVQ+VY N
Sbjct: 181 TAVREALEGQGYKVLSAEADKI---PSTYVTLTDEDSIKKMGLLLEYLEDNDDVQNVYHN 237

Query: 237 LE 238
            E
Sbjct: 238 WE 239


>gi|325684532|gb|EGD26696.1| glucose-1-phosphate adenylyltransferase [Lactobacillus delbrueckii
           subsp. lactis DSM 20072]
          Length = 243

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 146/238 (61%), Gaps = 5/238 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPSGNPSLRLVMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA  +   +Y  + YEGY P GVAI++EALTDN+NRTASS+R  FT+  
Sbjct: 61  MPKDNIQRAIKKAEGNSDEHYDEVTYEGYAPGGVAILVEALTDNKNRTASSVRVAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           GSLG+TGS    F++ G I+   +  D++   + M+V +E+   ++   D  Y  Y D  
Sbjct: 121 GSLGATGSVAYMFDRKGYIVIDRSTTDADEDQMLMDV-MEAGGDDLQTSDDAYEIYTDAK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           +       LE+   +    ++   P N   +  ADK +   K++E LEDDDDV +VY+
Sbjct: 180 SFTAVRDALEKAGYQLAVSELTMVPQNTTPVP-ADKKEQFEKLVEALEDDDDVSNVYT 236


>gi|6226438|sp|Q9ZNK0|YU82_CLOHI RecName: Full=UPF0082 protein ORF2U
 gi|3868871|dbj|BAA34259.1| unnamed protein product [Clostridium histolyticum]
          Length = 246

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 148/243 (60%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +K + DA + KIF+K+ +EI ++AK  G NP  NP+LR  I  AK  +
Sbjct: 1   MSGHSKWHNIQAKKSKVDAKRGKIFTKIGKEIAIAAKNGGPNPDANPKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK++IERAIKKA  +  G NY  I YEGYGP+G+A++++ALTDN+NR+A ++R  F+K 
Sbjct: 61  MPKDSIERAIKKAAGELAGVNYEEILYEGYGPDGIAVLVQALTDNKNRSAGNVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LGSTG  +  F+  G+I+   N   D    M +A+E  A +   ED+ YI      +
Sbjct: 121 GGNLGSTGCVSFMFQTKGQIVIEKNDELDEEELMMMALECGAEDFQSEDEVYIITTSPED 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G   + LEEK  E    +V   P  Y  + + +      KM++ LEDD+DVQ VY N E
Sbjct: 181 FGSVRETLEEKGLEFLEAEVKSIPDTYTVI-DENTAGKFQKMLDVLEDDEDVQDVYHNAE 239

Query: 239 IAD 241
             +
Sbjct: 240 FPE 242


>gi|145220236|ref|YP_001130945.1| hypothetical protein Cvib_1432 [Prosthecochloris vibrioformis DSM
           265]
 gi|189038695|sp|A4SG34|Y1432_PROVI RecName: Full=UPF0082 protein Cvib_1432
 gi|145206400|gb|ABP37443.1| protein of unknown function DUF28 [Chlorobium phaeovibrioides DSM
           265]
          Length = 250

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 100/244 (40%), Positives = 149/244 (61%), Gaps = 5/244 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A++ S
Sbjct: 1   MSGHSKWATIKRKKSATDQKRGNLFTKLVKEITIAAKMGGGDPAGNPRLRLAIDTARSNS 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKK   +  G +Y  I YEGYGP G+A+IIE  TDN+NRT + +R I ++ 
Sbjct: 61  MPMDNIQRAIKKGTGELEGVSYDEITYEGYGPAGIALIIETATDNKNRTVADLRHIMSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
           NGSLG  GS +  F + G I            MEV +++   E +  D E  Y    D +
Sbjct: 121 NGSLGENGSVSWMFHRKGSIEVPGGSATEEQLMEVLLDA-GLEDIGGDAEGGYTVTTDVH 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++    K LEE     ++ K+   P N+I L  AD  + +IK+I+ LE +DD+Q+V+SN+
Sbjct: 180 DLESAKKALEEAGIAYENAKMDLIPENFIELE-ADDARKVIKLIDALEGNDDIQAVFSNM 238

Query: 238 EIAD 241
           EI++
Sbjct: 239 EISE 242


>gi|283785602|ref|YP_003365467.1| hypothetical protein ROD_19051 [Citrobacter rodentium ICC168]
 gi|282949056|emb|CBG88659.1| conserved hypothetical protein [Citrobacter rodentium ICC168]
          Length = 247

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR AI  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI++E L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMVECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  + +
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEQ--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWED 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|299144379|ref|ZP_07037459.1| glucose-1-phosphate adenylyltransferase [Peptoniphilus sp. oral
           taxon 386 str. F0131]
 gi|298518864|gb|EFI42603.1| glucose-1-phosphate adenylyltransferase [Peptoniphilus sp. oral
           taxon 386 str. F0131]
          Length = 246

 Score =  181 bits (459), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 105/249 (42%), Positives = 149/249 (59%), Gaps = 20/249 (8%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI ++K ++DA + +IF+KL R I V+ K  G +P  NP L++AI  AK ++
Sbjct: 1   MSGHSKWNNIKNKKGKEDARRGRIFTKLGRYIMVAVKEGGPDPEYNPSLKVAIDKAKAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERAIKK AG+D   NY  I YEGYGP G+AI++  LTDNRNRTA  IR  F K 
Sbjct: 61  MPNDNIERAIKKGAGADADSNYEEITYEGYGPSGIAIMVNCLTDNRNRTAPDIRHAFDKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIE---------SDAFEVLFEDQE 169
            G+LG  G  +  F++ G++ I  ++  D++  M  AIE          D FE+L   +E
Sbjct: 121 GGNLGQPGCVSFMFDKKGQLGIEKTDSIDADELMMSAIELGADDVIDREDVFEILTAPEE 180

Query: 170 YIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDD 229
           Y          +    LEE   E     + + P NY  L + D +K +IK+I+ LED+DD
Sbjct: 181 Y---------HVVRNGLEEMGYEFIHSDISYIPQNYTALESEDDIKKMIKLIDILEDNDD 231

Query: 230 VQSVYSNLE 238
           VQ VY+N +
Sbjct: 232 VQEVYTNWD 240


>gi|291612981|ref|YP_003523138.1| hypothetical protein Slit_0511 [Sideroxydans lithotrophicus ES-1]
 gi|291583093|gb|ADE10751.1| protein of unknown function DUF28 [Sideroxydans lithotrophicus
           ES-1]
          Length = 243

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 152/241 (63%), Gaps = 10/241 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + +IF++L +EITV++KL G +P  NPRLRLA++ A +Q+
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGQIFTRLIKEITVASKLGGSDPDINPRLRLAMEKAYDQN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIK+   +  G +Y  +RYEGYG  G A++++ +TDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVERAIKRGAGELEGVDYMELRYEGYGINGAAVMVDCMTDNKTRTVADVRHAFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G+LG+ GS +  F+  G +I+     D N  MEVA+++ A +++  D   I       D
Sbjct: 121 GGNLGTDGSVSFLFKHCGHMIFAPGT-DENALMEVALDAGAEDIVNNDDGSIEVITSPHD 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V    ++LE    + +  +V  +P N +  +  D  K + K+++ LED  DVQ VY+
Sbjct: 180 FVAV---KQRLEAAGFKPEMGEVTMRPENEVVFTGEDAAK-MQKLLDALEDVGDVQEVYT 235

Query: 236 N 236
           N
Sbjct: 236 N 236


>gi|226734885|sp|A3M4T0|Y1496_ACIBT RecName: Full=UPF0082 protein A1S_1496
 gi|193077146|gb|ABO11924.2| hypothetical protein A1S_1496 [Acinetobacter baumannii ATCC 17978]
          Length = 249

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 150/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +AKL G +P  NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++  G +D  +   + YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGVGGEDNDDLKEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  +I   +  M+VA+E+ A ++   + E +        
Sbjct: 121 NGNLGTAGSVAYLFTKRGEITF-DDISLEDKIMDVALEAGAEDIEVSEDEILVITSPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K ++K+I+ LED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALAAAGLKSDNAEVVMSPSTKAEITDIDQAKQVMKLIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +D+++
Sbjct: 240 SDEVL 244


>gi|193069908|ref|ZP_03050857.1| conserved hypothetical protein [Escherichia coli E110019]
 gi|192956808|gb|EDV87262.1| conserved hypothetical protein [Escherichia coli E110019]
          Length = 246

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPSGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|22219064|pdb|1KON|A Chain A, Crystal Structure Of E.Coli Yebc
          Length = 249

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 4   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 63

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 64  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 123

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 124 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 181

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 182 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 240

Query: 239 IADDI 243
           I+D++
Sbjct: 241 ISDEV 245


>gi|89256280|ref|YP_513642.1| hypothetical protein FTL_0929 [Francisella tularensis subsp.
           holarctica LVS]
 gi|115314732|ref|YP_763455.1| hypothetical protein FTH_0908 [Francisella tularensis subsp.
           holarctica OSU18]
 gi|156502346|ref|YP_001428411.1| hypothetical protein FTA_0979 [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|167011090|ref|ZP_02276021.1| hypothetical protein Ftulh_10349 [Francisella tularensis subsp.
           holarctica FSC200]
 gi|254367615|ref|ZP_04983636.1| hypothetical protein FTHG_00883 [Francisella tularensis subsp.
           holarctica 257]
 gi|254369263|ref|ZP_04985275.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|290953115|ref|ZP_06557736.1| hypothetical protein FtulhU_01559 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|295313643|ref|ZP_06804227.1| hypothetical protein FtulhU_01559 [Francisella tularensis subsp.
           holarctica URFT1]
 gi|119392012|sp|Q2A3R0|Y929_FRATH RecName: Full=UPF0082 protein FTL_0929
 gi|122325247|sp|Q0BM66|Y908_FRATO RecName: Full=UPF0082 protein FTH_0908
 gi|166227544|sp|A7NBV2|Y979_FRATF RecName: Full=UPF0082 protein FTA_0979
 gi|89144111|emb|CAJ79368.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129631|gb|ABI82818.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica OSU18]
 gi|134253426|gb|EBA52520.1| hypothetical protein FTHG_00883 [Francisella tularensis subsp.
           holarctica 257]
 gi|156252949|gb|ABU61455.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FTNF002-00]
 gi|157122213|gb|EDO66353.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
          Length = 248

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 151/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATALANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERAI K AG D+  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTIERAIVKGAGGDESANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     Y D ++
Sbjct: 121 GGNLGTDGSVAYMFTKRGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVYTDPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L EK   +++ +V +       L + +  + ++ +I+ LED D VQSVYSN  
Sbjct: 180 FSDIQEVLIEKGFNSENAEVTFDAETKAEL-DTETAEKVMALIDKLEDLDYVQSVYSNAN 238

Query: 239 IADDII 244
              ++I
Sbjct: 239 FTQELI 244


>gi|307130885|ref|YP_003882901.1| hypothetical protein Dda3937_01618 [Dickeya dadantii 3937]
 gi|306528414|gb|ADM98344.1| conserved protein [Dickeya dadantii 3937]
          Length = 247

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDTVMDAALEAGADDVVSYDDGAIDVFTPWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     + +AD    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGQVKDALDAAGLVAESAEVSMIPSTKADM-DADTAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|290475275|ref|YP_003468163.1| hypothetical protein XBJ1_2264 [Xenorhabdus bovienii SS-2004]
 gi|289174596|emb|CBJ81390.1| conserved hypothetical protein [Xenorhabdus bovienii SS-2004]
          Length = 247

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDDADNMETIIYEGYGPGGTAVMVECLSDNRNRTVSDVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y    +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDAVMEAALEAGADDVETYDDGAIDVYTTPES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A+S +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGDVKDALDAAGFKAESAEVSMIPSTNAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D+I
Sbjct: 239 ISDEI 243


>gi|37526025|ref|NP_929369.1| hypothetical protein plu2109 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|49037280|sp|Q7N550|Y2109_PHOLL RecName: Full=UPF0082 protein plu2109
 gi|36785455|emb|CAE14402.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 247

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  GSD+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGSDEADNMETIIYEGYGPGGTAVMVECLSDNRNRTVSDVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  ME A+E+ A +V  ++D     Y     
Sbjct: 121 GGNLGTDGSVAYLFAKKGVISYAPGL-DEDAVMEAALEAGADDVETYDDGAIDVYTTPET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGDVKDALDAAGFVAESAEVSMIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D+I
Sbjct: 239 ISDEI 243


>gi|218133601|ref|ZP_03462405.1| hypothetical protein BACPEC_01470 [Bacteroides pectinophilus ATCC
           43243]
 gi|217990976|gb|EEC56982.1| hypothetical protein BACPEC_01470 [Bacteroides pectinophilus ATCC
           43243]
          Length = 248

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 145/240 (60%), Gaps = 2/240 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+K   DA K KIF+++ +EI V+ K  G +   N +LR  +  AK  +
Sbjct: 1   MSGHSKFANIAHKKAANDAAKGKIFTRIGKEIMVAVKEGGPDVNNNSKLRTVVAKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MP + IERAIKKA   D  NY ++ YEGYGP G AII+EALTDNRNR AS+IRS FTK  
Sbjct: 61  MPNDTIERAIKKAAGSDASNYESVVYEGYGPSGSAIIVEALTDNRNRAASNIRSAFTKGG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           GS+G+ G  +  F+  G II        D++  M +A+++ A +   ED  +      ++
Sbjct: 121 GSIGTPGCVSFMFDDKGLIIVSKEECDMDADDLMMIALDAGADDFSEEDDSFEITTAPDD 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + LEE+     S +V   P NY+ L++ + +K + +++  L++DDDVQ+VY N +
Sbjct: 181 FETVRQALEEQKIPMASAEVTKIPQNYVELTSEEDIKKMNRILMLLDEDDDVQNVYHNWD 240


>gi|187731444|ref|YP_001879758.1| hypothetical protein SbBS512_E1108 [Shigella boydii CDC 3083-94]
 gi|187428436|gb|ACD07710.1| conserved hypothetical protein [Shigella boydii CDC 3083-94]
 gi|320174357|gb|EFW49506.1| hypothetical protein SDB_03147 [Shigella dysenteriae CDC 74-1112]
 gi|320186109|gb|EFW60853.1| hypothetical protein SGF_01709 [Shigella flexneri CDC 796-83]
          Length = 246

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D+I
Sbjct: 238 ISDEI 242


>gi|15802277|ref|NP_288301.1| hypothetical protein Z2916 [Escherichia coli O157:H7 EDL933]
 gi|15831828|ref|NP_310601.1| hypothetical protein ECs2574 [Escherichia coli O157:H7 str. Sakai]
 gi|26248130|ref|NP_754170.1| hypothetical protein c2278 [Escherichia coli CFT073]
 gi|91211089|ref|YP_541075.1| hypothetical protein UTI89_C2068 [Escherichia coli UTI89]
 gi|110641982|ref|YP_669712.1| hypothetical protein ECP_1808 [Escherichia coli 536]
 gi|117624016|ref|YP_852929.1| hypothetical protein APECO1_914 [Escherichia coli APEC O1]
 gi|157156937|ref|YP_001463167.1| hypothetical protein EcE24377A_2094 [Escherichia coli E24377A]
 gi|157161333|ref|YP_001458651.1| hypothetical protein EcHS_A1957 [Escherichia coli HS]
 gi|168747891|ref|ZP_02772913.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757898|ref|ZP_02782905.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|168762342|ref|ZP_02787349.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|168770847|ref|ZP_02795854.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|168776589|ref|ZP_02801596.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|168783164|ref|ZP_02808171.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|168789729|ref|ZP_02814736.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|168801900|ref|ZP_02826907.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|170683235|ref|YP_001743380.1| hypothetical protein EcSMS35_1322 [Escherichia coli SMS-3-5]
 gi|188492343|ref|ZP_02999613.1| conserved hypothetical protein TIGR01033 [Escherichia coli 53638]
 gi|191172997|ref|ZP_03034531.1| conserved hypothetical protein [Escherichia coli F11]
 gi|195940290|ref|ZP_03085672.1| hypothetical protein EscherichcoliO157_28499 [Escherichia coli
           O157:H7 str. EC4024]
 gi|208810508|ref|ZP_03252384.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4206]
 gi|208816910|ref|ZP_03258030.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4045]
 gi|208820490|ref|ZP_03260810.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4042]
 gi|209400343|ref|YP_002270947.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4115]
 gi|215487077|ref|YP_002329508.1| hypothetical protein E2348C_1989 [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217328746|ref|ZP_03444827.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. TW14588]
 gi|218548575|ref|YP_002382366.1| hypothetical protein EFER_1208 [Escherichia fergusonii ATCC 35469]
 gi|218554452|ref|YP_002387365.1| hypothetical protein ECIAI1_1951 [Escherichia coli IAI1]
 gi|218558729|ref|YP_002391642.1| hypothetical protein ECS88_1922 [Escherichia coli S88]
 gi|218689802|ref|YP_002398014.1| hypothetical protein ECED1_2069 [Escherichia coli ED1a]
 gi|218695430|ref|YP_002403097.1| hypothetical protein EC55989_2043 [Escherichia coli 55989]
 gi|218699564|ref|YP_002407193.1| hypothetical protein ECIAI39_1185 [Escherichia coli IAI39]
 gi|218705365|ref|YP_002412884.1| hypothetical protein ECUMN_2162 [Escherichia coli UMN026]
 gi|227885708|ref|ZP_04003513.1| conserved hypothetical protein [Escherichia coli 83972]
 gi|237705818|ref|ZP_04536299.1| yebC [Escherichia sp. 3_2_53FAA]
 gi|253773179|ref|YP_003036010.1| hypothetical protein ECBD_1774 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254161924|ref|YP_003045032.1| hypothetical protein ECB_01835 [Escherichia coli B str. REL606]
 gi|254793488|ref|YP_003078325.1| hypothetical protein ECSP_2438 [Escherichia coli O157:H7 str.
           TW14359]
 gi|260855804|ref|YP_003229695.1| hypothetical protein ECO26_2716 [Escherichia coli O26:H11 str.
           11368]
 gi|260868399|ref|YP_003234801.1| hypothetical protein ECO111_2386 [Escherichia coli O111:H- str.
           11128]
 gi|261227635|ref|ZP_05941916.1| hypothetical protein EscherichiacoliO157_23996 [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|261258199|ref|ZP_05950732.1| hypothetical protein EscherichiacoliO157EcO_20602 [Escherichia coli
           O157:H7 str. FRIK966]
 gi|291283046|ref|YP_003499864.1| hypothetical protein G2583_2316 [Escherichia coli O55:H7 str.
           CB9615]
 gi|293405359|ref|ZP_06649351.1| UPF0082 protein yebC [Escherichia coli FVEC1412]
 gi|293410176|ref|ZP_06653752.1| hypothetical protein ECEG_01132 [Escherichia coli B354]
 gi|293415179|ref|ZP_06657822.1| hypothetical protein ECDG_01735 [Escherichia coli B185]
 gi|298381001|ref|ZP_06990600.1| yebC protein [Escherichia coli FVEC1302]
 gi|300824194|ref|ZP_07104312.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           119-7]
 gi|300899114|ref|ZP_07117397.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           198-1]
 gi|300924953|ref|ZP_07140880.1| hypothetical protein HMPREF9548_03065 [Escherichia coli MS 182-1]
 gi|300928895|ref|ZP_07144400.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           187-1]
 gi|300935839|ref|ZP_07150797.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 21-1]
 gi|300982168|ref|ZP_07175903.1| hypothetical protein HMPREF9553_02062 [Escherichia coli MS 200-1]
 gi|300994107|ref|ZP_07180690.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 45-1]
 gi|301018300|ref|ZP_07182809.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 69-1]
 gi|301050782|ref|ZP_07197639.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           185-1]
 gi|301327653|ref|ZP_07220861.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 78-1]
 gi|306814306|ref|ZP_07448472.1| hypothetical protein ECNC101_19736 [Escherichia coli NC101]
 gi|307314224|ref|ZP_07593834.1| protein of unknown function DUF28 [Escherichia coli W]
 gi|312967067|ref|ZP_07781285.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|331657913|ref|ZP_08358875.1| protein YebC [Escherichia coli TA206]
 gi|331668559|ref|ZP_08369407.1| protein YebC [Escherichia coli TA271]
 gi|331673394|ref|ZP_08374162.1| protein YebC [Escherichia coli TA280]
 gi|331677745|ref|ZP_08378420.1| protein YebC [Escherichia coli H591]
 gi|331683370|ref|ZP_08383971.1| protein YebC [Escherichia coli H299]
 gi|54040166|sp|P67176|YEBC_ECO57 RecName: Full=UPF0082 protein yebC
 gi|54042647|sp|P67175|YEBC_ECOL6 RecName: Full=UPF0082 protein yebC
 gi|118577828|sp|Q0TGW8|YEBC_ECOL5 RecName: Full=UPF0082 protein yebC
 gi|119392016|sp|Q1RAS0|YEBC_ECOUT RecName: Full=UPF0082 protein yebC
 gi|12515920|gb|AAG56854.1|AE005408_12 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|26108533|gb|AAN80735.1|AE016761_310 Protein yebC [Escherichia coli CFT073]
 gi|13362042|dbj|BAB35997.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai]
 gi|91072663|gb|ABE07544.1| hypothetical protein UTI89_C2068 [Escherichia coli UTI89]
 gi|110343574|gb|ABG69811.1| putative cytoplasmic protein [Escherichia coli 536]
 gi|115513140|gb|ABJ01215.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gi|157067013|gb|ABV06268.1| conserved hypothetical protein TIGR01033 [Escherichia coli HS]
 gi|157078967|gb|ABV18675.1| conserved hypothetical protein TIGR01033 [Escherichia coli E24377A]
 gi|170520953|gb|ACB19131.1| conserved hypothetical protein [Escherichia coli SMS-3-5]
 gi|187768083|gb|EDU31927.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017405|gb|EDU55527.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4113]
 gi|188487542|gb|EDU62645.1| conserved hypothetical protein TIGR01033 [Escherichia coli 53638]
 gi|188999493|gb|EDU68479.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355163|gb|EDU73582.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4401]
 gi|189360282|gb|EDU78701.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4486]
 gi|189367318|gb|EDU85734.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC4501]
 gi|189370673|gb|EDU89089.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC869]
 gi|189376041|gb|EDU94457.1| conserved hypothetical protein [Escherichia coli O157:H7 str.
           EC508]
 gi|190906708|gb|EDV66313.1| conserved hypothetical protein [Escherichia coli F11]
 gi|208725024|gb|EDZ74731.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4206]
 gi|208731253|gb|EDZ79942.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4045]
 gi|208740613|gb|EDZ88295.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4042]
 gi|209161743|gb|ACI39176.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. EC4115]
 gi|209767438|gb|ACI82031.1| hypothetical protein ECs2574 [Escherichia coli]
 gi|209767440|gb|ACI82032.1| hypothetical protein ECs2574 [Escherichia coli]
 gi|209767442|gb|ACI82033.1| hypothetical protein ECs2574 [Escherichia coli]
 gi|209767444|gb|ACI82034.1| hypothetical protein ECs2574 [Escherichia coli]
 gi|209767446|gb|ACI82035.1| hypothetical protein ECs2574 [Escherichia coli]
 gi|215265149|emb|CAS09537.1| predicted protein [Escherichia coli O127:H6 str. E2348/69]
 gi|217318093|gb|EEC26520.1| conserved hypothetical protein TIGR01033 [Escherichia coli O157:H7
           str. TW14588]
 gi|218352162|emb|CAU97901.1| conserved hypothetical protein [Escherichia coli 55989]
 gi|218356116|emb|CAQ88733.1| conserved hypothetical protein [Escherichia fergusonii ATCC 35469]
 gi|218361220|emb|CAQ98804.1| conserved hypothetical protein [Escherichia coli IAI1]
 gi|218365498|emb|CAR03225.1| conserved hypothetical protein [Escherichia coli S88]
 gi|218369550|emb|CAR17319.1| conserved hypothetical protein [Escherichia coli IAI39]
 gi|218427366|emb|CAR08261.2| conserved hypothetical protein [Escherichia coli ED1a]
 gi|218432462|emb|CAR13355.1| conserved hypothetical protein [Escherichia coli UMN026]
 gi|222033613|emb|CAP76354.1| UPF0082 protein yebC [Escherichia coli LF82]
 gi|226900575|gb|EEH86834.1| yebC [Escherichia sp. 3_2_53FAA]
 gi|227837281|gb|EEJ47747.1| conserved hypothetical protein [Escherichia coli 83972]
 gi|242377585|emb|CAQ32340.1| conserved protein [Escherichia coli BL21(DE3)]
 gi|253324223|gb|ACT28825.1| protein of unknown function DUF28 [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253973825|gb|ACT39496.1| hypothetical protein ECB_01835 [Escherichia coli B str. REL606]
 gi|253978019|gb|ACT43689.1| hypothetical protein ECD_01835 [Escherichia coli BL21(DE3)]
 gi|254592888|gb|ACT72249.1| conserved protein [Escherichia coli O157:H7 str. TW14359]
 gi|257754453|dbj|BAI25955.1| conserved predicted protein [Escherichia coli O26:H11 str. 11368]
 gi|257764755|dbj|BAI36250.1| conserved predicted protein [Escherichia coli O111:H- str. 11128]
 gi|281178934|dbj|BAI55264.1| conserved hypothetical protein [Escherichia coli SE15]
 gi|284921784|emb|CBG34857.1| conserved hypothetical protein [Escherichia coli 042]
 gi|290762919|gb|ADD56880.1| UPF0082 protein yebC [Escherichia coli O55:H7 str. CB9615]
 gi|291427567|gb|EFF00594.1| UPF0082 protein yebC [Escherichia coli FVEC1412]
 gi|291432827|gb|EFF05806.1| hypothetical protein ECDG_01735 [Escherichia coli B185]
 gi|291470644|gb|EFF13128.1| hypothetical protein ECEG_01132 [Escherichia coli B354]
 gi|294491341|gb|ADE90097.1| DNA-binding regulatory protein, YebC/PmpR family [Escherichia coli
           IHE3034]
 gi|298278443|gb|EFI19957.1| yebC protein [Escherichia coli FVEC1302]
 gi|300297537|gb|EFJ53922.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           185-1]
 gi|300307324|gb|EFJ61844.1| hypothetical protein HMPREF9553_02062 [Escherichia coli MS 200-1]
 gi|300357271|gb|EFJ73141.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           198-1]
 gi|300399736|gb|EFJ83274.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 69-1]
 gi|300406369|gb|EFJ89907.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 45-1]
 gi|300418889|gb|EFK02200.1| hypothetical protein HMPREF9548_03065 [Escherichia coli MS 182-1]
 gi|300458951|gb|EFK22444.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 21-1]
 gi|300463123|gb|EFK26616.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           187-1]
 gi|300523265|gb|EFK44334.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           119-7]
 gi|300845801|gb|EFK73561.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 78-1]
 gi|305852465|gb|EFM52916.1| hypothetical protein ECNC101_19736 [Escherichia coli NC101]
 gi|306906193|gb|EFN36711.1| protein of unknown function DUF28 [Escherichia coli W]
 gi|307553883|gb|ADN46658.1| conserved hypothetical protein [Escherichia coli ABU 83972]
 gi|307626653|gb|ADN70957.1| hypothetical protein UM146_07830 [Escherichia coli UM146]
 gi|309702088|emb|CBJ01402.1| conserved hypothetical protein [Escherichia coli ETEC H10407]
 gi|312288531|gb|EFR16433.1| conserved hypothetical protein [Escherichia coli 2362-75]
 gi|312946464|gb|ADR27291.1| hypothetical protein NRG857_09345 [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315061170|gb|ADT75497.1| conserved protein [Escherichia coli W]
 gi|315286567|gb|EFU46002.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           110-3]
 gi|315290343|gb|EFU49719.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           153-1]
 gi|315296555|gb|EFU55852.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 16-3]
 gi|320188565|gb|EFW63227.1| hypothetical protein ECoD_05063 [Escherichia coli O157:H7 str.
           EC1212]
 gi|320194420|gb|EFW69051.1| hypothetical protein EcoM_03340 [Escherichia coli WV_060327]
 gi|320198058|gb|EFW72666.1| hypothetical protein ECoL_05064 [Escherichia coli EC4100B]
 gi|320641718|gb|EFX11106.1| hypothetical protein ECO5101_14689 [Escherichia coli O157:H7 str.
           G5101]
 gi|320647078|gb|EFX15911.1| hypothetical protein ECO9389_19185 [Escherichia coli O157:H- str.
           493-89]
 gi|320652361|gb|EFX20659.1| hypothetical protein ECO2687_06392 [Escherichia coli O157:H- str. H
           2687]
 gi|320657962|gb|EFX25724.1| hypothetical protein ECO7815_20070 [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320658535|gb|EFX26229.1| hypothetical protein ECO5905_21790 [Escherichia coli O55:H7 str.
           USDA 5905]
 gi|320668433|gb|EFX35260.1| hypothetical protein ECOSU61_18914 [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152647|gb|EFZ38923.1| hypothetical protein ECEPECA14_5459 [Escherichia coli EPECa14]
 gi|323180661|gb|EFZ66206.1| hypothetical protein ECOK1180_0650 [Escherichia coli 1180]
 gi|323186360|gb|EFZ71710.1| hypothetical protein ECOK1357_0309 [Escherichia coli 1357]
 gi|323186872|gb|EFZ72191.1| hypothetical protein ECRN5871_4929 [Escherichia coli RN587/1]
 gi|323378253|gb|ADX50521.1| protein of unknown function DUF28 [Escherichia coli KO11]
 gi|323937122|gb|EGB33402.1| yebC [Escherichia coli E1520]
 gi|323952366|gb|EGB48239.1| yebC [Escherichia coli H252]
 gi|323956495|gb|EGB52237.1| yebC [Escherichia coli H263]
 gi|323961919|gb|EGB57518.1| yebC [Escherichia coli H489]
 gi|323968286|gb|EGB63693.1| yebC [Escherichia coli M863]
 gi|323977951|gb|EGB73037.1| yebC [Escherichia coli TW10509]
 gi|324007229|gb|EGB76448.1| hypothetical protein HMPREF9532_03086 [Escherichia coli MS 57-2]
 gi|324012867|gb|EGB82086.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS 60-1]
 gi|324113600|gb|EGC07575.1| yebC [Escherichia fergusonii B253]
 gi|324118924|gb|EGC12813.1| yebC [Escherichia coli E1167]
 gi|325496993|gb|EGC94852.1| hypothetical protein ECD227_1090 [Escherichia fergusonii ECD227]
 gi|326342244|gb|EGD66025.1| protein of unknown function DUF28 [Escherichia coli O157:H7 str.
           1044]
 gi|326343794|gb|EGD67556.1| hypothetical protein ECF_02227 [Escherichia coli O157:H7 str. 1125]
 gi|327252993|gb|EGE64647.1| hypothetical protein ECSTEC7V_2238 [Escherichia coli STEC_7v]
 gi|330911674|gb|EGH40184.1| hypothetical protein ECAA86_02033 [Escherichia coli AA86]
 gi|331056161|gb|EGI28170.1| protein YebC [Escherichia coli TA206]
 gi|331063753|gb|EGI35664.1| protein YebC [Escherichia coli TA271]
 gi|331069592|gb|EGI40979.1| protein YebC [Escherichia coli TA280]
 gi|331074205|gb|EGI45525.1| protein YebC [Escherichia coli H591]
 gi|331079585|gb|EGI50782.1| protein YebC [Escherichia coli H299]
          Length = 246

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 100/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|82776450|ref|YP_402799.1| hypothetical protein SDY_1151 [Shigella dysenteriae Sd197]
 gi|309789260|ref|ZP_07683853.1| conserved hypothetical protein [Shigella dysenteriae 1617]
 gi|119392018|sp|Q32H97|YEBC_SHIDS RecName: Full=UPF0082 protein yebC
 gi|81240598|gb|ABB61308.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308923014|gb|EFP68528.1| conserved hypothetical protein [Shigella dysenteriae 1617]
          Length = 246

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMLPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|302338524|ref|YP_003803730.1| protein of unknown function DUF28 [Spirochaeta smaragdinae DSM
           11293]
 gi|301635709|gb|ADK81136.1| protein of unknown function DUF28 [Spirochaeta smaragdinae DSM
           11293]
          Length = 248

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 103/247 (41%), Positives = 154/247 (62%), Gaps = 12/247 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ +I H+K   DA + K F+K+ +EITV+A++ G +P  NPRLR A+  AK+ +
Sbjct: 1   MSGHSKWASIKHKKGAIDAKRGKAFTKIIKEITVAARMGGGDPEANPRLRTAVLKAKSAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIKK   D  G +Y  + YE YGP GVAI+I+ALTDN+NRTA+ +RSI TK 
Sbjct: 61  MPKDNVERAIKKGTGDLEGVDYVELTYEAYGPGGVAILIDALTDNKNRTAADVRSILTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFE-DQEYIFYC--DF 176
            G+LG +G  +  F++ G I Y +         EVA+E+ A +V  E D   +     DF
Sbjct: 121 GGNLGESGCVSYLFQRKGIINYSAESYTEEAIFEVALEAGAEDVSTEGDTIEVMTAPEDF 180

Query: 177 NNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
             V   L +   EE++ E   +     P + + L + +K +  +++IE L+D DDVQSV 
Sbjct: 181 EPVLKALQAAGFEEELAEVSKV-----PDSTVTLDD-EKTRKALRLIERLDDHDDVQSVA 234

Query: 235 SNLEIAD 241
           +NL+I +
Sbjct: 235 TNLDIPE 241


>gi|89075784|ref|ZP_01162172.1| hypothetical protein SKA34_03054 [Photobacterium sp. SKA34]
 gi|89048516|gb|EAR54091.1| hypothetical protein SKA34_03054 [Photobacterium sp. SKA34]
          Length = 248

 Score =  181 bits (458), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+F NI HRK  +DA + KIF+KL REITV+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKFANIKHRKAAQDAKRGKIFTKLIREITVAAKEGGSEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RA+ + AG +       + YEGYGP G A+++E LTDNRNRT S +R  F+KA
Sbjct: 61  MTRDTINRAVTRGAGGEGDDGVETVIYEGYGPAGTAVMVECLTDNRNRTVSGVRHAFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS +  F++ G I Y   + D +  MEVA+ES A ++   D   I  Y    +
Sbjct: 121 GGNLGTDGSVSYLFDKKGVISYAVGL-DEDAIMEVALESGADDIETNDDGSIDVYTTPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A++ +V   P     L +A     ++++I+ LED DD+Q VY N +
Sbjct: 180 FGAVKDALDAAGFTAENAEVTLMPSTKAEL-DATTAPKLLRLIDALEDLDDIQEVYHNGD 238

Query: 239 IADDI 243
           ++D++
Sbjct: 239 MSDEV 243


>gi|319779288|ref|YP_004130201.1| hypothetical protein TEQUI_1134 [Taylorella equigenitalis MCE9]
 gi|317109312|gb|ADU92058.1| hypothetical protein TEQUI_1134 [Taylorella equigenitalis MCE9]
          Length = 243

 Score =  181 bits (458), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 143/238 (60%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KI++K+ REI V+A+  G +P  NP LRLA   A   +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKIWTKIIREIQVAARAGGADPDANPSLRLAWDKATAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI RAI++ AG  D  NY  IRYEGYGP G A+I+E +TDNR RT S +R   TK 
Sbjct: 61  MPKDNIMRAIQRGAGGADGENYEKIRYEGYGPAGAAVIVECMTDNRTRTVSDVRHALTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +S + ME+ +E+ A +V+ +D+  I   C+ ++
Sbjct: 121 GGNLGQDGSVAFMFKHCGQFLFAPGSDESQI-MEIGLEAGADDVVTDDEGLIEVTCEPSD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                K   +     +   +I KPLN   L   D +K + K+++ LE  DDVQ V++ 
Sbjct: 180 YMSVKKAFTDAGLTPEVDGIIMKPLNETVLEGDDAIK-MQKILDQLESLDDVQEVHTT 236


>gi|169633711|ref|YP_001707447.1| hypothetical protein ABSDF2152 [Acinetobacter baumannii SDF]
 gi|169796215|ref|YP_001714008.1| hypothetical protein ABAYE2155 [Acinetobacter baumannii AYE]
 gi|184157856|ref|YP_001846195.1| hypothetical protein ACICU_01536 [Acinetobacter baumannii ACICU]
 gi|213157051|ref|YP_002319096.1| hypothetical protein AB57_1731 [Acinetobacter baumannii AB0057]
 gi|215483670|ref|YP_002325891.1| hypothetical protein ABBFA_001989 [Acinetobacter baumannii
           AB307-0294]
 gi|239502267|ref|ZP_04661577.1| hypothetical protein AbauAB_08130 [Acinetobacter baumannii AB900]
 gi|260555277|ref|ZP_05827498.1| UPF0082 protein [Acinetobacter baumannii ATCC 19606]
 gi|301346643|ref|ZP_07227384.1| hypothetical protein AbauAB0_10366 [Acinetobacter baumannii AB056]
 gi|301512569|ref|ZP_07237806.1| hypothetical protein AbauAB05_13327 [Acinetobacter baumannii AB058]
 gi|301594641|ref|ZP_07239649.1| hypothetical protein AbauAB059_02490 [Acinetobacter baumannii
           AB059]
 gi|332855487|ref|ZP_08435907.1| DNA-binding regulatory protein, YebC/PmpR family [Acinetobacter
           baumannii 6013150]
 gi|332866616|ref|ZP_08437103.1| DNA-binding regulatory protein, YebC/PmpR family [Acinetobacter
           baumannii 6013113]
 gi|332872497|ref|ZP_08440467.1| DNA-binding regulatory protein, YebC/PmpR family [Acinetobacter
           baumannii 6014059]
 gi|226701115|sp|B7H3U3|Y1989_ACIB3 RecName: Full=UPF0082 protein ABBFA_001989
 gi|226701194|sp|B0VR58|Y2152_ACIBS RecName: Full=UPF0082 protein ABSDF2152
 gi|226701197|sp|B0VC84|Y2155_ACIBY RecName: Full=UPF0082 protein ABAYE2155
 gi|226734691|sp|B2HYW1|Y1536_ACIBC RecName: Full=UPF0082 protein ACICU_01536
 gi|226736434|sp|B7I4G5|Y1731_ACIB5 RecName: Full=UPF0082 protein AB57_1731
 gi|169149142|emb|CAM87021.1| conserved hypothetical protein [Acinetobacter baumannii AYE]
 gi|169152503|emb|CAP01477.1| conserved hypothetical protein [Acinetobacter baumannii]
 gi|183209450|gb|ACC56848.1| uncharacterized conserved protein [Acinetobacter baumannii ACICU]
 gi|213056211|gb|ACJ41113.1| conserved hypothetical protein [Acinetobacter baumannii AB0057]
 gi|213988098|gb|ACJ58397.1| conserved hypothetical protein [Acinetobacter baumannii AB307-0294]
 gi|260411819|gb|EEX05116.1| UPF0082 protein [Acinetobacter baumannii ATCC 19606]
 gi|322508171|gb|ADX03625.1| Hypothetical protein ABK1_1991 [Acinetobacter baumannii 1656-2]
 gi|323517260|gb|ADX91641.1| hypothetical protein ABTW07_1212 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|323517772|gb|ADX92153.1| hypothetical protein ABTW07_1724 [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332727461|gb|EGJ58891.1| DNA-binding regulatory protein, YebC/PmpR family [Acinetobacter
           baumannii 6013150]
 gi|332734490|gb|EGJ65603.1| DNA-binding regulatory protein, YebC/PmpR family [Acinetobacter
           baumannii 6013113]
 gi|332739303|gb|EGJ70160.1| DNA-binding regulatory protein, YebC/PmpR family [Acinetobacter
           baumannii 6014059]
          Length = 249

 Score =  181 bits (458), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 150/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +AKL G +P  NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGADPASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++  G +D  +   + YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGVGGEDNDDLKEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  ++   +  M+VA+E+ A ++   + E +        
Sbjct: 121 NGNLGTAGSVAYLFTKRGEITF-DDVSLEDKIMDVALEAGAEDIEVSEDEILVITSPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K ++K+I+ LED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALAAAGLKSDNAEVVMSPSTKAEITDIDQAKQVMKLIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +D+++
Sbjct: 240 SDEVL 244


>gi|154483677|ref|ZP_02026125.1| hypothetical protein EUBVEN_01381 [Eubacterium ventriosum ATCC
           27560]
 gi|149735587|gb|EDM51473.1| hypothetical protein EUBVEN_01381 [Eubacterium ventriosum ATCC
           27560]
          Length = 242

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 145/241 (60%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K K+F+ + +EI V+ K  G +P  N +LR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKMFTIIGKEIAVAVKEGGADPNNNSKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + IER IKKA G+    NY  +RYEGYGP G+AII++ALTDNRNRTA+++R+ FTK 
Sbjct: 61  MPNDTIERGIKKAAGNASAINYETVRYEGYGPNGIAIIVDALTDNRNRTAANVRNCFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            G++G+ G     F++ G+II        D +  M  AI++ A +   E+  Y    D N
Sbjct: 121 GGNVGTQGCVAYMFDEKGQIIIDKEECDMDPDELMMTAIDAGAEDFQDEEDSYEVITDPN 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
              +  + LE         +V   P NY+ L++ + +K +  +I+ L++D+DVQ VY N 
Sbjct: 181 EFSVVREALEAAGVAMAQAEVTMIPQNYVELTDDEAIKKMNIIIDRLDEDEDVQQVYHNW 240

Query: 238 E 238
           +
Sbjct: 241 D 241


>gi|268607914|ref|ZP_06141645.1| hypothetical protein RflaF_00250 [Ruminococcus flavefaciens FD-1]
          Length = 244

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 142/248 (57%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +KE  DA K KIF+K+ REITV  K  G +P  N +LR  I  AK+ +
Sbjct: 1   MSGHSKWNNIKRKKEATDAAKGKIFTKIGREITVVVKEGGPDPANNAKLRDLIAKAKSNN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NIER IKKA  D D  NY NI YEGYGP GVA+I+E LTDNRNRTA  +R  F K 
Sbjct: 61  VPNDNIERIIKKAAGDGDKNNYENITYEGYGPNGVAVIVECLTDNRNRTAGEVRHYFDKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ G  +  F   G ++  +   D +  ME   E    +    ++     C   NV
Sbjct: 121 GGNLGTIGCVSFMFSNKGIVVLENTGLDEDAVMEDVFEFGGEDFDINEETVEIECAPENV 180

Query: 180 -----GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
                GLT K       E++ I     P  Y  L++ D +K +  ++E+LE++DDVQ+VY
Sbjct: 181 SALREGLTGKGYNVLSAESEMI-----PSTYTTLTDEDHIKKMNLLLEHLEENDDVQNVY 235

Query: 235 SNLEIADD 242
            N E+ D+
Sbjct: 236 HNWEMPDE 243


>gi|319944358|ref|ZP_08018632.1| YebC like protein [Lautropia mirabilis ATCC 51599]
 gi|319742319|gb|EFV94732.1| YebC like protein [Lautropia mirabilis ATCC 51599]
          Length = 242

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 149/241 (61%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA +  +F++L +EITV+AK++G +P  NPRLRLA++ A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGALFTRLIKEITVAAKMAGGDPAMNPRLRLAMEKAADGN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ ++RAI++  G  +  NY  IRYEGYG  G A+II+ LTDNR RT + +R   TK 
Sbjct: 61  MPKDTVQRAIQRGVGGLEGVNYEEIRYEGYGVAGAAVIIDCLTDNRTRTVADVRHALTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    F   G++++     +  L MEV +E+ A ++L  D   +        
Sbjct: 121 GGNLGTDGSVAFQFTHCGQLVFAPGTDEDKL-MEVGLEAGAQDILSNDDGSLEVITEPGD 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            +  K   E  G +A+  ++  KP N + L+  D VK + K+++ LE+ DDVQ VY+N  
Sbjct: 180 FIAVKTALEAAGLKAEVAEITMKPQNELELTGDDAVK-MQKILDALENVDDVQQVYTNAV 238

Query: 239 I 239
           I
Sbjct: 239 I 239


>gi|320182598|gb|EFW57487.1| hypothetical protein SGB_00148 [Shigella boydii ATCC 9905]
 gi|332090041|gb|EGI95141.1| hypothetical protein SB521682_2156 [Shigella boydii 5216-82]
 gi|332095261|gb|EGJ00288.1| hypothetical protein SD15574_1533 [Shigella dysenteriae 155-74]
          Length = 246

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEASGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|225677403|ref|ZP_03788370.1| hypothetical protein WUni_009210 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|225590547|gb|EEH11807.1| hypothetical protein WUni_009210 [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 244

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 147/246 (59%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +S+ F+KL REI V+AK     P  NPRLR AI  A+ ++
Sbjct: 1   MAGHSQFSNIKHRKGAQDAKRSQKFTKLIREIAVAAKQG--LPELNPRLRSAIFAARKEN 58

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AIK A  +  G NY  I+YEG+GP G A+I+ ALT+NRNRTAS +R IF++ 
Sbjct: 59  LPKDKIETAIKNATGNVAGENYEEIQYEGHGPSGTALIVHALTNNRNRTASEVRYIFSRK 118

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
            G+LG TGS +  F+ +G I+Y +   + +      IE +   V   D+E  ++  C+  
Sbjct: 119 GGNLGETGSVSYLFDHVGLIVYKAEGVNFDDLFSHGIELEVLNVEENDKEGLHVITCEIK 178

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G        K GE +  ++  +P + I +S+ + +  +  ++E LED+DDVQ V  N 
Sbjct: 179 DFGKVRDAFYAKFGEPELARLSRQPKDLIEISDKELIDKLSALVEELEDNDDVQYVEGNF 238

Query: 238 EIADDI 243
              D +
Sbjct: 239 TFVDAV 244


>gi|110833611|ref|YP_692470.1| hypothetical protein ABO_0750 [Alcanivorax borkumensis SK2]
 gi|118574398|sp|Q0VRK0|Y750_ALCBS RecName: Full=UPF0082 protein ABO_0750
 gi|110646722|emb|CAL16198.1| conserved hypothetical protein [Alcanivorax borkumensis SK2]
          Length = 247

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 146/239 (61%), Gaps = 5/239 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+TV+AK+ G  P +NPRLR AI  A  Q+
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIRELTVAAKMGGGEPNDNPRLRAAIDKALGQN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RA+K+ AG DD G+   I YEGYG  GVA+++E +TDN NRT + +R  F+K 
Sbjct: 61  MTRDTIDRAVKRGAGGDDDGSMDEITYEGYGKGGVAVLVETMTDNVNRTVAEVRHAFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV--LFEDQEYIFYCDFN 177
            G+LG++GS    F + GEI +   + +  L MEVA+E+ A +V  + +D   +      
Sbjct: 121 GGNLGTSGSVAFLFTKRGEIFFEPGVDEEKL-MEVALEAGAEDVEEMGDDGFLVITTPDK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           + G     L     E    +V   P     + + D  +++ KMI+ LED DDVQ+VY+N
Sbjct: 180 SFGEVVDSLRAAGLEFAEAEVTMHPSTEAEM-DTDTAETVQKMIDMLEDLDDVQNVYTN 237


>gi|16129817|ref|NP_416378.1| conserved protein, UPF0082 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|30063274|ref|NP_837445.1| hypothetical protein S1940 [Shigella flexneri 2a str. 2457T]
 gi|74311806|ref|YP_310225.1| hypothetical protein SSON_1277 [Shigella sonnei Ss046]
 gi|89108704|ref|AP_002484.1| hypothetical protein [Escherichia coli str. K-12 substr. W3110]
 gi|170019791|ref|YP_001724745.1| hypothetical protein EcolC_1768 [Escherichia coli ATCC 8739]
 gi|170081520|ref|YP_001730840.1| hypothetical protein ECDH10B_2005 [Escherichia coli str. K-12
           substr. DH10B]
 gi|191168081|ref|ZP_03029880.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|193066058|ref|ZP_03047115.1| conserved hypothetical protein [Escherichia coli E22]
 gi|194429661|ref|ZP_03062179.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194439052|ref|ZP_03071135.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|209919231|ref|YP_002293315.1| hypothetical protein ECSE_2040 [Escherichia coli SE11]
 gi|238901079|ref|YP_002926875.1| hypothetical protein BWG_1678 [Escherichia coli BW2952]
 gi|256017932|ref|ZP_05431797.1| hypothetical protein ShiD9_03377 [Shigella sp. D9]
 gi|256022470|ref|ZP_05436335.1| hypothetical protein E4_03794 [Escherichia sp. 4_1_40B]
 gi|260844207|ref|YP_003221985.1| hypothetical protein ECO103_2054 [Escherichia coli O103:H2 str.
           12009]
 gi|293446251|ref|ZP_06662673.1| hypothetical protein ECCG_00399 [Escherichia coli B088]
 gi|300816244|ref|ZP_07096466.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           107-1]
 gi|300904748|ref|ZP_07122578.1| hypothetical protein HMPREF9536_02819 [Escherichia coli MS 84-1]
 gi|300917559|ref|ZP_07134214.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           115-1]
 gi|300951486|ref|ZP_07165321.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           116-1]
 gi|300956623|ref|ZP_07168902.1| hypothetical protein HMPREF9547_02440 [Escherichia coli MS 175-1]
 gi|301029314|ref|ZP_07192411.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           196-1]
 gi|301304453|ref|ZP_07210565.1| hypothetical protein HMPREF9347_03058 [Escherichia coli MS 124-1]
 gi|301645620|ref|ZP_07245549.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           146-1]
 gi|307138527|ref|ZP_07497883.1| hypothetical protein EcolH7_10410 [Escherichia coli H736]
 gi|309794245|ref|ZP_07688669.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           145-7]
 gi|312969905|ref|ZP_07784088.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|331642478|ref|ZP_08343613.1| protein YebC [Escherichia coli H736]
 gi|331653273|ref|ZP_08354278.1| protein YebC [Escherichia coli M718]
 gi|332278966|ref|ZP_08391379.1| conserved hypothetical protein [Shigella sp. D9]
 gi|67476510|sp|P0A8A0|YEBC_ECOLI RecName: Full=UPF0082 protein yebC
 gi|67476511|sp|P0A8A1|YEBC_SHIFL RecName: Full=UPF0082 protein yebC
 gi|119392019|sp|Q3Z2M2|YEBC_SHISS RecName: Full=UPF0082 protein yebC
 gi|42173|emb|CAA42126.1| ORF246 [Escherichia coli K-12]
 gi|216652|dbj|BAA01031.1| Orf26 [Escherichia coli]
 gi|1736511|dbj|BAA15675.1| conserved hypothetical protein [Escherichia coli str. K12 substr.
           W3110]
 gi|1788171|gb|AAC74934.1| conserved protein, UPF0082 family [Escherichia coli str. K-12
           substr. MG1655]
 gi|30041526|gb|AAP17254.1| hypothetical protein S1940 [Shigella flexneri 2a str. 2457T]
 gi|73855283|gb|AAZ87990.1| conserved hypothetical protein [Shigella sonnei Ss046]
 gi|169754719|gb|ACA77418.1| protein of unknown function DUF28 [Escherichia coli ATCC 8739]
 gi|169889355|gb|ACB03062.1| conserved protein [Escherichia coli str. K-12 substr. DH10B]
 gi|190901879|gb|EDV61629.1| conserved hypothetical protein [Escherichia coli B7A]
 gi|192926295|gb|EDV80932.1| conserved hypothetical protein [Escherichia coli E22]
 gi|194412303|gb|EDX28607.1| conserved hypothetical protein [Escherichia coli B171]
 gi|194422011|gb|EDX38015.1| conserved hypothetical protein [Escherichia coli 101-1]
 gi|195182926|dbj|BAG66494.1| hypothetical protein [Escherichia coli O111:H-]
 gi|209912490|dbj|BAG77564.1| conserved hypothetical protein [Escherichia coli SE11]
 gi|238860331|gb|ACR62329.1| conserved protein [Escherichia coli BW2952]
 gi|257759354|dbj|BAI30851.1| conserved predicted protein [Escherichia coli O103:H2 str. 12009]
 gi|260449013|gb|ACX39435.1| protein of unknown function DUF28 [Escherichia coli DH1]
 gi|281601279|gb|ADA74263.1| hypothetical protein SFxv_2098 [Shigella flexneri 2002017]
 gi|291323081|gb|EFE62509.1| hypothetical protein ECCG_00399 [Escherichia coli B088]
 gi|299877740|gb|EFI85951.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           196-1]
 gi|300316605|gb|EFJ66389.1| hypothetical protein HMPREF9547_02440 [Escherichia coli MS 175-1]
 gi|300403332|gb|EFJ86870.1| hypothetical protein HMPREF9536_02819 [Escherichia coli MS 84-1]
 gi|300415213|gb|EFJ98523.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           115-1]
 gi|300449236|gb|EFK12856.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           116-1]
 gi|300530934|gb|EFK51996.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           107-1]
 gi|300840304|gb|EFK68064.1| hypothetical protein HMPREF9347_03058 [Escherichia coli MS 124-1]
 gi|301076152|gb|EFK90958.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           146-1]
 gi|308122150|gb|EFO59412.1| conserved hypothetical protein TIGR01033 [Escherichia coli MS
           145-7]
 gi|310338190|gb|EFQ03279.1| conserved hypothetical protein [Escherichia coli 1827-70]
 gi|313650640|gb|EFS15042.1| hypothetical protein SF2457T_0885 [Shigella flexneri 2a str. 2457T]
 gi|315136507|dbj|BAJ43666.1| hypothetical protein ECDH1ME8569_1810 [Escherichia coli DH1]
 gi|315257304|gb|EFU37272.1| glucose-1-phosphate adenylyl transferase [Escherichia coli MS 85-1]
 gi|315617913|gb|EFU98511.1| conserved hypothetical protein [Escherichia coli 3431]
 gi|323158651|gb|EFZ44665.1| hypothetical protein ECE128010_5109 [Escherichia coli E128010]
 gi|323165012|gb|EFZ50802.1| hypothetical protein SS53G_4475 [Shigella sonnei 53G]
 gi|323174757|gb|EFZ60373.1| hypothetical protein ECLT68_0636 [Escherichia coli LT-68]
 gi|323940468|gb|EGB36659.1| hypothetical protein ERDG_02817 [Escherichia coli E482]
 gi|323948250|gb|EGB44238.1| yebC [Escherichia coli H120]
 gi|323972628|gb|EGB67831.1| hypothetical protein ERHG_01371 [Escherichia coli TA007]
 gi|324018007|gb|EGB87226.1| hypothetical protein HMPREF9542_03343 [Escherichia coli MS 117-3]
 gi|331039276|gb|EGI11496.1| protein YebC [Escherichia coli H736]
 gi|331049371|gb|EGI21443.1| protein YebC [Escherichia coli M718]
 gi|332101318|gb|EGJ04664.1| conserved hypothetical protein [Shigella sp. D9]
 gi|332343590|gb|AEE56924.1| conserved hypothetical protein [Escherichia coli UMNK88]
 gi|332756765|gb|EGJ87112.1| hypothetical protein SF434370_2063 [Shigella flexneri 4343-70]
 gi|332757658|gb|EGJ87991.1| hypothetical protein SF274771_2229 [Shigella flexneri 2747-71]
 gi|332758052|gb|EGJ88378.1| hypothetical protein SFK671_2250 [Shigella flexneri K-671]
 gi|332766840|gb|EGJ97041.1| hypothetical protein SF293071_2157 [Shigella flexneri 2930-71]
 gi|333003475|gb|EGK23018.1| hypothetical protein SFVA6_2500 [Shigella flexneri VA-6]
 gi|333004717|gb|EGK24240.1| hypothetical protein SFK272_2476 [Shigella flexneri K-272]
 gi|333004760|gb|EGK24282.1| hypothetical protein SFK218_2088 [Shigella flexneri K-218]
 gi|333018438|gb|EGK37736.1| hypothetical protein SFK227_2150 [Shigella flexneri K-227]
 gi|333018606|gb|EGK37900.1| hypothetical protein SFK304_1840 [Shigella flexneri K-304]
          Length = 246

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|33593302|ref|NP_880946.1| hypothetical protein BP2308 [Bordetella pertussis Tohama I]
 gi|49037283|sp|Q7VWE9|Y2308_BORPE RecName: Full=UPF0082 protein BP2308
 gi|33572658|emb|CAE42581.1| conserved hypothetical protein [Bordetella pertussis Tohama I]
 gi|332382711|gb|AEE67558.1| hypothetical protein BPTD_2267 [Bordetella pertussis CS]
          Length = 243

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 146/239 (61%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRMAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG  D  +Y  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIQRAIQRGAGGADGESYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +  + ME A+E+ A +V  +++  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFVFAPGTSEETV-MEAALEAGAEDVATDEEGVIEVVCAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                +  E    +A+   V+ K LN   L+  D VK + K+++ LE  DDVQ VY+N+
Sbjct: 180 FTAVRQAFEAAGLKAEVDGVVMKALNETELTGEDAVK-MQKLLDVLESLDDVQEVYTNV 237


>gi|194433920|ref|ZP_03066192.1| conserved hypothetical protein [Shigella dysenteriae 1012]
 gi|194417792|gb|EDX33889.1| conserved hypothetical protein [Shigella dysenteriae 1012]
          Length = 262

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 17  MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 76

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 77  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 136

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 137 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 194

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 195 MGKVRDALEASGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 253

Query: 239 IADDI 243
           I+D++
Sbjct: 254 ISDEV 258


>gi|154498059|ref|ZP_02036437.1| hypothetical protein BACCAP_02040 [Bacteroides capillosus ATCC
           29799]
 gi|150273049|gb|EDN00206.1| hypothetical protein BACCAP_02040 [Bacteroides capillosus ATCC
           29799]
          Length = 242

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 148/240 (61%), Gaps = 2/240 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQ-NPLENPRLRLAIQNAKNQ 59
           M+GHS++ NI   K   DA +S+IF+K++RE+ V+ K  G  +P  N RL   I  AK  
Sbjct: 1   MSGHSKWHNIQKTKGAADAKRSQIFTKIAREMIVAVKTGGSGDPANNSRLATVIAKAKAA 60

Query: 60  SMPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +MP +NI+R I KA GS +  +Y N+ YEGYGP GVA+I+EALTDNRNRTA  +R IF K
Sbjct: 61  NMPNDNIKRTIDKALGSGNTDSYENVVYEGYGPCGVAVIVEALTDNRNRTAPFVRHIFDK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+LG+TG  +  F+Q G I+      D +  M  A+++ A ++  +D  +      + 
Sbjct: 121 YGGNLGATGCVSWSFDQKGVIVIEREDLDEDTVMMDALDAGADDMTADDDCFEITTSPDV 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G    KLEEK     S +V   P NY++L + D VK++ K+I+ LE++DDVQ+VY N E
Sbjct: 181 FGEVLAKLEEKGYVFASAEVEMVPQNYVKLESEDDVKNMEKLIDFLEENDDVQNVYHNWE 240


>gi|254448972|ref|ZP_05062426.1| conserved hypothetical protein TIGR01033 [gamma proteobacterium
           HTCC5015]
 gi|198261366|gb|EDY85657.1| conserved hypothetical protein TIGR01033 [gamma proteobacterium
           HTCC5015]
          Length = 247

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 149/245 (60%), Gaps = 14/245 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK+  DA + KIF+KL +EITV+A++ G +   NPRLRLAI  A  QS
Sbjct: 1   MAGHSKWANIQHRKKAVDAKRGKIFTKLVKEITVAARMGGGDTDSNPRLRLAIDKALGQS 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERA+K+   D  G NY  IRYEGYGP GVA++++ +TDN+NR+ + +R  F+K 
Sbjct: 61  MPKDNIERAVKRGTGDLEGVNYEEIRYEGYGPGGVAVMVDCMTDNKNRSVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G+LG+ GS    F Q G + Y     +  + ME A+E  A +V+  D   I        
Sbjct: 121 GGNLGTDGSVAFLFSQTGILSYPPGTSEEAI-MEAALEGGADDVVTNDDASIDVLTQPDQ 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F +V   L +  L     + ++ +V  KP     L + D  + ++K+ + LED DDVQ+V
Sbjct: 180 FVDVKEALIAADL-----KPENDEVTMKPSTDAPL-DVDTARQMLKLQDMLEDLDDVQNV 233

Query: 234 YSNLE 238
           Y+N +
Sbjct: 234 YTNAD 238


>gi|242239586|ref|YP_002987767.1| hypothetical protein Dd703_2158 [Dickeya dadantii Ech703]
 gi|242131643|gb|ACS85945.1| protein of unknown function DUF28 [Dickeya dadantii Ech703]
          Length = 247

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAVDKALTNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  M+ A+E+ A +VL F+D     +  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISYAPGL-DEDTLMDAALEAGADDVLSFDDGAIDVFTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGQVKDALDAAGFVAESAEVSMIPSTRADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|238854833|ref|ZP_04645163.1| conserved hypothetical protein [Lactobacillus jensenii 269-3]
 gi|260664120|ref|ZP_05864973.1| conserved hypothetical protein [Lactobacillus jensenii SJ-7A-US]
 gi|282933911|ref|ZP_06339259.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           jensenii 208-1]
 gi|313472336|ref|ZP_07812828.1| glucose-1-phosphate adenylyltransferase [Lactobacillus jensenii
           1153]
 gi|238832623|gb|EEQ24930.1| conserved hypothetical protein [Lactobacillus jensenii 269-3]
 gi|239529808|gb|EEQ68809.1| glucose-1-phosphate adenylyltransferase [Lactobacillus jensenii
           1153]
 gi|260562006|gb|EEX27975.1| conserved hypothetical protein [Lactobacillus jensenii SJ-7A-US]
 gi|281302000|gb|EFA94254.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           jensenii 208-1]
          Length = 242

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 153/243 (62%), Gaps = 15/243 (6%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSREI ++AK  G +P  NP LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKLSREIYMAAKSGGPDPSGNPALRLVMDKARAAN 60

Query: 61  MPKENIERAIKKA--GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NI+RAIKKA  GSD+  +Y  I YEGY P GVA+++EALTDN+NRTA+S+R+ FT+
Sbjct: 61  MPKDNIQRAIKKAEGGSDE--HYDEITYEGYAPGGVAVLVEALTDNKNRTATSVRTAFTR 118

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCD 175
             GS+GSTGS    F++ G I+   +  D++   + M+V +++ A ++   D  Y  Y D
Sbjct: 119 NGGSMGSTGSVAYMFDRKGYIVIDRSTTDADEDQMLMDV-MDAGADDLQTSDDAYEIYTD 177

Query: 176 ---FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
              F  V    +K   K+ +A+   +   P N   +  ADK +    +I+ LEDDDDV +
Sbjct: 178 AKEFTGVRDALEKAGYKLADAELTMI---PQNTTPVP-ADKKEQFEHLIDALEDDDDVSN 233

Query: 233 VYS 235
           VY+
Sbjct: 234 VYT 236


>gi|161502987|ref|YP_001570099.1| hypothetical protein SARI_01049 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|189041144|sp|A9MND4|YEEN_SALAR RecName: Full=UPF0082 protein yeeN
 gi|160864334|gb|ABX20957.1| hypothetical protein SARI_01049 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 247

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI++E L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMVECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALENAGLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|317121683|ref|YP_004101686.1| hypothetical protein Tmar_0845 [Thermaerobacter marianensis DSM
           12885]
 gi|315591663|gb|ADU50959.1| protein of unknown function DUF28 [Thermaerobacter marianensis DSM
           12885]
          Length = 248

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 152/246 (61%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK R+DA + KIFSKLSREI  + +  G +P  NPRLRLA++ A+  S
Sbjct: 1   MAGHSKWANRKHRKARQDAKRGKIFSKLSREIITAVRQGGGDPAANPRLRLALERARQFS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP EN+ERAIK+  G  D  NY  + YEGYGP GVA+++E LTDNRNR+AS IR IF K 
Sbjct: 61  MPAENVERAIKRGLGESDADNYEELIYEGYGPGGVALMLEILTDNRNRSASEIRHIFAKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LG +G     F++ G I +        +  + +A+E+ A ++  E+  ++ Y D ++
Sbjct: 121 GGNLGESGCVAWMFDRKGVITVPVPGAPAEDDLLLLALEAGAEDLKQEEGAFVVYTDPDD 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    + LE+     +   +   P   +++   +  + ++++++ LED DDVQ +Y N E
Sbjct: 181 LHRVREALEKAGVPVEDAALRMVPKTEVKVEGKE-AEQLLRLLDALEDHDDVQEIYGNFE 239

Query: 239 IADDII 244
           + D+++
Sbjct: 240 LPDEML 245


>gi|296101797|ref|YP_003611943.1| hypothetical protein ECL_01434 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295056256|gb|ADF60994.1| hypothetical protein ECL_01434 [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 246

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 147/245 (60%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDTNMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD ++ ME A+E+ A +V+ F+D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDVIMEAALEAGAEDVVTFDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|313123374|ref|YP_004033633.1| glucose-1-phosphate adenylyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
 gi|312279937|gb|ADQ60656.1| Glucose-1-phosphate adenylyltransferase [Lactobacillus delbrueckii
           subsp. bulgaricus ND02]
          Length = 243

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/238 (41%), Positives = 146/238 (61%), Gaps = 5/238 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPSGNPSLRLVMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA  +   +Y  + YEGY P GVAI++EALTDN+NRTASS+R  FT+  
Sbjct: 61  MPKDNIQRAIKKAEGNSDEHYDEVTYEGYAPGGVAILVEALTDNKNRTASSVRVAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           GSLG+TGS    F++ G I+   +  D++   + M+V +E+   ++   D  Y  Y D  
Sbjct: 121 GSLGATGSVAYMFDRKGYIVIDRSTTDADEDQMLMDV-MEAGGDDLQTSDDAYEIYTDAK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           +       LE+   +    ++   P N   +  ADK +   K+++ LEDDDDV +VY+
Sbjct: 180 SFTAVRDALEKAGYQLAVSELTMVPQNTTPVP-ADKKEQFEKLVDALEDDDDVSNVYT 236


>gi|242280348|ref|YP_002992477.1| hypothetical protein Desal_2886 [Desulfovibrio salexigens DSM 2638]
 gi|259646918|sp|C6C067|Y2886_DESAD RecName: Full=UPF0082 protein Desal_2886
 gi|242123242|gb|ACS80938.1| protein of unknown function DUF28 [Desulfovibrio salexigens DSM
           2638]
          Length = 248

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/249 (38%), Positives = 155/249 (62%), Gaps = 11/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KIF+K++++I ++AK  G +P  NP LRLAI  AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKIFTKMAKDIILAAK-GGGDPAMNPSLRLAISKAKAVN 59

Query: 61  MPKENIERAIKKAGSDDL--GNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP + I+ AIKK G+ +L  G+ + + YEGYGP GVAI++EA TDN+NRT + +R    K
Sbjct: 60  MPNDKIDTAIKK-GTGELAGGDISEVMYEGYGPGGVAILVEAATDNKNRTVAEVRHALGK 118

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---D 175
             GS+G  G     F++ G +++ +     +  +E+ +E+ A +V+ ED+    +C   D
Sbjct: 119 GGGSMGEAGCVAWMFDKKGVMVFDAEKYTEDQLLEIGLEAGAEDVIAEDESLEVHCMPED 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F+ V    K  E    EA+S  + + P N + + +    K ++ ++E LED+DDVQ+V+ 
Sbjct: 179 FSEV---QKAFEAAECEAKSSDLAFVPKNLVEV-DVPTAKKLMNLMEKLEDNDDVQNVHV 234

Query: 236 NLEIADDII 244
           N +  D+++
Sbjct: 235 NADFPDELM 243


>gi|238754858|ref|ZP_04616208.1| hypothetical protein yruck0001_15660 [Yersinia ruckeri ATCC 29473]
 gi|238706869|gb|EEP99236.1| hypothetical protein yruck0001_15660 [Yersinia ruckeri ATCC 29473]
          Length = 247

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 148/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPAANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V +++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDTVMDAALEAGADDVTVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+S +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGQVKDALDAAGLVAESAEVSLIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|62180477|ref|YP_216894.1| hypothetical protein SC1907 [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224583596|ref|YP_002637394.1| hypothetical protein SPC_1814 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75482767|sp|Q57N98|YEBC_SALCH RecName: Full=UPF0082 protein yebC
 gi|62128110|gb|AAX65813.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|224468123|gb|ACN45953.1| hypothetical protein SPC_1814 [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|322714952|gb|EFZ06523.1| UPF0082 protein yebC [Salmonella enterica subsp. enterica serovar
           Choleraesuis str. A50]
          Length = 246

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LEE   +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEEAGLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|257455417|ref|ZP_05620652.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
 gi|257447379|gb|EEV22387.1| conserved hypothetical protein [Enhydrobacter aerosaccus SK60]
          Length = 249

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 147/245 (60%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA K KIF+K+ RE+  +AK    +P  NPRLR A++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDAAKGKIFTKIIRELVSAAKQGDPDPASNPRLRAAVEKANSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ ++RAI++ AG  D  N   I YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 61  MTKDTVKRAIERGAGGGDNDNMQEITYEGYGLGGVAVIVETMTDNLNRTVGEVRHAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++GS    F + GEI +  ++   +  MEVA+E+ A ++           +  N 
Sbjct: 121 GGNLGTSGSVAYMFSKRGEITF-DDVSLEDTIMEVALEAGATDIENNGDSITVVTEPENF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     LE+   ++ + +V   P     +++ +  K I+KMI+ LED DDVQ VY+N+  
Sbjct: 180 GDVMDALEKAGLKSDNAEVTMSPSTMADVTDVEDAKKIMKMIDMLEDLDDVQEVYTNVNF 239

Query: 240 ADDII 244
            DD++
Sbjct: 240 TDDVM 244


>gi|90580114|ref|ZP_01235922.1| hypothetical protein VAS14_18051 [Vibrio angustum S14]
 gi|90438999|gb|EAS64182.1| hypothetical protein VAS14_18051 [Vibrio angustum S14]
          Length = 248

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 147/246 (59%), Gaps = 6/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+F NI HRK  +DA + KIF+KL REITV+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKFANIKHRKAAQDAKRGKIFTKLIREITVAAKEGGSEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RA+ +   G  D G  T I YEGYGP G A+++E LTDNRNRT S +R  F+K
Sbjct: 61  MTRDTINRAVTRGAGGEGDEGVETVI-YEGYGPAGTAVMVECLTDNRNRTVSGVRHAFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFN 177
           A G+LG+ GS +  F++ G I Y + + D +  MEVA+ES A ++   D   I  Y    
Sbjct: 120 AGGNLGTDGSVSYLFDKKGVISYAAGL-DEDAVMEVALESGADDIETNDDGSIEVYTTPA 178

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     L+     A++ +V   P     L +      ++++I+ LED DD+Q VY N 
Sbjct: 179 DFGSVKDALDAAGFTAENAEVTLVPSTKAEL-DVTTAPKLLRLIDALEDLDDIQEVYHNG 237

Query: 238 EIADDI 243
           +++D++
Sbjct: 238 DMSDEV 243


>gi|256851420|ref|ZP_05556809.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260660841|ref|ZP_05861756.1| UPF0082 protein [Lactobacillus jensenii 115-3-CHN]
 gi|282933130|ref|ZP_06338517.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           jensenii 208-1]
 gi|297206234|ref|ZP_06923629.1| glucose-1-phosphate adenylyl transferase [Lactobacillus jensenii
           JV-V16]
 gi|256616482|gb|EEU21670.1| conserved hypothetical protein [Lactobacillus jensenii 27-2-CHN]
 gi|260548563|gb|EEX24538.1| UPF0082 protein [Lactobacillus jensenii 115-3-CHN]
 gi|281302634|gb|EFA94849.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           jensenii 208-1]
 gi|297149360|gb|EFH29658.1| glucose-1-phosphate adenylyl transferase [Lactobacillus jensenii
           JV-V16]
          Length = 242

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/241 (42%), Positives = 149/241 (61%), Gaps = 11/241 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSREI ++AK  G +P  NP LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKLSREIYMAAKSGGPDPSGNPALRLVMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAIKKA      +Y  I YEGY P GVA+++EALTDN+NRTA+S+R+ FT+  
Sbjct: 61  MPKDNIQRAIKKAEGGSEEHYDEITYEGYAPGGVAVLVEALTDNKNRTATSVRTAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCD-- 175
           GSLG+TGS    F++ G I+   +  D++   + M+V +++ A ++   D  Y  Y D  
Sbjct: 121 GSLGATGSVAYMFDRKGYIVIDRSTTDADEDQMLMDV-MDAGADDLQTSDDAYEIYTDAK 179

Query: 176 -FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
            F  V    +K   K+ +A+   +   P N   +  ADK +    +I+ LEDDDDV +VY
Sbjct: 180 EFTGVRDALEKAGYKLADAELTMI---PQNTTPVP-ADKKEQFAHLIDALEDDDDVSNVY 235

Query: 235 S 235
           +
Sbjct: 236 T 236


>gi|86608824|ref|YP_477586.1| hypothetical protein CYB_1350 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|119391259|sp|Q2JLT1|Y1350_SYNJB RecName: Full=UPF0082 protein CYB_1350
 gi|86557366|gb|ABD02323.1| conserved hypothetical protein TIGR01033 [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 249

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/251 (39%), Positives = 147/251 (58%), Gaps = 13/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA K  +F+KLSR I V+A+    +P  N +LR A++ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAKKGSLFTKLSRAIIVAARNGLPDPDGNFQLRAAVEKAKAAG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTN------IRYEGYGPEGVAIIIEALTDNRNRTASSIRS 114
           MP ENIERAI K      GN+++      +RYEGYGP GVA++IEA+TDNRNRTA+ +R 
Sbjct: 61  MPSENIERAIAKGA----GNWSDDSPLEEVRYEGYGPGGVAVLIEAMTDNRNRTAAEVRE 116

Query: 115 IFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVA-IESDAFEVLFEDQEYIFY 173
            F+K  GSLG  G  +  F Q G I     +    L + VA    D F+V     E   Y
Sbjct: 117 AFSKTGGSLGEAGCVSWLFRQKGVISLEEVLDPEALLLAVAEAGGDDFKVEGTGAE--VY 174

Query: 174 CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           CD++ +   +  L+++    Q   + W P   + + + D  KS++ ++E L++ DDVQ+V
Sbjct: 175 CDYSLLEQVATYLKKEGYPVQDAAIRWIPSTEVHVEDPDTAKSVLALMERLDNLDDVQNV 234

Query: 234 YSNLEIADDII 244
           Y+N EI + ++
Sbjct: 235 YANFEIDEAVM 245


>gi|262278841|ref|ZP_06056626.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
 gi|262259192|gb|EEY77925.1| conserved hypothetical protein [Acinetobacter calcoaceticus
           RUH2202]
          Length = 249

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 148/245 (60%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +A+L G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAARLGGGDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   + YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGEDNDDLKEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  ++   +  MEVA+E+ A ++   + E +        
Sbjct: 121 NGNLGTAGSVAYLFTKRGEITFE-DVSLEDKIMEVALEAGAEDIEISEDEILVITSPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+  ED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALTAAGLKSDNAEVVMSPSTKAEITDVDQAKQILKMIDMFEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
            D+++
Sbjct: 240 TDEVL 244


>gi|299770474|ref|YP_003732500.1| hypothetical protein AOLE_11190 [Acinetobacter sp. DR1]
 gi|298700562|gb|ADI91127.1| hypothetical protein AOLE_11190 [Acinetobacter sp. DR1]
          Length = 249

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 148/245 (60%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +AKL G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGGDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   + YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGEDNDDLKEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  ++   +  ME+A+E+ A ++   + E +        
Sbjct: 121 NGNLGTAGSVAYLFTKRGEITFE-DVSLEDKIMEIALEAGAEDIEVSEDEILVITSPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+  ED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALTAAGLKSNNAEVVMSPSTKAEITDVDQAKQILKMIDMFEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
            D+++
Sbjct: 240 TDEVL 244


>gi|255319220|ref|ZP_05360437.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262379722|ref|ZP_06072878.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
 gi|255303613|gb|EET82813.1| conserved hypothetical protein [Acinetobacter radioresistens SK82]
 gi|262299179|gb|EEY87092.1| conserved hypothetical protein [Acinetobacter radioresistens SH164]
          Length = 249

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 151/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +AKL G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAAKLGGPDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   I YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGEDNDDLKEITYEGYGTGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG++GS    F + GEI +  ++      +EVA+E+ A ++   + E +      + 
Sbjct: 121 NGNLGTSGSVAYLFTKRGEISF-DDLSLEEKILEVALEAGAEDIEISEDEILVITTPESF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 180 GDVQDALSAAGLKSDNAEVVMSPSTKAEITDIDQAKQIMKMIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +D+++
Sbjct: 240 SDEVL 244


>gi|157145357|ref|YP_001452676.1| hypothetical protein CKO_01097 [Citrobacter koseri ATCC BAA-895]
 gi|166228559|sp|A8AFH7|Y1097_CITK8 RecName: Full=UPF0082 protein CKO_01097
 gi|157082562|gb|ABV12240.1| hypothetical protein CKO_01097 [Citrobacter koseri ATCC BAA-895]
          Length = 246

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ F+D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEQ--GDEDTIMEAALEAGAEDVVTFDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADNAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|262041980|ref|ZP_06015162.1| YebC like protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
 gi|259040678|gb|EEW41767.1| YebC like protein [Klebsiella pneumoniae subsp. rhinoscleromatis
           ATCC 13884]
          Length = 246

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I +    GD +  ME A+E+ A + V+++D     Y  +  
Sbjct: 121 GGNLGTDGSVSYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVIYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADAAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|89895216|ref|YP_518703.1| hypothetical protein DSY2470 [Desulfitobacterium hafniense Y51]
 gi|219669647|ref|YP_002460082.1| hypothetical protein Dhaf_3629 [Desulfitobacterium hafniense DCB-2]
 gi|119391309|sp|Q24UN3|Y2470_DESHY RecName: Full=UPF0082 protein DSY2470
 gi|254765084|sp|B8FQV9|Y3629_DESHD RecName: Full=UPF0082 protein Dhaf_3629
 gi|89334664|dbj|BAE84259.1| hypothetical protein [Desulfitobacterium hafniense Y51]
 gi|219539907|gb|ACL21646.1| protein of unknown function DUF28 [Desulfitobacterium hafniense
           DCB-2]
          Length = 252

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 155/246 (63%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K + DA K KIF+KL RE+ V+A+  G +P  N RL++AI NAK+ +
Sbjct: 1   MSGHSKWANIKHKKAKADAQKGKIFTKLGRELIVAARAGGGDPNNNFRLKIAIDNAKSAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAI+K  G  +  +Y  +RYEGYGP GVAI+++ +TDNRNRTA  +R IF+K 
Sbjct: 61  MPNDNIQRAIQKGVGGGEGESYEELRYEGYGPGGVAIMVDIMTDNRNRTAGEVRHIFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGE--IIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            G+LG TG     F + G+  I+      D +  M + +E+ A ++  +++ ++ Y    
Sbjct: 121 GGNLGETGCVNWMFTEKGQLMILKEDLKCDEDELMLLVLEAGAEDLQQDEESFVVYTAPG 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++    + L ++    +  K+   P N I +++ ++ K +++M+E LED DD Q VY+N 
Sbjct: 181 DMEAVRQALLDQGIAIEEAKINQVPQNTIEIADLEQAKKLVRMMELLEDHDDSQGVYANF 240

Query: 238 EIADDI 243
           E AD I
Sbjct: 241 EFADSI 246


>gi|189184285|ref|YP_001938070.1| hypothetical protein OTT_1378 [Orientia tsutsugamushi str. Ikeda]
 gi|226734131|sp|B3CTY9|Y1378_ORITI RecName: Full=UPF0082 protein OTT_1378
 gi|189181056|dbj|BAG40836.1| hypothetical protein OTT_1378 [Orientia tsutsugamushi str. Ikeda]
          Length = 249

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 154/244 (63%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNI HRK  +D  K+K+F+ L REI++SAK SG +   NPRLR AI  AK  +
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKKAKLFASLVREISLSAK-SGADIQYNPRLRAAISAAKFNN 59

Query: 61  MPKENIERAIKKAGS-DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE+AI  A + D+  NY  I YEG   +G+AII+EALTDN NRTA+++R+IF+K 
Sbjct: 60  LPKDRIEKAIAHANNKDNYENYFEITYEGIIFDGIAIIVEALTDNTNRTAANVRAIFSKY 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+L  TG+ +  F+++G I + S +  S    + AIE  A ++  +++ ++ Y      
Sbjct: 120 GGNLVGTGNASFLFDRLGIIKFESKVSTSEELFDAAIELGAEDIELDEEYHVVYTPIKLF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               ++L +  G      + W+P N + +S+ +K + +IK++  L+D+DDVQ  + N E 
Sbjct: 180 TNIIEELAQLFGYPVESYIGWRPRNTVLISDTEKAQKLIKLVNALDDNDDVQRFFGNYEF 239

Query: 240 ADDI 243
           ++ I
Sbjct: 240 SEQI 243


>gi|332298168|ref|YP_004440090.1| UPF0082 protein yeeN [Treponema brennaborense DSM 12168]
 gi|332181271|gb|AEE16959.1| UPF0082 protein yeeN [Treponema brennaborense DSM 12168]
          Length = 246

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 151/242 (62%), Gaps = 8/242 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H K   DA + ++F+K  +EI+++A++ G +P  NPRLR A+  A+  +
Sbjct: 1   MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISIAARMGGGDPGSNPRLRTAMLKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NIERAIKK G+ +LG   +    YEGYGP GVAI++E LTDN NR A+++R+IF+K
Sbjct: 61  MPKDNIERAIKK-GTGELGGAIFEEKLYEGYGPGGVAILVEVLTDNNNRAAANVRNIFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+LG+TGS    F + G I Y +     +  ME A+E+ A +++ ED       D + 
Sbjct: 120 TGGNLGATGSVAYMFNRKGVIEYDAEAVSEDEVMEAALEAGAEDIVSEDGVVTVTTDPSA 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNY--IRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                + L+ K  E+ S +V   P  Y  I +  A KV+   K+I+ LE+DDDVQ+VYSN
Sbjct: 180 FESVLEALQNKGYESVSAEVAMVPDMYSAIDMETATKVQ---KLIDRLEEDDDVQNVYSN 236

Query: 237 LE 238
            E
Sbjct: 237 AE 238


>gi|330829086|ref|YP_004392038.1| protein YebC [Aeromonas veronii B565]
 gi|328804222|gb|AEB49421.1| Protein YebC [Aeromonas veronii B565]
          Length = 246

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/246 (41%), Positives = 147/246 (59%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REIT SA+L   +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIREITTSARLGDADPANNPRLRAAVTAALTNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG  D      I YEGYGP G A+++E LTDNRNRT + +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGGDGEQLETIVYEGYGPAGSAVMVECLTDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYI-FYCDFN 177
            G+LG+ GS    F + G + +   +G D +  M+ A+E+ A +V+ E+   I  Y   N
Sbjct: 121 GGNLGTDGSVAYLFSKKGLLTF---VGVDEDALMDAALEAGADDVVTEEDGTIEVYTTPN 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     LE    +AQS +V   P     L +A+    ++++I+ LED DDVQ VY N 
Sbjct: 178 DFGTVLDGLEAAGFKAQSAEVTMIPSTEAEL-DAETAPKLMRLIDMLEDLDDVQEVYHNG 236

Query: 238 EIADDI 243
            I+D++
Sbjct: 237 SISDEV 242


>gi|300813070|ref|ZP_07093448.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           delbrueckii subsp. bulgaricus PB2003/044-T3-4]
 gi|300495911|gb|EFK31055.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           delbrueckii subsp. bulgaricus PB2003/044-T3-4]
          Length = 243

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 146/238 (61%), Gaps = 5/238 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPSGNPSLRLVMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+N++RAIKKA  +   +Y  + YEGY P GVAI++EALTDN+NRTASS+R  FT+  
Sbjct: 61  MPKDNVQRAIKKAEGNSDEHYDEVTYEGYAPGGVAILVEALTDNKNRTASSVRVAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           GSLG+TGS    F++ G I+   +  D++   + M+V +E+   ++   D  Y  Y D  
Sbjct: 121 GSLGATGSVAYMFDRKGYIVIDRSTTDADEDQMLMDV-MEAGGDDLQTSDDAYEIYTDAK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           +       LE+   +    ++   P N   +  ADK +   K+++ LEDDDDV +VY+
Sbjct: 180 SFTAVRDALEKAGYQLAVSELTMVPQNTTPVP-ADKKEQFEKLVDALEDDDDVSNVYT 236


>gi|152970925|ref|YP_001336034.1| hypothetical protein KPN_02378 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206578852|ref|YP_002237745.1| conserved hypothetical protein TIGR01033 [Klebsiella pneumoniae
           342]
 gi|238895440|ref|YP_002920175.1| hypothetical protein KP1_3508 [Klebsiella pneumoniae NTUH-K2044]
 gi|288934603|ref|YP_003438662.1| hypothetical protein Kvar_1727 [Klebsiella variicola At-22]
 gi|290508804|ref|ZP_06548175.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
 gi|330001140|ref|ZP_08303907.1| DNA-binding regulatory protein, YebC/PmpR family [Klebsiella sp. MS
           92-3]
 gi|166987441|sp|A6TB33|Y2343_KLEP7 RecName: Full=UPF0082 protein KPN78578_23430
 gi|226732152|sp|B5XQ02|Y1906_KLEP3 RecName: Full=UPF0082 protein KPK_1906
 gi|150955774|gb|ABR77804.1| hypothetical protein KPN_02378 [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206567910|gb|ACI09686.1| conserved hypothetical protein TIGR01033 [Klebsiella pneumoniae
           342]
 gi|238547757|dbj|BAH64108.1| hypothetical protein KP1_3508 [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
 gi|288889312|gb|ADC57630.1| protein of unknown function DUF28 [Klebsiella variicola At-22]
 gi|289778198|gb|EFD86195.1| conserved hypothetical protein [Klebsiella sp. 1_1_55]
 gi|328537786|gb|EGF63985.1| DNA-binding regulatory protein, YebC/PmpR family [Klebsiella sp. MS
           92-3]
          Length = 246

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVSYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADAAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|169334008|ref|ZP_02861201.1| hypothetical protein ANASTE_00400 [Anaerofustis stercorihominis DSM
           17244]
 gi|169258725|gb|EDS72691.1| hypothetical protein ANASTE_00400 [Anaerofustis stercorihominis DSM
           17244]
          Length = 256

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/255 (40%), Positives = 152/255 (59%), Gaps = 24/255 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K + DA K KI++K+++ I V+A+  G +P  N +L+ AI  AK+ +
Sbjct: 10  MSGHSKWSTIKHKKAKTDAQKGKIYTKMAKLIAVAAREGGADPDLNAKLKDAIAKAKSNN 69

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NIERAIKK G+ +LGN  +  I YEGYG  GVA+I+EALTDN+NRTA  +R  F K
Sbjct: 70  MPNDNIERAIKK-GAGELGNSVFEEITYEGYGIGGVAVIVEALTDNKNRTAGDVRYYFDK 128

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHS--NIGDSNLAMEVAIES---------DAFEVLFED 167
             G+LG++G  +  FE+ G I+  +  N+ +  L M +A++S         D FE+    
Sbjct: 129 NGGNLGTSGCVSFMFEKKGTILVDNDGNVDEEELMM-IALDSGAEDFDVSDDGFEITTTP 187

Query: 168 QEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDD 227
           + +   CD          LEE + +  S  V   P NY +L +  ++K   KM+E  ED+
Sbjct: 188 ETFSKVCD---------ALEENVIKTASASVEMVPSNYTKLEDEAQIKKFEKMLEMFEDN 238

Query: 228 DDVQSVYSNLEIADD 242
           DDVQ VY N E  DD
Sbjct: 239 DDVQDVYHNAEFPDD 253


>gi|261340249|ref|ZP_05968107.1| protein YebC [Enterobacter cancerogenus ATCC 35316]
 gi|288317334|gb|EFC56272.1| protein YebC [Enterobacter cancerogenus ATCC 35316]
          Length = 246

 Score =  179 bits (455), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD ++ ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDVIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|170769424|ref|ZP_02903877.1| conserved hypothetical protein [Escherichia albertii TW07627]
 gi|170121748|gb|EDS90679.1| conserved hypothetical protein [Escherichia albertii TW07627]
          Length = 246

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  +   I YEGYGP G AI++E L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDGADMETIIYEGYGPGGTAIMVECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|251789860|ref|YP_003004581.1| hypothetical protein Dd1591_2260 [Dickeya zeae Ech1591]
 gi|247538481|gb|ACT07102.1| protein of unknown function DUF28 [Dickeya zeae Ech1591]
          Length = 247

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFSKKGVISYAPGL-DEDTVMDAALEAGADDVVSYDDGAIDVFTPWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     + +AD    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGQVKDALDAAGLVAESAEVSMIPSTKADM-DADTAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|227111610|ref|ZP_03825266.1| hypothetical protein PcarbP_01535 [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227329755|ref|ZP_03833779.1| hypothetical protein PcarcW_21418 [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 247

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDAVMDAALEAGADDVVTYDDGAIDVFTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A+S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGDVKDALDAAGLKAESAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|229592303|ref|YP_002874422.1| hypothetical protein PFLU4916 [Pseudomonas fluorescens SBW25]
 gi|229364169|emb|CAY51825.1| conserved hypothetical protein [Pseudomonas fluorescens SBW25]
          Length = 248

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 149/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRKER+DA K KIF+K  RE+TV+A+  G +P  NPRLRLA+  A   +
Sbjct: 1   MAGHSKWANIKHRKERQDAKKGKIFTKWIRELTVAARQGGGDPGSNPRLRLALDKALGAN 60

Query: 61  MPKENIE-RAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+    + AG+ D  +   + YEGYGP GVA+++E +TDNRNRTA+++R  F+K 
Sbjct: 61  MSRDIIDRAVARGAGAADTDDMVELTYEGYGPGGVAVMVECMTDNRNRTAAAVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G+I +     D +  ME A+E+DA +V+  ED     +  F  
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPGT-DEDALMEAAMEADADDVVTNEDGSIDVFTSFAG 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +    +++  P     L + D  + ++KM++ LED DDVQ+VYSN +
Sbjct: 180 FYAVRNALEAAGFKGTDAEIVMLPTTSAEL-DLDGAQKVLKMLDMLEDLDDVQNVYSNAD 238

Query: 239 IADDI 243
           I + +
Sbjct: 239 IPESV 243


>gi|187251558|ref|YP_001876040.1| hypothetical protein Emin_1151 [Elusimicrobium minutum Pei191]
 gi|226696237|sp|B2KDV7|Y1151_ELUMP RecName: Full=UPF0082 protein Emin_1151
 gi|186971718|gb|ACC98703.1| Conserved hypothetical protein DUF28 [Elusimicrobium minutum
           Pei191]
          Length = 250

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 149/245 (60%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M GHS +  I H+K   D+ + K+F+++ REIT++AK+ G     NPRLR A+++AK  +
Sbjct: 1   MGGHSHWAGIKHKKALLDSKRGKVFTRIIREITIAAKMGGAELENNPRLRKAVEDAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAI K  G  +   Y  I YEGYGP  +A+I++  TDN+NRT S IR IFT  
Sbjct: 61  MPADNIKRAIMKGTGQLEGATYEEITYEGYGPSSIAVIVDCTTDNKNRTFSEIRKIFTSR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GS+G+TG  +  F++ G II +         M++AIE+ A ++  E + +  +    ++
Sbjct: 121 GGSIGTTGCVSYMFKKKGLIIINKETISEESLMDIAIEAGADDIKSESEVHEVFTAPESL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
            +  K LEEK  + +S  +   P     +++ +  +SI+KM++ L+D DD ++VYSN  I
Sbjct: 181 DIVKKALEEKGVKTESATLTMIPDTETEITDENAAQSIMKMMDELDDHDDTKAVYSNYNI 240

Query: 240 ADDII 244
            D+I+
Sbjct: 241 PDEIM 245


>gi|33597014|ref|NP_884657.1| hypothetical protein BPP2422 [Bordetella parapertussis 12822]
 gi|33600856|ref|NP_888416.1| hypothetical protein BB1871 [Bordetella bronchiseptica RB50]
 gi|49036533|sp|Q7WL78|Y1871_BORBR RecName: Full=UPF0082 protein BB1871
 gi|49037284|sp|Q7W7T8|Y2422_BORPA RecName: Full=UPF0082 protein BPP2422
 gi|33566465|emb|CAE37718.1| conserved hypothetical protein [Bordetella parapertussis]
 gi|33568456|emb|CAE32368.1| conserved hypothetical protein [Bordetella bronchiseptica RB50]
          Length = 243

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 146/239 (61%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRMAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG  D  +Y  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIQRAIQRGAGGADGESYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +  + ME A+E+ A ++  +++  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFVFAPGTSEEAV-MEAALEAGAEDIATDEEGVIEVVCAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                +  E    +A+   V+ K LN   L+  D VK + K+++ LE  DDVQ VY+N+
Sbjct: 180 FTAVRQAFEAAGLKAEVDGVVMKALNETELTGEDAVK-MQKLLDVLESLDDVQEVYTNV 237


>gi|37522076|ref|NP_925453.1| hypothetical protein glr2507 [Gloeobacter violaceus PCC 7421]
 gi|49037281|sp|Q7NHM8|Y2507_GLOVI RecName: Full=UPF0082 protein glr2507
 gi|35213075|dbj|BAC90448.1| glr2507 [Gloeobacter violaceus PCC 7421]
          Length = 251

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 149/247 (60%), Gaps = 4/247 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++  I  +K + D  K  +F++LSREI V+ +L G +P  N RLRLAI+ AK  S
Sbjct: 1   MAGHSKWAQIKRQKAKNDVAKGAMFARLSREIIVATRLGGPDPAGNFRLRLAIEQAKAAS 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P ENI+RAI K +G+ +  N+  IRYEGYGP GVAI+IEA TDNRNRT + +R++F++ 
Sbjct: 61  LPGENIQRAIDKGSGAIEGDNFEEIRYEGYGPAGVAILIEAQTDNRNRTVADLRAVFSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLFEDQEYIFYCDFN 177
            G+LG TG     F+Q G  +    + +  L +E A++  A  +E+  + Q     C+  
Sbjct: 121 GGNLGETGCVGWMFQQRGVAVLEGPVREEEL-IEAALDGGALGYEIDPQGQGVEVTCEAA 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++   +  L+       + +V W P N I L++ D  + ++ ++E LE  DDVQ V +N 
Sbjct: 180 DLEALTDALKGAGFRLAAAEVRWVPDNNIELADPDVARQVLTLLEKLESLDDVQRVSANH 239

Query: 238 EIADDII 244
            + D ++
Sbjct: 240 LVEDAVL 246


>gi|119356375|ref|YP_911019.1| hypothetical protein Cpha266_0538 [Chlorobium phaeobacteroides DSM
           266]
 gi|166227317|sp|A1BDW8|Y538_CHLPD RecName: Full=UPF0082 protein Cpha266_0538
 gi|119353724|gb|ABL64595.1| protein of unknown function DUF28 [Chlorobium phaeobacteroides DSM
           266]
          Length = 250

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 148/244 (60%), Gaps = 5/244 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A++ S
Sbjct: 1   MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGADPGGNPRLRLAIDTARSNS 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI RA+KK   +  G  Y  I YEGYGP G+A+IIE  TDNRNRT + IR I ++ 
Sbjct: 61  MPMENILRAVKKGTGELEGVTYDEITYEGYGPAGIALIIETATDNRNRTVADIRHIMSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDFN 177
           NGSLG +GS +  F + G +    +    ++ +E+ +++   E L  D    Y    D  
Sbjct: 121 NGSLGESGSVSWMFHRKGSLDVSKSAVSEDMLLEILLDA-GLEDLESDDAIYYTVITDLK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++    K L+      ++ ++   P NYI L   D  K +I++I+ LE++DDVQ+VYSN+
Sbjct: 180 DLETVKKALDAAAIPFENARIDMIPENYIELEAEDASK-VIRIIDALENNDDVQAVYSNM 238

Query: 238 EIAD 241
           EI++
Sbjct: 239 EISE 242


>gi|262368435|ref|ZP_06061764.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
 gi|262316113|gb|EEY97151.1| conserved hypothetical protein [Acinetobacter johnsonii SH046]
          Length = 249

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 152/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  RE+T +AKL G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKLFTKFIRELTTAAKLGGGDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   I YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDVINRAIQRGAGGEDNDDLKEITYEGYGVGGVAVIVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ GS    F + GEI +  ++   +  M+VA+E+ A ++  ++ E +      + 
Sbjct: 121 DGNLGTNGSVAFLFTKRGEITFE-DVSLEDQIMDVALEAGAEDIEVDEDEILVITTPESF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 180 GDVQDALTAAGLKSDNAEVVMSPSTKAEITDIDQAKKIMKMIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +D ++
Sbjct: 240 SDAVL 244


>gi|261343865|ref|ZP_05971510.1| protein YebC [Providencia rustigianii DSM 4541]
 gi|282568252|gb|EFB73787.1| protein YebC [Providencia rustigianii DSM 4541]
          Length = 247

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDDNDNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y  F  
Sbjct: 121 GGNLGTDGSVSYLFTKRGVITYAPGV-DEDALMEAALEAGADDVETYDDGAIDVYTTFET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     +++ +V   P     L + +    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGAVKDALDAAGFTSEAAEVSMIPSITAEL-DVETAPKLMRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|269838390|ref|YP_003320618.1| hypothetical protein Sthe_2376 [Sphaerobacter thermophilus DSM
           20745]
 gi|269787653|gb|ACZ39796.1| protein of unknown function DUF28 [Sphaerobacter thermophilus DSM
           20745]
          Length = 248

 Score =  179 bits (453), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 147/238 (61%), Gaps = 3/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++  I  +K   D  K   FSK++REI V+ +  G NP  N RLR+A++ AK + 
Sbjct: 1   MAGHSKWAQIKRQKAAADFKKGATFSKIAREIHVAVREGGPNPDANLRLRMALERAKREG 60

Query: 61  MPKENIERAIKKA--GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP + IERAI KA     D  NY  + YEGYGP GVA++  ALTDNRNRTAS +R  F++
Sbjct: 61  MPNDTIERAIAKASGAGADAENYETVIYEGYGPGGVAVLAVALTDNRNRTASEVRHAFSR 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            NG+LG TG     FE +G+I+  ++  D++    +AI++ A +V  E+ E I   D + 
Sbjct: 121 HNGTLGETGCVAWQFETVGQIVISADGVDADEVALLAIDAGATDVETENGEIIITTDPSE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           +G  +++L+E     Q+ ++   P   + + +  + ++ +K++E LED DDVQ+VY+N
Sbjct: 181 LGDVTERLKEAGLTIQAAEIQRVPQASVDV-DGSQAQATLKLLEALEDLDDVQAVYTN 237


>gi|15643232|ref|NP_228276.1| hypothetical protein TM0466 [Thermotoga maritima MSB8]
 gi|4980974|gb|AAD35550.1|AE001724_8 conserved hypothetical protein [Thermotoga maritima MSB8]
          Length = 254

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 149/243 (61%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA KSKIF+KL REI V+A+  G N   NPRLR A++ A+ ++
Sbjct: 2   MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPRLRAAVERARAEN 61

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIK+   +  G +Y  + YEGY P GVA+ I ALTDN+NRTA  +R +F K 
Sbjct: 62  MPKENIERAIKRGTGELEGVDYQEVIYEGYAPGGVAVYIRALTDNKNRTAQELRHLFNKY 121

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS +  FE+ G I I    + D    M +AI++ A ++   +          N
Sbjct: 122 GGSLAESGSVSWIFERKGVIEISRDKVKDLEELMMIAIDAGAEDIKDAEDPIQIITAPEN 181

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +     KLEE   E ++ KV + P N ++++  D  K +++ +  LED DDVQ VYSN E
Sbjct: 182 LSEVKSKLEEAGYEVEA-KVTFIPKNTVKVTGKDAEK-VLEFLNALEDMDDVQEVYSNFE 239

Query: 239 IAD 241
           + D
Sbjct: 240 MDD 242


>gi|33517115|sp|Q9WYT7|Y466_THEMA RecName: Full=UPF0082 protein TM_0466
          Length = 253

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 149/243 (61%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA KSKIF+KL REI V+A+  G N   NPRLR A++ A+ ++
Sbjct: 1   MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPRLRAAVERARAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIK+   +  G +Y  + YEGY P GVA+ I ALTDN+NRTA  +R +F K 
Sbjct: 61  MPKENIERAIKRGTGELEGVDYQEVIYEGYAPGGVAVYIRALTDNKNRTAQELRHLFNKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS +  FE+ G I I    + D    M +AI++ A ++   +          N
Sbjct: 121 GGSLAESGSVSWIFERKGVIEISRDKVKDLEELMMIAIDAGAEDIKDAEDPIQIITAPEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +     KLEE   E ++ KV + P N ++++  D  K +++ +  LED DDVQ VYSN E
Sbjct: 181 LSEVKSKLEEAGYEVEA-KVTFIPKNTVKVTGKDAEK-VLEFLNALEDMDDVQEVYSNFE 238

Query: 239 IAD 241
           + D
Sbjct: 239 MDD 241


>gi|193212194|ref|YP_001998147.1| hypothetical protein Cpar_0525 [Chlorobaculum parvum NCIB 8327]
 gi|226707685|sp|B3QLZ4|Y525_CHLP8 RecName: Full=UPF0082 protein Cpar_0525
 gi|193085671|gb|ACF10947.1| protein of unknown function DUF28 [Chlorobaculum parvum NCIB 8327]
          Length = 251

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 101/247 (40%), Positives = 153/247 (61%), Gaps = 5/247 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL +EIT++AK+ G +P  NPRLRLAI  A+  S
Sbjct: 1   MSGHSKWATIKRKKAATDQKRGNLFTKLVKEITIAAKMGGGDPSGNPRLRLAIDTARANS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKK  G  +   Y  I YEGYGP G+AIIIE  TDNRNRT + IR + +++
Sbjct: 61  MPMDNIQRAIKKGTGELEGATYEEITYEGYGPGGIAIIIETATDNRNRTVADIRHLMSRS 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQE-YIFYCDFN 177
            GSLG  GS    F + G I +  S I + +L ME+ +++   E+  +D++ Y    D  
Sbjct: 121 GGSLGENGSVGWMFNRKGSIEVPKSAISEDDL-MELLLDAGLEELESDDEQYYTVLTDVK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++    K LEE     ++ K+   P NY+ L   D  K+ +K+I+ LE+ DD Q+VYSN+
Sbjct: 180 DLEPVKKALEEAEIPFENAKMDMIPDNYVELDVEDARKA-LKLIDALENSDDAQAVYSNM 238

Query: 238 EIADDII 244
           +I++ ++
Sbjct: 239 DISESVM 245


>gi|170288270|ref|YP_001738508.1| hypothetical protein TRQ2_0469 [Thermotoga sp. RQ2]
 gi|226706222|sp|B1L927|Y469_THESQ RecName: Full=UPF0082 protein TRQ2_0469
 gi|170175773|gb|ACB08825.1| protein of unknown function DUF28 [Thermotoga sp. RQ2]
          Length = 253

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 149/243 (61%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA KSKIF+KL REI V+A+  G N   NPRLR A++ A+ ++
Sbjct: 1   MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPRLRAAVERARAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIK+   +  G +Y  + YEGY P GVA+ I ALTDN+NRTA  +R +F K 
Sbjct: 61  MPKENIERAIKRGTGELEGVDYQEVIYEGYAPGGVAVYIRALTDNKNRTAQELRHLFNKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS +  FE+ G I I    + D    M +AI++ A ++   +          N
Sbjct: 121 GGSLAESGSVSWIFERKGVIEISRDKVKDLEELMMIAIDAGAEDIKDTEDPIQIITAPEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +     KLEE   E ++ KV + P N ++++  D  K +++ +  LED DDVQ VYSN E
Sbjct: 181 LSEVKSKLEEAGYEVEA-KVTFIPKNTVKVTGKDAEK-VLEFLNALEDMDDVQEVYSNFE 238

Query: 239 IAD 241
           + D
Sbjct: 239 MDD 241


>gi|188586415|ref|YP_001917960.1| protein of unknown function DUF28 [Natranaerobius thermophilus
           JW/NM-WN-LF]
 gi|226695972|sp|B2A5L8|Y1800_NATTJ RecName: Full=UPF0082 protein Nther_1800
 gi|179351102|gb|ACB85372.1| protein of unknown function DUF28 [Natranaerobius thermophilus
           JW/NM-WN-LF]
          Length = 250

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/258 (41%), Positives = 159/258 (61%), Gaps = 25/258 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R D  + K+FSKLS+EI V+AK  G +P +N RLR+A+Q AK  +
Sbjct: 1   MAGHSKWANIKHKKARVDEKRGKLFSKLSKEIIVAAKEGGGDPEKNFRLRMAVQKAKENN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERAIKK   +  G NY  I YEGYGP GVAI ++A+TDN+NRTAS +R IFTK 
Sbjct: 61  MPNDNIERAIKKGTGELKGFNYEEISYEGYGPGGVAIFLDAMTDNKNRTASEVRHIFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH----SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCD 175
           +G+LG  G     F++ G I        NI +  L +  A      E   ED    F  D
Sbjct: 121 DGNLGEDGCVAWMFDRKGLITIDKEQAENIDEEELMLLTA------EAGAED----FKSD 170

Query: 176 FNNVGL-TSKKLEEKIGEA---QSIKVIWK-----PLNYIRLSNADKVKSIIKMIENLED 226
            N++ + T+ +  E++ EA   + + + +K     P N +++   ++ K +++++E LED
Sbjct: 171 NNSIEIVTTPQDFEQVREALENEEVPLSYKEVTMIPSNTVKVE-GEEAKKVLQLMEELED 229

Query: 227 DDDVQSVYSNLEIADDII 244
            DDVQ+VY+N +I D ++
Sbjct: 230 HDDVQNVYANFDIDDSLM 247


>gi|297171722|gb|ADI22714.1| uncharacterized conserved protein [uncultured verrucomicrobium
           HF0500_27H16]
          Length = 250

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 91/246 (36%), Positives = 151/246 (61%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++      K   DA + KIFS + +E+T++A+  G +P  NPRLR  I  AK  +
Sbjct: 1   MSGHSKWATTKRHKAAIDAKRGKIFSMVGKELTIAARDGGSDPEFNPRLRTCILKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYT--NIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NI+RAIKK G+ +LG      + YEGY P GV +I+E  TDN+NR+AS +RS FT+
Sbjct: 61  MPADNIDRAIKK-GTGELGGTIIEELTYEGYAPGGVGLIVEVTTDNKNRSASEVRSSFTR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+L   G+    F+++G+ +  ++  D +  ME+AIE+ A +V+  D  +   C+   
Sbjct: 120 HGGNLAGAGALAYSFQRMGQFLVSADKTDEDTLMEIAIEASAEDVINNDDHFEIQCEVQE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               S+ L EK  +  S ++++ P N + ++    V+ ++K+IE L+D DDV++V++N +
Sbjct: 180 FDKVSQALAEKNIQPDSAELVYLPGNLVSVAETGVVRQVLKLIEVLDDLDDVKAVHANYD 239

Query: 239 IADDII 244
           I D ++
Sbjct: 240 IDDSLL 245


>gi|322616899|gb|EFY13807.1| hypothetical protein SEEM315_16039 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618137|gb|EFY15029.1| hypothetical protein SEEM971_05408 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625808|gb|EFY22627.1| hypothetical protein SEEM973_09207 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626260|gb|EFY23070.1| hypothetical protein SEEM974_06015 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632674|gb|EFY29419.1| hypothetical protein SEEM201_06708 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639018|gb|EFY35711.1| hypothetical protein SEEM202_10408 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640458|gb|EFY37111.1| hypothetical protein SEEM954_10722 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644223|gb|EFY40768.1| hypothetical protein SEEM054_02947 [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649545|gb|EFY45977.1| hypothetical protein SEEM675_03606 [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655453|gb|EFY51761.1| hypothetical protein SEEM965_14328 [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660232|gb|EFY56470.1| hypothetical protein SEEM19N_06216 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662913|gb|EFY59120.1| hypothetical protein SEEM801_19092 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668098|gb|EFY64257.1| hypothetical protein SEEM507_21561 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674142|gb|EFY70236.1| hypothetical protein SEEM877_13418 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675504|gb|EFY71578.1| hypothetical protein SEEM867_03722 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683082|gb|EFY79098.1| hypothetical protein SEEM180_10987 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686776|gb|EFY82754.1| hypothetical protein SEEM600_18980 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323195333|gb|EFZ80513.1| hypothetical protein SEEM581_09044 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199225|gb|EFZ84320.1| hypothetical protein SEEM501_00615 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204050|gb|EFZ89065.1| hypothetical protein SEEM460_06835 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207481|gb|EFZ92429.1| hypothetical protein SEEM020_07248 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323217465|gb|EGA02184.1| hypothetical protein SEEM0077_21392 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221956|gb|EGA06346.1| hypothetical protein SEEM0047_10500 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224434|gb|EGA08722.1| hypothetical protein SEEM0055_06011 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231487|gb|EGA15600.1| hypothetical protein SEEM0052_14766 [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235929|gb|EGA20008.1| hypothetical protein SEEM3312_13729 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240499|gb|EGA24542.1| hypothetical protein SEEM5258_11026 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245391|gb|EGA29391.1| hypothetical protein SEEM1156_16671 [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323247811|gb|EGA31749.1| hypothetical protein SEEM9199_00854 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253610|gb|EGA37438.1| hypothetical protein SEEM8282_15583 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255039|gb|EGA38827.1| hypothetical protein SEEM8283_09076 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260272|gb|EGA43893.1| hypothetical protein SEEM8284_21635 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266863|gb|EGA50349.1| hypothetical protein SEEM8285_19099 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269069|gb|EGA52525.1| hypothetical protein SEEM8287_03882 [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
          Length = 246

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 145/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETITYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|293395806|ref|ZP_06640088.1| glucose-1-phosphate adenylyl transferase [Serratia odorifera DSM
           4582]
 gi|291421743|gb|EFE94990.1| glucose-1-phosphate adenylyl transferase [Serratia odorifera DSM
           4582]
          Length = 247

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDSNPRLRAAMDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  ME A+E+ A +++ ++D     Y  + N
Sbjct: 121 GGNLGTDGSVAYLFTKKGVITYAPGL-DEDTLMEAALEAGAEDIVTYDDGAIDVYTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L      A++ +V   P     + + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGEVKDALTAAGFTAEAAEVSMIPSTKADM-DEETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|300723089|ref|YP_003712387.1| hypothetical protein XNC1_2148 [Xenorhabdus nematophila ATCC 19061]
 gi|297629604|emb|CBJ90207.1| conserved hypothetical protein [Xenorhabdus nematophila ATCC 19061]
          Length = 247

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGEPDSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDDADNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y     
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYALGL-DEDAVMEAALEAGADDVETYDDGAIDVYTTPET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A S +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGEVKDALDAAGFKADSAEVSMIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|237731901|ref|ZP_04562382.1| yebC [Citrobacter sp. 30_2]
 gi|226907440|gb|EEH93358.1| yebC [Citrobacter sp. 30_2]
          Length = 247

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 145/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A++IE L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETIIYEGYGPGGTAVMIECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ F+D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEQ--GDEDAIMEAALEAGAEDVVTFDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADAAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|86143251|ref|ZP_01061653.1| hypothetical protein MED217_08715 [Leeuwenhoekiella blandensis
           MED217]
 gi|85830156|gb|EAQ48616.1| hypothetical protein MED217_08715 [Leeuwenhoekiella blandensis
           MED217]
          Length = 254

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 104/253 (41%), Positives = 152/253 (60%), Gaps = 17/253 (6%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN--PLENPRLRLAIQNAKN 58
           MAGHS++ NI HRK  +D  ++K F++  +EITV+ K + QN  P  NP LR AIQNAK 
Sbjct: 1   MAGHSKWANIKHRKGAQDKKRAKQFTRAIKEITVAIKENNQNGDPDSNPALRNAIQNAKG 60

Query: 59  QSMPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
            +MPK+ IERAIKKA   D  +Y  + +EGYGP G+A  IE  TDN NRT +S+RSIF+K
Sbjct: 61  VNMPKDTIERAIKKASGADADSYEQMTFEGYGPHGIAFFIECTTDNTNRTIASVRSIFSK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAM------EVAIESDAFEVLFEDQEYIF 172
             GSLG+ GS    F++ G       + + +  M      E   ES      FE+ E +F
Sbjct: 121 NGGSLGTNGSLEFLFDRKGVFTLDKAVIERDWEMLQLELIEGGAES------FENHEDVF 174

Query: 173 --YCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDV 230
             Y +F + G  ++ LEE   E ++ ++   PLN + L   ++ + I+ + E  EDDDDV
Sbjct: 175 VIYTEFTDFGKMAQHLEELNIETKNAELQRIPLNTVELP-INQAQQILNLAEKFEDDDDV 233

Query: 231 QSVYSNLEIADDI 243
           Q+V+  LE+++++
Sbjct: 234 QNVFHTLELSEEL 246


>gi|212711938|ref|ZP_03320066.1| hypothetical protein PROVALCAL_03013 [Providencia alcalifaciens DSM
           30120]
 gi|212685460|gb|EEB44988.1| hypothetical protein PROVALCAL_03013 [Providencia alcalifaciens DSM
           30120]
          Length = 247

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDDNDNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y  F  
Sbjct: 121 GGNLGTDGSVSYLFTKRGVITYAPGV-DEDALMEAALEAGADDVETYDDGAIDVYTTFET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     +++ +V   P     L + +    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGAVKDALDAAGFTSEAAEVSMIPSITAEL-DVETAPKLMRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|258593138|emb|CBE69449.1| conserved hypothetical protein; YebC-like [NC10 bacterium 'Dutch
           sediment']
          Length = 249

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 155/246 (63%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K + DA + ++F+KL REITV+A+  G +P  NPRLRLA++ AK  +
Sbjct: 1   MSGHSKWSGIKHKKAKVDAQRGRVFTKLIREITVAARAGGGDPDGNPRLRLAVEKAKAVN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP++NI+RAI+K   +  G +Y    YEGYGP GVA+++E +TDN+NRTA  IR  F K 
Sbjct: 61  MPQDNIQRAIQKGTGELPGTSYEEYIYEGYGPGGVAVLLEIVTDNKNRTAPEIRKAFAKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG +G     F++ G I  +++  D +  + V +E+ A +V   D  +       ++
Sbjct: 121 GGNLGESGCVAWMFDKKGLIQVYTSEADEDRLLGVVLEAGAEDVRRSDDTFEVITAPKDL 180

Query: 180 GLTSKKL-EEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 L +EKIG A+  +V   P N ++L    + + +++++E LE+ DDVQ+VY+N +
Sbjct: 181 ERVKASLTKEKIGIAEG-EVTMLPQNTVKL-EGKQAQQMLQLMETLEEHDDVQNVYANFD 238

Query: 239 IADDII 244
           I D+I+
Sbjct: 239 IPDEIM 244


>gi|119511449|ref|ZP_01630560.1| hypothetical protein N9414_16549 [Nodularia spumigena CCY9414]
 gi|119463914|gb|EAW44840.1| hypothetical protein N9414_16549 [Nodularia spumigena CCY9414]
          Length = 251

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 156/248 (62%), Gaps = 5/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K   DA K K F++LSR I ++A+    +P  N +LR AI  AK   
Sbjct: 1   MAGHSKWANIKRQKAVVDAKKGKTFAQLSRAIIIAARSGVPDPNLNFQLRTAIDKAKAAD 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+   D  ++  IRYEGYGP GVAI+IEALTDNRNRTA+ +R  F+
Sbjct: 61  IPNDNIERAIAKGAGTFGGDGASFEAIRYEGYGPGGVAILIEALTDNRNRTAADLRGAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA-FEVLFEDQEYIFYCDF 176
           K  G+LG TG  +  F+Q G +   S + D +  +E ++E  A F  + ED     +   
Sbjct: 121 KFGGNLGETGCVSWMFDQKG-VCVVSGVEDEDQLLEASLEGGAEFYEMSEDDMAEVFTQV 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           +N+ +  ++L +   +   I++ W P NYI + + ++ +S++K+I++LE  DDVQ+V +N
Sbjct: 180 SNLEVLGQRLRDTGFQVNDIELRWIPRNYIEVVDFEQGRSLLKLIDSLEGLDDVQNVTAN 239

Query: 237 LEIADDII 244
            +++D ++
Sbjct: 240 FDMSDSVL 247


>gi|283832738|ref|ZP_06352479.1| protein YebC [Citrobacter youngae ATCC 29220]
 gi|291072421|gb|EFE10530.1| protein YebC [Citrobacter youngae ATCC 29220]
          Length = 247

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A++IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETIIYEGYGPGGTAVMIECLSDNRNRTVAEVRHAFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVTMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|217967996|ref|YP_002353502.1| protein of unknown function DUF28 [Dictyoglomus turgidum DSM 6724]
 gi|226734745|sp|B8E2P4|Y1615_DICTD RecName: Full=UPF0082 protein Dtur_1615
 gi|217337095|gb|ACK42888.1| protein of unknown function DUF28 [Dictyoglomus turgidum DSM 6724]
          Length = 249

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 154/249 (61%), Gaps = 9/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK   DA K K+FS+LS+EI ++AK  G NP  NPRLR AI+ A+  +
Sbjct: 1   MSGHSKWANIKHRKAAADAKKGKLFSQLSKEIIIAAKHGGGNPETNPRLRAAIERAREAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIE+AI +   +  G  Y  + YEGYGP GVAI++E +TDN+NRTA+ IR IFTK 
Sbjct: 61  MPKENIEKAIMRGTGEIPGVAYEEVTYEGYGPGGVAIMVEVVTDNKNRTAAEIRRIFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIGDSNLAMEVAIESDAFEVLFEDQ--EYIFYCD- 175
            G+LG  G     FE+ G II    ++ D +  +  A+E+ A +V   D   E I   + 
Sbjct: 121 GGNLGEAGCVAWIFEEKGSIIIEKESVKDEDQLISDALEAGAEDVQISDDTVEVITSPES 180

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F+ V    K+   KI +A+  KV   P N + +   D  K ++K++E LED DDVQ  Y+
Sbjct: 181 FSEVRDILKEKGYKITQAEVTKV---PKNLVPVDGPDAEK-VLKLMEELEDHDDVQKTYA 236

Query: 236 NLEIADDII 244
           N +I D+I+
Sbjct: 237 NFDIPDEIL 245


>gi|295095542|emb|CBK84632.1| conserved hypothetical protein TIGR01033 [Enterobacter cloacae
           subsp. cloacae NCTC 9394]
          Length = 246

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDAIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|206900756|ref|YP_002251322.1| hypothetical protein DICTH_1505 [Dictyoglomus thermophilum H-6-12]
 gi|226734671|sp|B5YFL4|Y1505_DICT6 RecName: Full=UPF0082 protein DICTH_1505
 gi|206739859|gb|ACI18917.1| conserved hypothetical protein [Dictyoglomus thermophilum H-6-12]
          Length = 249

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 148/249 (59%), Gaps = 9/249 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK   DA K K+FS+LS+EI ++AK  G NP  NPRLR AI+ AK  +
Sbjct: 1   MSGHSKWANIKHRKAAADAKKGKLFSQLSKEIIIAAKHGGGNPETNPRLRAAIERAKEAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIE+AI +  G+     Y  + YEGYGP GVAI++E +TDN+NRTA+ IR IFTK 
Sbjct: 61  MPKENIEKAIMRGIGAIPGVAYEEVTYEGYGPGGVAIMVEVVTDNKNRTAAEIRRIFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSLG  G     FE  G I I   ++ D +  +  A+E+ A +V              N
Sbjct: 121 GGSLGEAGCVAWIFEDKGSIFIEKESVKDEDQLIADALEAGAEDVQISGDSVEIITSPEN 180

Query: 179 VGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
                  LEE   KI +A+  KV   P N + +   D  K ++K++E LED DDVQ  Y+
Sbjct: 181 FSEVKNVLEEKGYKITQAEVTKV---PKNVVPVDGPDAEK-VLKLMEELEDHDDVQKTYA 236

Query: 236 NLEIADDII 244
           N +I D+I+
Sbjct: 237 NFDIPDEIL 245


>gi|302380328|ref|ZP_07268798.1| DNA-binding regulatory protein, YebC/PmpR family [Finegoldia magna
           ACS-171-V-Col3]
 gi|303233712|ref|ZP_07320366.1| DNA-binding regulatory protein, YebC/PmpR family [Finegoldia magna
           BVS033A4]
 gi|302311818|gb|EFK93829.1| DNA-binding regulatory protein, YebC/PmpR family [Finegoldia magna
           ACS-171-V-Col3]
 gi|302495146|gb|EFL54898.1| DNA-binding regulatory protein, YebC/PmpR family [Finegoldia magna
           BVS033A4]
          Length = 241

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 93/239 (38%), Positives = 148/239 (61%), Gaps = 1/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I ++K  +DA + KIF+K++R ITV+ +  G +P  NP L+  I+ A+ ++
Sbjct: 1   MSGHNKWSKIKNKKGSEDARRGKIFTKMARAITVAVREGGADPEYNPSLKSVIEKARAEN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKKA  D D  NY NI YEGYGPEGVA+I+E LTDNRNRTAS +R  F K 
Sbjct: 61  MPNDNIDRAIKKASGDGDSANYENIVYEGYGPEGVAVIVECLTDNRNRTASDVRHYFDKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG  GS +  F++ G ++  ++  D    M  ++++ A +   +D  ++      + 
Sbjct: 121 GGNLGQNGSVSFMFQRKGLLLIDADSLDEEEVMMDSLDAGAEDFEADDGIFVINTAMEDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 L EK  +     ++++P NY+++++   V  + K+I+NLED DDVQ V  N +
Sbjct: 181 AQVRDTLLEKGYKFVKSDLVYEPSNYVKINDESNVDKMEKLIDNLEDSDDVQQVSHNWD 239


>gi|188533629|ref|YP_001907426.1| hypothetical protein ETA_14870 [Erwinia tasmaniensis Et1/99]
 gi|226734879|sp|B2VJ92|Y1487_ERWT9 RecName: Full=UPF0082 protein ETA_14870
 gi|188028671|emb|CAO96533.1| Conserved hypothetical protein [Erwinia tasmaniensis Et1/99]
          Length = 247

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +   NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKVIRELVTAAKLGGGDAGSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  + N
Sbjct: 121 GGNLGTDGSVAYLFTKKGVISYAPGL-DEDAVMDAALEAGADDVMTYDDGAIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 MGAVKDVLDAAGLQADSAEVTMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|15602845|ref|NP_245917.1| hypothetical protein PM0980 [Pasteurella multocida subsp. multocida
           str. Pm70]
 gi|33517096|sp|Q9CM61|Y980_PASMU RecName: Full=UPF0082 protein PM0980
 gi|12721306|gb|AAK03064.1| unknown [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 246

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 149/246 (60%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AKL G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDVNANPRLRTAVDKALSSN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI++   G DD    T I YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIERGVGGGDDTNMETKI-YEGYGPGGTAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFN 177
             G+LG+ GS    F + G I+  S  GD ++ ME AIE+ A +V + ED  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILITS--GDEDVIMEAAIEAGADDVQVQEDGSFEVYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
            +G     +E    +  + +V   P   + L +A+    ++K+I+ LED DDVQ+VY N 
Sbjct: 178 ELGAVRDGIESAGIKIDNAEVTMIPSTTVEL-DAETAPKLLKLIDMLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D+I
Sbjct: 237 EISDEI 242


>gi|225181977|ref|ZP_03735410.1| protein of unknown function DUF28 [Dethiobacter alkaliphilus AHT 1]
 gi|225167339|gb|EEG76157.1| protein of unknown function DUF28 [Dethiobacter alkaliphilus AHT 1]
          Length = 251

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 152/248 (61%), Gaps = 7/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R DA K K+F+K+S+EI  + +  G +P  N RLRLA+Q A++ +
Sbjct: 1   MAGHSKWANIKHRKARVDAQKGKVFTKISKEIMAAVRQGGGDPNNNFRLRLALQKARSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAI+K AG  +  N+  I YEGYGP G A+++E LTDNRNRTA  IR IF+K+
Sbjct: 61  MPNDNIQRAIQKGAGELEGTNFEEIIYEGYGPAGTAVMLEILTDNRNRTAGEIRHIFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG TG     F + G +       D +  M +A+++ A +    +  +  Y   ++ 
Sbjct: 121 GGSLGETGCVAWMFNRRGYLEVSKEGHDEDELMLLALDAGAEDFEAGENAFEIYTRPDDF 180

Query: 180 GLTSKKLEEK---IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
               +K+E +    GEA +I +I  P   + + + +  K  + +IE LED DDVQ+ Y+N
Sbjct: 181 EAVKEKMEAEGISFGEA-AITMI--PETTVEVPDVEGAKKALALIEALEDHDDVQNAYTN 237

Query: 237 LEIADDII 244
           L++  +++
Sbjct: 238 LDVPSEVM 245


>gi|110805808|ref|YP_689328.1| hypothetical protein SFV_1866 [Shigella flexneri 5 str. 8401]
 gi|110615356|gb|ABF04023.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 246

 Score =  178 bits (452), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 144/245 (58%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G LG+ GS    F + G I      GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGYLGTDGSVAYLFSKKGVISLEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|148269594|ref|YP_001244054.1| hypothetical protein Tpet_0454 [Thermotoga petrophila RKU-1]
 gi|281411688|ref|YP_003345767.1| protein of unknown function DUF28 [Thermotoga naphthophila RKU-10]
 gi|166227268|sp|A5IJV5|Y454_THEP1 RecName: Full=UPF0082 protein Tpet_0454
 gi|147735138|gb|ABQ46478.1| protein of unknown function DUF28 [Thermotoga petrophila RKU-1]
 gi|281372791|gb|ADA66353.1| protein of unknown function DUF28 [Thermotoga naphthophila RKU-10]
          Length = 253

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 149/243 (61%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA KSKIF+KL REI V+A+  G N   NPRLR A++ A+ ++
Sbjct: 1   MSGHNKWANIKHRKMAQDAKKSKIFTKLIREIIVAAREGGGNIETNPRLRAAVEKARAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIK+   +  G +Y  + YEGY P GVA+ I ALTDN+NRTA  +R +F K 
Sbjct: 61  MPKENIERAIKRGTGELEGVDYQEVIYEGYAPGGVAVYIRALTDNKNRTAQELRHLFNKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS +  FE+ G I I    + D    M +AI++ A ++   +          N
Sbjct: 121 GGSLAESGSVSWIFERKGVIEIPRDKVKDLEELMMIAIDAGAEDIKDTEDPIQIITTPEN 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +     KLEE   E ++ KV + P N ++++  D  K +++ +  LED DDVQ VYSN E
Sbjct: 181 LSEVKSKLEEAGYEVEA-KVTFIPKNTMKVTGKDAEK-VLEFLNALEDMDDVQEVYSNFE 238

Query: 239 IAD 241
           + D
Sbjct: 239 MDD 241


>gi|187478698|ref|YP_786722.1| hypothetical protein BAV2207 [Bordetella avium 197N]
 gi|119372126|sp|Q2KYW0|Y2207_BORA1 RecName: Full=UPF0082 protein BAV2207
 gi|115423284|emb|CAJ49817.1| conserved hypothetical protein [Bordetella avium 197N]
          Length = 243

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 147/239 (61%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLRLA   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGADPDSNPRLRLAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI++ AG  D  NY  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNVQRAIQRGAGGADGDNYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +  + MEVA+++ A +V+ +D+  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFLFAPGSSEDKV-MEVALDAGAEDVITDDEGGIEVICAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                +  E    +A+   VI K  +   L+  D +K + K+++ LE  DDVQ VY+N+
Sbjct: 180 YPALRQAFEAAGLKAEVDAVIMKAQSETELTGDDAIK-MQKLLDALEGLDDVQEVYTNV 237


>gi|153816435|ref|ZP_01969103.1| hypothetical protein RUMTOR_02688 [Ruminococcus torques ATCC 27756]
 gi|317500188|ref|ZP_07958420.1| hypothetical protein HMPREF1026_00362 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|331087584|ref|ZP_08336514.1| hypothetical protein HMPREF1025_00097 [Lachnospiraceae bacterium
           3_1_46FAA]
 gi|145846223|gb|EDK23141.1| hypothetical protein RUMTOR_02688 [Ruminococcus torques ATCC 27756]
 gi|316898403|gb|EFV20442.1| hypothetical protein HMPREF1026_00362 [Lachnospiraceae bacterium
           8_1_57FAA]
 gi|330400455|gb|EGG80088.1| hypothetical protein HMPREF1025_00097 [Lachnospiraceae bacterium
           3_1_46FAA]
          Length = 243

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 147/240 (61%), Gaps = 4/240 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSG-QNPLENPRLRLAIQNAKNQ 59
           M+GHS+F NI H+KE+ DA K KIF+K+ RE+ V+ K  G  +P  N RLR  I  AK+ 
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTKIGRELAVAVKEGGGPDPANNSRLRDVIAKAKSN 60

Query: 60  SMPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +MP + IER IKKA  +  G NY +I YEGYGP G AII++ LTDN+NRTAS++R+ FTK
Sbjct: 61  NMPNDTIERNIKKAAGEGAGDNYEHITYEGYGPNGTAIIVKTLTDNKNRTASNVRNAFTK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            +G++G+ G  +  F++ G+I         D++  M +A+++ A +   E++ +    D 
Sbjct: 121 GSGNVGTPGCVSFMFDEKGQIFVAKEDCSMDADELMMLALDAGAEDFAEEEESFEILTDP 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                   KLEE        +V   P  Y+ L++ + +K+I K ++ LE+DDDVQ VY N
Sbjct: 181 AAFSEVRLKLEEAGIVMAGAEVTMIPQTYVDLTSEEDIKNIQKTLDLLEEDDDVQDVYHN 240


>gi|325478640|gb|EGC81752.1| DNA-binding regulatory protein, YebC/PmpR family [Anaerococcus
           prevotii ACS-065-V-Col13]
          Length = 240

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 99/239 (41%), Positives = 146/239 (61%), Gaps = 1/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I ++K  +DA K KIF+K +R ITV+AK  G NP  NP L+ AI+ AK  +
Sbjct: 1   MSGHNKWSKIKNKKGSEDAKKGKIFTKHARNITVAAKEGGVNPDYNPALKTAIEKAKADN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKKA  DD   N+  I YEGYGP GVAII++ LTDN+NRTA  +R  F K 
Sbjct: 61  MPNDNIDRAIKKAAGDDASDNFERIIYEGYGPGGVAIIVDCLTDNKNRTAPDVRHAFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    F++ G+II +S   D +  M  A+E+   +V    + +    D    
Sbjct: 121 GGNLGTDGSVMFMFDRKGDIIVNSEYKDFDEFMMDALEAGCEDVKDMGEYFEAITDVQAF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
              +  L+E   + +S  + +   N I++ + D+   + K+I+ LED+DDVQ VYSN +
Sbjct: 181 NDANDNLKEAGYKVESADISYLAQNLIKVDDEDQKSKLTKLIDTLEDNDDVQEVYSNWD 239


>gi|289523152|ref|ZP_06440006.1| glucose-1-phosphate adenylyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
 gi|289503695|gb|EFD24859.1| glucose-1-phosphate adenylyltransferase [Anaerobaculum
           hydrogeniformans ATCC BAA-1850]
          Length = 250

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 151/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI +RK  +D+ + K+F KL R I  +A+  G +P  N  L+ AI+ AK  +
Sbjct: 1   MSGHSKWANIKYRKAAQDSKRGKLFQKLVRAIITAAREGGGDPSANVALKNAIEKAKEAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P ENI++AIK+  G  +  +Y  + YEGYGP GVAI++EA TDNRNRTAS +R IFT+ 
Sbjct: 61  VPMENIQKAIKRGTGELEGASYEYVMYEGYGPGGVAILVEATTDNRNRTASEMRFIFTRH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG  G  +  FE+ G I   S + +  L +  A E+ A +V+ ED  +I Y + + +
Sbjct: 121 GGSLGEAGCVSWIFEKRGAIYIPSQVNEDELLL-TAAEAGAMDVVKEDSSFIVYTEPSAL 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
              S+ L ++       ++   P   +++S+  +   ++K+++ LED DDVQ+VY+N +I
Sbjct: 180 NEVSEFLAKQGYPIDRCEMAMIPKTTVQVSDTGEASKLLKLLDALEDHDDVQNVYANFDI 239

Query: 240 ADDII 244
            D+I 
Sbjct: 240 PDEIF 244


>gi|146293034|ref|YP_001183458.1| hypothetical protein Sputcn32_1936 [Shewanella putrefaciens CN-32]
 gi|145564724|gb|ABP75659.1| protein of unknown function DUF28 [Shewanella putrefaciens CN-32]
 gi|319426436|gb|ADV54510.1| protein of unknown function DUF28 [Shewanella putrefaciens 200]
          Length = 248

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 154/249 (61%), Gaps = 10/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRIAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G + Y   I D +  ME A+E+ A +++ ++D     + D  +
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGI-DEDALMEAALEAGAEDIISYDDGAVDVFTDPVD 179

Query: 179 VGLTSKKLEEK---IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
              T K+L +K   + +   I +I      + L  A+K    +++I+ LED DDVQ VY 
Sbjct: 180 F-YTVKELLDKAHFVADNAEIAMIASTKAELDLETAEK---FMRLIDTLEDHDDVQEVYH 235

Query: 236 NLEIADDII 244
           N EI+DD++
Sbjct: 236 NAEISDDVM 244


>gi|22297719|ref|NP_680966.1| hypothetical protein tll0175 [Thermosynechococcus elongatus BP-1]
 gi|33517024|sp|Q8DME3|Y175_THEEB RecName: Full=UPF0082 protein tll0175
 gi|22293896|dbj|BAC07728.1| tll0175 [Thermosynechococcus elongatus BP-1]
          Length = 250

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 147/248 (59%), Gaps = 7/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA K KIF++LSR I ++A+  G +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAQKGKIFARLSRAIIIAARHGGGDPAGNFQLRSAIEKAKAAG 60

Query: 61  MPKENIERAIKKAGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENIERAI K     D       IRYEGYGP GVA +IEALTDNRNRTA+ +R+ F K
Sbjct: 61  IPSENIERAIAKGTGTLDSDAPLEAIRYEGYGPGGVAFLIEALTDNRNRTAADLRAAFNK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESD--AFEVLFEDQEYIFYCDF 176
             G+LG TG     FEQ G I+  +   D    +E  + +D   +E+L E  E    C  
Sbjct: 121 QGGNLGETGCVGWMFEQWG-IVTVTAPRDEEAFLEALLAADVETYEILEEVAE--VRCPV 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
             +   S+ L+E        +  W P+N + +++ D  + ++K+++ LE+ DD+QSV +N
Sbjct: 178 PALETVSETLKEHGYTVLDTESRWIPMNTVEITDEDTARRVLKLMDALENLDDIQSVATN 237

Query: 237 LEIADDII 244
           + ++D ++
Sbjct: 238 VTMSDALM 245


>gi|71065498|ref|YP_264225.1| hypothetical protein Psyc_0938 [Psychrobacter arcticus 273-4]
 gi|119392013|sp|Q4FT67|Y938_PSYA2 RecName: Full=UPF0082 protein Psyc_0938
 gi|71038483|gb|AAZ18791.1| conserved hypothetical protein [Psychrobacter arcticus 273-4]
          Length = 249

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 148/245 (60%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+K K+F+K+ REI  +AK    +P +NPRLR  I+ A + +
Sbjct: 1   MAGHSKWANIKHRKARQDAVKGKVFTKIIREIVSAAKQGDPDPDKNPRLRAVIEKALSVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RA+ +  G DD  N   + YEGYG  GVA+++E +TDN NRT S +R  FTK 
Sbjct: 61  MTRDTINRAVARGTGGDDNDNMDEVSYEGYGIGGVAVLVETMTDNLNRTVSEVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+TGS    F + GEI ++ +I   +  M VA+++ A ++  + +  +   ++ N 
Sbjct: 121 EGNLGTTGSVAYLFNKRGEISFN-DISLEDEVMLVALDAGALDIENDGKSLLVITEWENF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L      + + +V   P     + N +  + ++KMI+ LED DDVQ VYSN+  
Sbjct: 180 GHVKDALNAAGLVSDNAEVTMSPSTSAEIDNVEDAEKVMKMIDMLEDIDDVQEVYSNVNF 239

Query: 240 ADDII 244
           +D+++
Sbjct: 240 SDEVM 244


>gi|320103075|ref|YP_004178666.1| hypothetical protein Isop_1532 [Isosphaera pallida ATCC 43644]
 gi|319750357|gb|ADV62117.1| protein of unknown function DUF28 [Isosphaera pallida ATCC 43644]
          Length = 247

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 149/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS   N+ HRK   DA + K+FSKL R I V+AK    NP  N RLR AI+ A+  S
Sbjct: 1   MAGHSHAANVAHRKGVVDARRGKLFSKLCRAIYVAAKNGDPNPESNLRLRYAIEKARQFS 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
            PKENIER+IKKA + +LG  NY  + YEGYGP GVA++ E LTDNRNRTA  +R  F  
Sbjct: 61  CPKENIERSIKKA-TGELGADNYEEVLYEGYGPGGVAVLCEVLTDNRNRTAGELRKAFDV 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           A G+LGSTG  +  F + G I+ +      +  ME+ +E+ A ++  +   Y   CD  +
Sbjct: 120 AGGNLGSTGCVSYLFAKKGVILVNQTAIAEDELMEIVLEAGAEDMHPDSGFYEITCDPKS 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    + L ++  E +S ++ + P   + L + +  K ++K+ E L+D++DVQ+VYSN  
Sbjct: 180 LDAIKQALVDRHIEIESAELTYIPSTTVDL-DVELGKKMLKLREALDDNEDVQNVYSNDN 238

Query: 239 IADDI 243
           + D++
Sbjct: 239 LPDEL 243


>gi|241668352|ref|ZP_04755930.1| hypothetical protein FphipA2_06276 [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254876885|ref|ZP_05249595.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
 gi|254842906|gb|EET21320.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25015]
          Length = 248

 Score =  178 bits (451), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 151/246 (61%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATAFANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ +ERAI K AG DD  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTVERAILKGAGGDDSANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I + S + D +  MEVA+E+ A +++  ED     +   ++
Sbjct: 121 GGNLGTDGSVAYMFTKKGIISFASGV-DEDALMEVALEAGAEDIITHEDGSIDVFTTPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K   + + +V +       L + +  + ++ +I+ LED DDVQ+VYSN+ 
Sbjct: 180 FSDVQEALIAKGFNSDNAEVTFDAETKAEL-DIEIAEKVMNLIDRLEDLDDVQNVYSNVN 238

Query: 239 IADDII 244
              +++
Sbjct: 239 FTQELM 244


>gi|168241528|ref|ZP_02666460.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
 gi|194448488|ref|YP_002045952.1| hypothetical protein SeHA_C2113 [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194406792|gb|ACF67011.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|205339568|gb|EDZ26332.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL486]
          Length = 246

 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 145/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAASLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|225572061|ref|ZP_03780925.1| hypothetical protein RUMHYD_00355 [Blautia hydrogenotrophica DSM
           10507]
 gi|225040496|gb|EEG50742.1| hypothetical protein RUMHYD_00355 [Blautia hydrogenotrophica DSM
           10507]
          Length = 242

 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 142/241 (58%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI ++ K  G +P  N +LR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAKKGKIFTVIGREIVIAVKEGGPDPANNSKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+R IKKA  D    NY  + YEGYGP G+AII+EALTDN+NRTA+++RS F+K 
Sbjct: 61  MPNDTIDRGIKKAAGDASADNYEAVTYEGYGPNGIAIIVEALTDNKNRTAANVRSAFSKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNL--AMEVAIESDAFEVLFEDQEYIFYCDFN 177
           NGS+G  G  +  F++ G+II      + N    M  A+++ A +   E+  Y      +
Sbjct: 121 NGSIGVQGCVSFMFDKKGQIIIAKEDCEMNADDLMMAALDAGAEDFNEEEDSYEVLTAPD 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +  +  + LE++       +V   P  Y+ L+    VK + K +E LEDDDDV  V+ N 
Sbjct: 181 DFSVVRETLEKEGVPMLEAQVAMIPQTYVELTEEKAVKDLQKTLELLEDDDDVTDVWHNW 240

Query: 238 E 238
           +
Sbjct: 241 D 241


>gi|156933558|ref|YP_001437474.1| hypothetical protein ESA_01378 [Cronobacter sakazakii ATCC BAA-894]
 gi|166200382|sp|A7MEB8|Y1378_ENTS8 RecName: Full=UPF0082 protein ESA_01378
 gi|156531812|gb|ABU76638.1| hypothetical protein ESA_01378 [Cronobacter sakazakii ATCC BAA-894]
          Length = 246

 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I + +  GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEA--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|307826387|ref|ZP_07656589.1| protein of unknown function DUF28 [Methylobacter tundripaludum
           SV96]
 gi|307732564|gb|EFO03439.1| protein of unknown function DUF28 [Methylobacter tundripaludum
           SV96]
          Length = 248

 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 150/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+K+ REITV+ K SG +   NP LR A+  A   +
Sbjct: 1   MAGHSKWANIKHRKAGQDAKRGKIFTKMLREITVAVKTSGPDAASNPALRTAVDKALGAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+ AIKKA G+ +  NY  +RYEGYGP G A++++ LTDNRNRT   +R  F+KA
Sbjct: 61  MRRDTIDTAIKKASGALEGVNYEVVRYEGYGPGGTAVMVDCLTDNRNRTVGEVRHAFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    F +IG + Y  ++ D +  ME A+E+ A +V+  D   +        
Sbjct: 121 GGNLGTDGSVAYLFSKIGILSYAPSV-DEDALMEAALEAGAEDVIVNDDGSVDVMTTPES 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            L  K      G E  + +V  +      L +A+  + ++++I+ LED DDVQ+VYSN +
Sbjct: 180 YLEVKDALVAAGFEPDNAEVTMQAATMTEL-DAEGAEKMMRLIDRLEDLDDVQNVYSNAD 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|320539867|ref|ZP_08039526.1| putative conserved protein [Serratia symbiotica str. Tucson]
 gi|320030053|gb|EFW12073.1| putative conserved protein [Serratia symbiotica str. Tucson]
          Length = 247

 Score =  178 bits (451), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N  +I YEGYGP G A++IE L+DNRNRT   +R  FTK 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMESIIYEGYGPGGTAVMIECLSDNRNRTVGEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  ME A+E+ A +++  D + I  +  + +
Sbjct: 121 GGNLGTDGSVAYLFTKKGVITYAPGV-DEDALMEAALEAGAEDIVSYDDDVIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L      A++ ++   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGALKDALTAAGFNAEAAEIAMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D+I
Sbjct: 239 ISDEI 243


>gi|145299763|ref|YP_001142604.1| hypothetical protein ASA_2843 [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|166200355|sp|A4SPN4|Y2843_AERS4 RecName: Full=UPF0082 protein ASA_2843
 gi|142852535|gb|ABO90856.1| conserved hypothetical protein [Aeromonas salmonicida subsp.
           salmonicida A449]
          Length = 246

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 147/246 (59%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REIT SA++   +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIREITTSARIGDPDPANNPRLRAAVTAALTSN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M +E I RAI + AG  D      I YEGYGP G A+++E LTDNRNRT + +R  F+K+
Sbjct: 61  MTRETINRAIARGAGGGDGEQLETIVYEGYGPAGSAVMVECLTDNRNRTVAEVRHAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYI-FYCDFN 177
            G+LG+ GS    F + G + +   +G D +  M+ A+E+ A +V+ E+   I  Y   N
Sbjct: 121 GGNLGTDGSVAYLFSKKGLLTF---VGVDEDALMDAALEAGADDVVTEEDGSIEVYTTPN 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     LE    +AQ+ +V   P     L +A+    ++++I+ LED DDVQ VY N 
Sbjct: 178 DFGTVLDALEAAGFKAQNAEVTMIPSTEAEL-DAETAPKLMRLIDMLEDLDDVQEVYHNG 236

Query: 238 EIADDI 243
            I+D++
Sbjct: 237 SISDEV 242


>gi|16760849|ref|NP_456466.1| hypothetical protein STY2107 [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16765241|ref|NP_460856.1| hypothetical protein STM1899 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29141459|ref|NP_804801.1| hypothetical protein t0978 [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56413182|ref|YP_150257.1| hypothetical protein SPA0970 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161613545|ref|YP_001587510.1| hypothetical protein SPAB_01265 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552465|ref|ZP_02346218.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|167994200|ref|ZP_02575292.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|168234039|ref|ZP_02659097.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|168238529|ref|ZP_02663587.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|168259826|ref|ZP_02681799.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|168462569|ref|ZP_02696500.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|168820723|ref|ZP_02832723.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|194444208|ref|YP_002041164.1| hypothetical protein SNSL254_A2058 [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194469640|ref|ZP_03075624.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194736427|ref|YP_002114934.1| hypothetical protein SeSA_A2053 [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197250988|ref|YP_002146123.1| hypothetical protein SeAg_B1224 [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264424|ref|ZP_03164498.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197362108|ref|YP_002141745.1| hypothetical protein SSPA0904 [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|198244624|ref|YP_002215186.1| hypothetical protein SeD_A1348 [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200390301|ref|ZP_03216912.1| conserved hypothetical protein TIGR01033 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|205352395|ref|YP_002226196.1| hypothetical protein SG1153 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207856580|ref|YP_002243231.1| hypothetical protein SEN1104 [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213426400|ref|ZP_03359150.1| hypothetical protein SentesTyphi_12659 [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213649295|ref|ZP_03379348.1| hypothetical protein SentesTy_19640 [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|213855275|ref|ZP_03383515.1| hypothetical protein SentesT_14892 [Salmonella enterica subsp.
           enterica serovar Typhi str. M223]
 gi|238912041|ref|ZP_04655878.1| hypothetical protein SentesTe_13046 [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|54040167|sp|P67180|YEBC_SALTI RecName: Full=UPF0082 protein yebC
 gi|54042650|sp|P67179|YEBC_SALTY RecName: Full=UPF0082 protein yebC
 gi|67461916|sp|Q5PMZ4|YEBC_SALPA RecName: Full=UPF0082 protein yebC
 gi|25318108|pir||AG0743 conserved hypothetical protein STY2107 [imported] - Salmonella
           enterica subsp. enterica serovar Typhi (strain CT18)
 gi|16420435|gb|AAL20815.1| putative cytoplasmic protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16503146|emb|CAD05650.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137086|gb|AAO68650.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127439|gb|AAV76945.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|161362909|gb|ABX66677.1| hypothetical protein SPAB_01265 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402871|gb|ACF63093.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194456004|gb|EDX44843.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CVM29188]
 gi|194711929|gb|ACF91150.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|195633896|gb|EDX52248.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Newport str. SL317]
 gi|197093585|emb|CAR59048.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214691|gb|ACH52088.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197242679|gb|EDY25299.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA23]
 gi|197288645|gb|EDY28020.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197939140|gb|ACH76473.1| conserved hypothetical protein TIGR01033 [Salmonella enterica
           subsp. enterica serovar Dublin str. CT_02021853]
 gi|199602746|gb|EDZ01292.1| conserved hypothetical protein TIGR01033 [Salmonella enterica
           subsp. enterica serovar Virchow str. SL491]
 gi|205272176|emb|CAR37034.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322905|gb|EDZ10744.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Saintpaul str. SARA29]
 gi|205327899|gb|EDZ14663.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar 4,[5],12:i:- str. CVM23701]
 gi|205331992|gb|EDZ18756.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Kentucky str. CDC 191]
 gi|205342638|gb|EDZ29402.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Weltevreden str. HI_N05-537]
 gi|205350673|gb|EDZ37304.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Hadar str. RI_05P066]
 gi|206708383|emb|CAR32687.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|261247069|emb|CBG24890.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993882|gb|ACY88767.1| hypothetical protein STM14_2310 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158419|emb|CBW17928.1| hypothetical protein SL1344_1834 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|312912893|dbj|BAJ36867.1| hypothetical protein STMDT12_C19240 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085483|emb|CBY95264.1| UPF0082 protein yebC [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
 gi|321224543|gb|EFX49606.1| hypothetical protein SEE_03001 [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
 gi|323130183|gb|ADX17613.1| protein YebC [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
 gi|326622934|gb|EGE29279.1| UPF0082 protein yebC [Salmonella enterica subsp. enterica serovar
           Dublin str. 3246]
 gi|326627447|gb|EGE33790.1| hypothetical protein SG9_1181 [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
 gi|332988792|gb|AEF07775.1| hypothetical protein STMUK_1879 [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 246

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 145/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|157371019|ref|YP_001479008.1| hypothetical protein Spro_2779 [Serratia proteamaculans 568]
 gi|166988611|sp|A8GFJ0|Y2779_SERP5 RecName: Full=UPF0082 protein Spro_2779
 gi|157322783|gb|ABV41880.1| protein of unknown function DUF28 [Serratia proteamaculans 568]
          Length = 247

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAAKLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A++IE L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMIECLSDNRNRTVAEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F + G I Y   + D ++ ME A+E+ A +++  D   I  +  + N
Sbjct: 121 GGNLGTDGSVAYLFTKKGVITYAPGL-DEDVVMEAALEAGAEDIVSYDDGVIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L      A S +V   P     + + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGEVKDALTAAGFTADSAEVSMIPSTKADM-DEETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|114566959|ref|YP_754113.1| hypothetical protein Swol_1435 [Syntrophomonas wolfei subsp. wolfei
           str. Goettingen]
 gi|122318038|sp|Q0AX12|Y1435_SYNWW RecName: Full=UPF0082 protein Swol_1435
 gi|114337894|gb|ABI68742.1| protein of unknown function DUF28 [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 251

 Score =  177 bits (450), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 153/249 (61%), Gaps = 6/249 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQ-NPLENPRLRLAIQNAKNQ 59
           MAGHS++ NI H+K R D  + K F+K+++EIT++ +  G  +P  N +L+LAIQ AK  
Sbjct: 1   MAGHSKWANIKHKKARSDEKRGKEFTKIAKEITIAVRSGGSGDPEANSKLKLAIQKAKAI 60

Query: 60  SMPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +MP ENI RA+KK  G  D      I YEGY P G+A+++E  TDNRNRTAS IR +F+K
Sbjct: 61  NMPNENINRAVKKGTGEIDSETIEEIIYEGYAPGGIAVMLEIATDNRNRTASEIRHLFSK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHS---NIGDSNLAMEVAIESDAFEVLFEDQEYIFYCD 175
            NG+LG +G     F+++G I       N+ +    ++V +++ A +V  ED+EY     
Sbjct: 121 NNGNLGESGCVAWMFKRVGLISIKKDKLNMEEEEFMLKV-LDAGAEDVREEDEEYEVLTL 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
             +  L  + +EE+    +   ++  P N + +++ D    IIK+IE LED DDVQ+VY+
Sbjct: 180 PESFMLVKEAMEEEKLLIEEADIVMLPENTVDITDVDMAGKIIKLIELLEDHDDVQNVYT 239

Query: 236 NLEIADDII 244
           N+ I D+II
Sbjct: 240 NMSIPDEII 248


>gi|313115677|ref|ZP_07801132.1| conserved hypothetical protein TIGR01033 [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310622004|gb|EFQ05504.1| conserved hypothetical protein TIGR01033 [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 267

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 144/243 (59%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +KE+ D  K+K+F+K+ REI+V+ +  G NP  N +L   I  AK  S
Sbjct: 23  MSGHSKWNNIKRKKEKTDGAKAKVFTKIGREISVAVRTGGPNPASNSKLADLIAKAKRMS 82

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +P +NI+R IKKA   D   Y  I YEGYGP GVA+++E LTDNRNRTA+ +R  F K  
Sbjct: 83  VPNDNIQRIIKKAEGGDKTEYEAITYEGYGPGGVAVMVETLTDNRNRTAADLRHYFDKNG 142

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ G     F Q G I       D++ AM  A+++ A +    +       D  N  
Sbjct: 143 GNLGAMGCVGFLFSQKGVIDISLEDKDADEAMMDALDAGAEDFDASEDAAEITTDPENYS 202

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              K +EEK  E  S  +   P+   RL++ D++K + K+++ LED+DDVQ+V+ +LE  
Sbjct: 203 AVVKAMEEKGYEILSDDLAMVPMTTTRLTDPDQLKLMGKLLDALEDNDDVQNVWHSLENE 262

Query: 241 DDI 243
           +D+
Sbjct: 263 EDL 265


>gi|317403476|gb|EFV83984.1| hypothetical protein HMPREF0005_01918 [Achromobacter xylosoxidans
           C54]
          Length = 243

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 145/239 (60%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGPDPDSNPRLRMAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG  D   Y  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIQRAIQRGAGGADGDAYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +  + ME A+E+ A +V  +++  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFVFAPGTPEDQV-MEAALEAGAEDVTTDEEGVIEVVCAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                K  ++   +A+   ++ K LN   L+  D +K + K+++ LE  DDVQ VY+ +
Sbjct: 180 YAAVRKAFDDAGLKAEVDGIVMKALNETELAGEDAIK-MQKLLDALESLDDVQEVYTTV 237


>gi|315640546|ref|ZP_07895654.1| glucose-1-phosphate adenylyltransferase [Enterococcus italicus DSM
           15952]
 gi|315483750|gb|EFU74238.1| glucose-1-phosphate adenylyltransferase [Enterococcus italicus DSM
           15952]
          Length = 240

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 105/240 (43%), Positives = 148/240 (61%), Gaps = 5/240 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSREI ++AK  G     NP LRL I  AK  +
Sbjct: 1   MSGHSKWNNIQGRKNAQDAKRGKIFQKLSREIYIAAKAGGGEVSMNPGLRLVIDKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERAIKKA S   G NY  + YEGYGP GVAI++EALTDNRNRT +++R  FT+ 
Sbjct: 61  MPNDNIERAIKKATSGIEGSNYEELTYEGYGPNGVAILVEALTDNRNRTQTNVRVAFTRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAM-EVAIESDAFEVLFEDQEYIFYCDFN 177
            GSLG TGS +  FE+ G + I    I  S   M E  I++ A ++  + +    Y D  
Sbjct: 121 GGSLGETGSVSYLFERQGYLAIAREGIALSEEQMLEAVIDAGAEDLQMQPEVVEIYTDPE 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +  +  + LE +   AQ+ ++   P   + L++A +++ + +++  LEDDDDV  VY+NL
Sbjct: 181 DFLVVKEALEAQFTLAQA-ELTMVPKTTVALNDA-QLEQLSQLVTKLEDDDDVSEVYTNL 238


>gi|260912900|ref|ZP_05919385.1| YebC like protein [Pasteurella dagmatis ATCC 43325]
 gi|260632890|gb|EEX51056.1| YebC like protein [Pasteurella dagmatis ATCC 43325]
          Length = 246

 Score =  177 bits (450), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 148/246 (60%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AKL G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDVSANPRLRAAVDKALSSN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI +   G DD    T + YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIDRGVGGGDDTNMETKV-YEGYGPGGTAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFN 177
             G+LG+ GS    F + G I+  S  GD ++ ME AIES A +V   ED  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILISS--GDEDIIMEAAIESGADDVQAQEDGSFEVYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++G     +E    +  + +V   P   + L +A+    ++++I+ LED DDVQ+VY N 
Sbjct: 178 DLGSVRDGIEAAGIKVDNAEVTMIPSTTVEL-DAETAPKLLRLIDMLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D++
Sbjct: 237 EISDEV 242


>gi|116492988|ref|YP_804723.1| hypothetical protein PEPE_1240 [Pediococcus pentosaceus ATCC 25745]
 gi|122265548|sp|Q03EU1|Y1240_PEDPA RecName: Full=UPF0082 protein PEPE_1240
 gi|116103138|gb|ABJ68281.1| hypothetical protein PEPE_1240 [Pediococcus pentosaceus ATCC 25745]
          Length = 245

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 141/244 (57%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF ++SREI V+ K  G +P  NP+LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQRISREIYVAVKAGGPDPSSNPQLRLMMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ K       NY  I YEGYGP G AII+ ALTDN+NRTA+++RS FT   
Sbjct: 61  MPKDNIKRAVDKGSGAGGANYEEITYEGYGPAGTAIIVSALTDNKNRTAAAVRSAFTHHG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNL--AMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           GSLG++GS +  F++ G I+      D N    ME AI++ A +V   ++ +  Y D   
Sbjct: 121 GSLGASGSVSYMFDRKGYIVISREDLDKNEDDMMEDAIDAGADDVQTSEEVFEIYTDPKE 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE K     + ++   P N   +   DKVK    +I+ LED+DDV  VY    
Sbjct: 181 FAAVRDALEAKGYTLANAELTMIPENETMVPE-DKVKQYTGLIDELEDNDDVSEVYEAAT 239

Query: 239 IADD 242
           + +D
Sbjct: 240 LPED 243


>gi|293604474|ref|ZP_06686879.1| YebC like protein [Achromobacter piechaudii ATCC 43553]
 gi|292817055|gb|EFF76131.1| YebC like protein [Achromobacter piechaudii ATCC 43553]
          Length = 243

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 145/239 (60%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGPDPDSNPRLRMAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG  D   Y  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIQRAIQRGAGGADGDAYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +  + ME A+++ A +V  +++  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFVFAPGTPEDKV-MEAALDAGAEDVTTDEEGVIEVVCAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                K  +E   +A+   ++ K LN   L+  D +K + K+++ LE  DDVQ VY+ +
Sbjct: 180 YAAVRKAFDEAGLKAEVDGIVMKALNETELAGEDAIK-MQKLLDALEGLDDVQEVYTTV 237


>gi|120598880|ref|YP_963454.1| hypothetical protein Sputw3181_2072 [Shewanella sp. W3-18-1]
 gi|120558973|gb|ABM24900.1| protein of unknown function DUF28 [Shewanella sp. W3-18-1]
          Length = 248

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 154/252 (61%), Gaps = 16/252 (6%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRIAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFY---CD 175
            G+LG+ GS +  F + G + Y   I D +  ME A+E+ A +++ ++D     +    D
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGI-DEDALMEAALEAGAEDIISYDDGAVDVFTNPVD 179

Query: 176 FNNVGLTSKKLEEK---IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
           F  V    K+L +K   + +   I +I      + L  A+K    +++I+ LED DDVQ 
Sbjct: 180 FYTV----KELLDKAHFVADNAEIAMIASTKAELHLETAEK---FMRLIDTLEDHDDVQE 232

Query: 233 VYSNLEIADDII 244
           VY N EI+DD++
Sbjct: 233 VYHNAEISDDVM 244


>gi|169824590|ref|YP_001692201.1| hypothetical protein FMG_0893 [Finegoldia magna ATCC 29328]
 gi|226696014|sp|B0S1S1|Y893_FINM2 RecName: Full=UPF0082 protein FMG_0893
 gi|167831395|dbj|BAG08311.1| conserved hypothetical protein [Finegoldia magna ATCC 29328]
          Length = 241

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 148/239 (61%), Gaps = 1/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I ++K  +DA + KIF+K++R ITV+ +  G +P  NP L+  I+ A+ ++
Sbjct: 1   MSGHNKWSKIKNKKGSEDARRGKIFTKMARAITVAVREGGADPEYNPSLKSVIEKARAEN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKKA  D D  NY NI YEGYGPEGVA+I+E LTDNRNRTAS +R  F K 
Sbjct: 61  MPNDNIDRAIKKASGDGDSANYENIVYEGYGPEGVAVIVECLTDNRNRTASDVRHYFDKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG  GS +  F++ G ++  ++  D    M  ++++ A +   +D  ++      + 
Sbjct: 121 GGNLGQNGSVSFMFQRKGLLLIDADSLDEEEVMMDSLDAGAEDFEADDGIFVINTAMEDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 L +K  +     ++++P NY+++++   V  + K+I+NLED DDVQ V  N +
Sbjct: 181 AQVRDTLLDKGYKFVKSDLVYEPSNYVKINDESNVDKMEKLIDNLEDSDDVQQVSHNWD 239


>gi|93006305|ref|YP_580742.1| hypothetical protein Pcryo_1479 [Psychrobacter cryohalolentis K5]
 gi|119391269|sp|Q1QAP5|Y1479_PSYCK RecName: Full=UPF0082 protein Pcryo_1479
 gi|92393983|gb|ABE75258.1| protein of unknown function DUF28 [Psychrobacter cryohalolentis K5]
          Length = 249

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 149/248 (60%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA+K K+F+K+ REI  +AK    +P +NPRLR  I+ A + +
Sbjct: 1   MAGHSKWANIKHRKARQDAVKGKVFTKIIREIVSAAKQGDPDPDKNPRLRAVIEKALSVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RA+ +  G DD  N   + YEGYG  GVA+++E +TDN NRT S +R  FTK 
Sbjct: 61  MTRDTINRAVARGTGGDDNDNMDEVSYEGYGIGGVAVLVETMTDNLNRTVSEVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNL---AMEVAIESDAFEVLFEDQEYIFYCDF 176
           +G+LG+TGS    F + GEI ++    D++L    M VA+++ A ++  + +  +   ++
Sbjct: 121 DGNLGTTGSVAYLFNKRGEISFN----DTSLEDEVMLVALDAGALDIENDGESLLVITEW 176

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            N G     L      + + +V   P     + N    + ++KMI+ LED DDVQ VYSN
Sbjct: 177 ENFGHVKDALNAAGLVSDNAEVTMSPSTSAEIDNVADAEKVMKMIDMLEDIDDVQEVYSN 236

Query: 237 LEIADDII 244
           +  +D+++
Sbjct: 237 VNFSDEVM 244


>gi|295100668|emb|CBK98213.1| conserved hypothetical protein TIGR01033 [Faecalibacterium
           prausnitzii L2-6]
          Length = 245

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 144/243 (59%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +KE+ D  K+K+F+K+ REI+V+ +  G NP  N +L   I  AK  S
Sbjct: 1   MSGHSKWNNIKRKKEKTDGAKAKVFTKIGREISVAVRTGGPNPASNSKLADLIAKAKRMS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +P +NI+R IKKA   D   Y  I YEGYGP GVA+++E LTDNRNRTA+ +R  F K  
Sbjct: 61  VPNDNIQRIIKKAEGGDKTEYEAITYEGYGPGGVAVMVETLTDNRNRTAADLRHYFDKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ G     F Q G I       D++ AM  A+++ A +    +       D  N  
Sbjct: 121 GNLGAMGCVGFLFSQKGVIDISLEDKDADEAMMDALDAGAEDFDAGEDAAEITTDPENYS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              K +EEK  E  S  +   P+   RL++ D++K + K+++ LED+DDVQ+V+ +LE  
Sbjct: 181 AVVKAMEEKGYEILSDDLAMVPMTTTRLTDPDQLKLMGKLLDALEDNDDVQNVWHSLENE 240

Query: 241 DDI 243
           +D+
Sbjct: 241 EDL 243


>gi|229829046|ref|ZP_04455115.1| hypothetical protein GCWU000342_01131 [Shuttleworthia satelles DSM
           14600]
 gi|229792209|gb|EEP28323.1| hypothetical protein GCWU000342_01131 [Shuttleworthia satelles DSM
           14600]
          Length = 242

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 145/241 (60%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI V+ K  G +P  N +LR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTVIGREIAVAVKEGGPDPGNNSKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P + IER IKKA  D D  NY    YEGYGP G AII++ LTDN+NRTA+ +R+ F+K 
Sbjct: 61  VPNDTIERGIKKAAGDADSVNYIQATYEGYGPSGTAIIVQCLTDNKNRTAADVRNAFSKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGD--SNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            GS+G+ G  +  F++ G+II      D  ++  M +A+++ A +V  ED  ++      
Sbjct: 121 QGSVGTPGCVSYMFDERGQIIVDKEATDMSADDIMMMALDAGADDVEEEDDSFVITSSPA 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +     + LE++        V   P  Y++L++ + +++I ++++ L++ DDVQ VY N 
Sbjct: 181 DFSAVREALEKEGLPMADASVTMVPQTYVQLTSEEDIRNINRILDLLDESDDVQEVYHNW 240

Query: 238 E 238
           E
Sbjct: 241 E 241


>gi|268589739|ref|ZP_06123960.1| protein YebC [Providencia rettgeri DSM 1131]
 gi|291314891|gb|EFE55344.1| protein YebC [Providencia rettgeri DSM 1131]
          Length = 247

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDDNDNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y     
Sbjct: 121 GGNLGTDGSVSYLFTKRGVITYAPGV-DEDAIMEAALEAGADDVETYDDGAIDVYTTPET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     +++ +V   P     L +A+    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGEVKDALDAAGFTSEAAEVSMIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|224367519|ref|YP_002601682.1| hypothetical protein HRM2_04000 [Desulfobacterium autotrophicum
           HRM2]
 gi|259647138|sp|C0QGP3|Y400_DESAH RecName: Full=UPF0082 protein HRM2_04000
 gi|223690235|gb|ACN13518.1| conserved hypothetical protein [Desulfobacterium autotrophicum
           HRM2]
          Length = 247

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 145/244 (59%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K   DA + KIF+KL +EITV+A++ G +   NPRLR A+  AK Q+
Sbjct: 1   MSGHSKWSTIKHKKGAADAKRGKIFTKLIKEITVAARMGGGDIDSNPRLRGAVAAAKAQN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ERAIKK   D  G +Y  I YEGYGP GVAI++E LTDN+NRT + +R IF+KA
Sbjct: 61  MPKDNLERAIKKGTGDLEGVDYEEILYEGYGPGGVAILVECLTDNKNRTIADVRYIFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G+ G     F++ G I       D +  MEV +E+ A +V  E   +    D  + 
Sbjct: 121 GGNIGTDGCVAWMFDKKGLITISKEESDEDTLMEVGLEAGAEDVTDEGDCFEIITDPADF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 +E    + +  +V   P    RL   +  + +++ ++ L+D DD+Q  YSN +I
Sbjct: 181 DAVKGAVEAAGIKIEMAEVTMIPQTQTRLEGKE-AEQMVRFMDALDDCDDIQKFYSNADI 239

Query: 240 ADDI 243
            D++
Sbjct: 240 PDEV 243


>gi|163751782|ref|ZP_02158999.1| hypothetical protein KT99_11585 [Shewanella benthica KT99]
 gi|161328346|gb|EDP99506.1| hypothetical protein KT99_11585 [Shewanella benthica KT99]
          Length = 248

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 150/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +   NPRLR AI  + + +
Sbjct: 1   MSGHSKWDNIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDADSNPRLRAAIDKSLSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ IERA+K+ AG  D      I YEGYGP G A+++E +TDN+NRT S +R+ F+K+
Sbjct: 61  MTRDTIERAVKRGAGELDGQVLETIMYEGYGPGGTAVMVETMTDNKNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F++ G I Y +   D ++ M+VA+E+ A +V+  ED     +    +
Sbjct: 121 GGNLGTDGSVSYLFDKKGVISYAAGT-DEDIVMDVALEAGADDVVSHEDGAIDVFTSPED 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    E+   +V   P     L +A      +++I+NLED DDVQ VY N E
Sbjct: 180 FGAVKDALDAAGLESVHAEVTMVPSTTASL-DASTAAKFLRLIDNLEDHDDVQEVYHNAE 238

Query: 239 IADDII 244
           I+D+++
Sbjct: 239 ISDEVM 244


>gi|204930987|ref|ZP_03221813.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
 gi|204320031|gb|EDZ05236.1| conserved hypothetical protein [Salmonella enterica subsp. enterica
           serovar Javiana str. GA_MM04042433]
          Length = 246

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 145/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTRHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPDANPRLRAAVDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G AI+IE L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDSNMETIIYEGYGPGGTAIMIECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +    GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISFEK--GDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEY 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGKVRDALEAAGLKADSAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|260598338|ref|YP_003210909.1| hypothetical protein CTU_25460 [Cronobacter turicensis z3032]
 gi|260217515|emb|CBA31695.1| UPF0082 protein ESA_01378 [Cronobacter turicensis z3032]
          Length = 246

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  F+K 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +  + GD +  ME A+E+ A +V+ ++D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISF--DAGDEDTIMEAALEAGAEDVVTYDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALESAGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|212635159|ref|YP_002311684.1| hypothetical protein swp_2352 [Shewanella piezotolerans WP3]
 gi|212556643|gb|ACJ29097.1| Conserved hypothetical protein [Shewanella piezotolerans WP3]
          Length = 247

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 149/246 (60%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR AI  + + +
Sbjct: 1   MAGHSKWDNIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRAAIDKSLSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  D      I YEGYGP G A+++E +TDN+NRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELDGQVLETIIYEGYGPGGTAVLVETMTDNKNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F++ G I Y +   D +  M+ A+E+ A +V+  ED     +    +
Sbjct: 121 GGNLGTDGSVAYLFDKKGIISYQN--ADEDTVMDAALEAGADDVVAHEDCSIDVFTTPED 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    EA + +V   P     L +A      +++I+NLED DDVQ VY N +
Sbjct: 179 FGAVKDALDAAGLEAVNAEVTMLPSTKAEL-DASTAPKFLRLIDNLEDHDDVQEVYHNAD 237

Query: 239 IADDII 244
           I+D+++
Sbjct: 238 ISDEVM 243


>gi|311279236|ref|YP_003941467.1| hypothetical protein Entcl_1927 [Enterobacter cloacae SCF1]
 gi|308748431|gb|ADO48183.1| protein of unknown function DUF28 [Enterobacter cloacae SCF1]
          Length = 246

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 147/245 (60%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +   NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDAGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I +  + GD +  ME A+E+ A +V+ F+D     Y  +  
Sbjct: 121 GGNLGTDGSVSYLFSKKGVISF--DAGDEDTIMEAALEAGAEDVVTFDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALEAAGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|253688204|ref|YP_003017394.1| hypothetical protein PC1_1817 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|259646497|sp|C6DFE9|Y1817_PECCP RecName: Full=UPF0082 protein PC1_1817
 gi|251754782|gb|ACT12858.1| protein of unknown function DUF28 [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 247

 Score =  177 bits (449), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDAVMDAALEAGADDVVTYDDGAIDVFTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A+S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGNVKDALDAAGLKAESAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|253989951|ref|YP_003041307.1| hypothetical protein PAU_02472 [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211639068|emb|CAR67681.1| hypothetical protein yebc [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781401|emb|CAQ84564.1| hypothetical protein yebc [Photorhabdus asymbiotica]
          Length = 247

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 143/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPASNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDEADNMETIIYEGYGPGGTAVMVECLSDNRNRTVSDVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  ME A+E  A +V  ++D     Y     
Sbjct: 121 GGNLGTDGSVAYLFTKKGVISYAPGL-DEDAVMEAALEVGADDVETYDDGAIDVYTTPET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGDVKDALDAAGFVAESAEVSMIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|262375415|ref|ZP_06068648.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
 gi|262309669|gb|EEY90799.1| conserved hypothetical protein [Acinetobacter lwoffii SH145]
          Length = 249

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 150/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  RE+T +AKL G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIRELTTAAKLGGPDTASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   + YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDVINRAIQRGAGGEDNDDLKEVTYEGYGVGGVAVIVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ GS    F + GEI +  ++   +  MEVA+E+ A ++   + + +        
Sbjct: 121 DGNLGTNGSVAFLFTKRGEITFE-DVSLEDQIMEVALEAGAEDIEVTEDDILVITTPEAF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 180 GDVQDALTAAGLKSDNAEVVMSPSTKAEITDIDQAKKIMKMIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +D ++
Sbjct: 240 SDAVL 244


>gi|260550668|ref|ZP_05824877.1| UPF0082 protein [Acinetobacter sp. RUH2624]
 gi|260406379|gb|EEW99862.1| UPF0082 protein [Acinetobacter sp. RUH2624]
          Length = 249

 Score =  177 bits (448), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 149/245 (60%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +A+L G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAARLGGGDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++  G +D  +   + YEGYG  GVA++IE +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGVGGEDNDDLKEVTYEGYGVGGVAVLIETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS +  F + GEI +  ++   +  MEVA+E+ A ++   + E +        
Sbjct: 121 NGNLGTAGSVSYLFTKRGEITFE-DVSLEDKIMEVALEAGAEDIEVSEDEILVITSPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+  ED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALAAAGLKSDNAEVVMSPSTKAEITDIDQAKQILKMIDMFEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +++++
Sbjct: 240 SEEVL 244


>gi|300867865|ref|ZP_07112506.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
 gi|300334101|emb|CBN57682.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506]
          Length = 255

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 160/252 (63%), Gaps = 10/252 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA+K KIF+K+SREI V+A+    +P  N +LR AI  AK  +
Sbjct: 1   MAGHSKWANIKRQKARVDAVKGKIFAKISREIIVAARSGVPDPAGNFQLRTAIDKAKAAA 60

Query: 61  MPKENIERAIKKAGSDDLGNYT---NIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P ENIERAI K G+  LG  +   +IRYEGYG  GVAI+IEALTDNRNRTA+ +R  FT
Sbjct: 61  IPSENIERAIAK-GAGKLGPTSELESIRYEGYGVGGVAILIEALTDNRNRTAADLREAFT 119

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLF--EDQEYI-F 172
           K  G+LG TG     F+Q G       I + +L +E ++E +A  +E++   ED E    
Sbjct: 120 KNGGNLGETGCVGWMFDQKGVCTVFGPINEDDL-LEASLEGEAEYYELISIDEDTEGAEV 178

Query: 173 YCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
           + + +N+   SK L+++       +  W P N + + N DK +S++K+++ LED DDVQS
Sbjct: 179 FTEVSNLENLSKVLKKRGFVVMQSETRWIPSNSVEVDNPDKARSLLKLMDALEDLDDVQS 238

Query: 233 VYSNLEIADDII 244
           V +N E+ D+++
Sbjct: 239 VTANFEMTDELM 250


>gi|170726920|ref|YP_001760946.1| hypothetical protein Swoo_2574 [Shewanella woodyi ATCC 51908]
 gi|169812267|gb|ACA86851.1| protein of unknown function DUF28 [Shewanella woodyi ATCC 51908]
          Length = 248

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 149/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +   NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDADANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  D      I YEGYGP G A+++E +TDN+NRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELDGQVLETIMYEGYGPGGTAVMVETMTDNKNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS +  F++ G I Y   I D +  M+ A+E+ A +V+  D   I  +    +
Sbjct: 121 GGNLGTDGSVSYLFDKRGVISYGEGI-DEDTIMDAALEAGADDVVTHDDGSIDVFTTPED 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    E+ + +V   P     L +A      +++I+NLED DDVQ VY N E
Sbjct: 180 FGGVKDALDSAGFESVNAEVTMIPSTKADL-DASTAPKFMRLIDNLEDHDDVQEVYHNAE 238

Query: 239 IADDII 244
           I+D+I+
Sbjct: 239 ISDEIM 244


>gi|270262225|ref|ZP_06190497.1| hypothetical protein SOD_b04330 [Serratia odorifera 4Rx13]
 gi|270044101|gb|EFA17193.1| hypothetical protein SOD_b04330 [Serratia odorifera 4Rx13]
          Length = 247

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 143/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAAKLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A++IE L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMIECLSDNRNRTVAEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F + G I Y   + D +  ME A+E+ A +++  D   I  +  + N
Sbjct: 121 GGNLGTDGSVAYLFTKKGVITYAPGL-DEDAVMEAALEAGAEDIVSYDDGVIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L      A S +V   P     + + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGEVKDALTAAGFTADSAEVSMIPSTKADM-DEETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|311105296|ref|YP_003978149.1| hypothetical protein AXYL_02110 [Achromobacter xylosoxidans A8]
 gi|310759985|gb|ADP15434.1| hypothetical protein AXYL_02110 [Achromobacter xylosoxidans A8]
          Length = 243

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 144/239 (60%), Gaps = 4/239 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGPDPDSNPRLRMAWDKATDAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG  D   Y  +RYEGYG  G A+I++ +TDNR RT + +R  F K 
Sbjct: 61  MPKDNIQRAIQRGAGGADGEAYEEVRYEGYGIGGAAVIVDCMTDNRTRTVAEVRHAFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG  GS    F+  G+ ++     +  + ME A+E+ A +V  +++  I   C   +
Sbjct: 121 GGNLGQEGSVAFMFKHCGQFVFAPGTSEDKV-MEAALEAGAEDVTTDEEGVIEVVCAPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
                   +    +A+   ++ K LN   L+  D +K + K+++ LE  DDVQ VY+N+
Sbjct: 180 YAAVRSAFDAAGLKAEVDGIVMKALNETELAGEDAIK-MQKLLDALEGLDDVQEVYTNV 237


>gi|160943942|ref|ZP_02091172.1| hypothetical protein FAEPRAM212_01443 [Faecalibacterium prausnitzii
           M21/2]
 gi|158444618|gb|EDP21622.1| hypothetical protein FAEPRAM212_01443 [Faecalibacterium prausnitzii
           M21/2]
 gi|295104775|emb|CBL02319.1| conserved hypothetical protein TIGR01033 [Faecalibacterium
           prausnitzii SL3/3]
          Length = 245

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 145/243 (59%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +KE+ D  ++K+F+K+ REI+V+ +  G NP  N +L   I  AK  S
Sbjct: 1   MSGHSKWNNIKRKKEKTDGARAKVFTKIGREISVAVRDGGPNPASNSKLADLIAKAKRMS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +P +NI+R IKKA   D   +  I YEGYGP GVA+++E LTDNRNRTA+ +R  F K  
Sbjct: 61  VPNDNIQRIIKKAEGGDKTEFEAITYEGYGPGGVAVMVETLTDNRNRTAADLRHYFDKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ G     F Q G I       D++ AM  A+++ A +    +       D  N  
Sbjct: 121 GNLGAMGCVAFLFNQKGVIDISLEDKDADEAMMDALDAGAEDFDASEDAAEVTTDPENYS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              K LEEK  E  S  +   P+   RL++ D++K + K++++LED+DDVQ+V+ +LE  
Sbjct: 181 AVVKALEEKGYEILSDDLAMVPMTTTRLTDPDQLKQMGKLLDSLEDNDDVQNVWHSLENE 240

Query: 241 DDI 243
           +D+
Sbjct: 241 EDL 243


>gi|116748439|ref|YP_845126.1| hypothetical protein Sfum_0996 [Syntrophobacter fumaroxidans MPOB]
 gi|166227552|sp|A0LGY9|Y996_SYNFM RecName: Full=UPF0082 protein Sfum_0996
 gi|116697503|gb|ABK16691.1| protein of unknown function DUF28 [Syntrophobacter fumaroxidans
           MPOB]
          Length = 249

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 153/250 (61%), Gaps = 11/250 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K   DA + K+F+K+ +EI V+A++ G     NPRLR A+  AK ++
Sbjct: 1   MSGHSKWSTIKHKKGAADAKRGKVFTKIIKEIMVAARMGGGAIDANPRLRAAVLAAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIERAIKK   +  G  Y  + YEGYGP GVA++++ +TDNRNR AS IR IF++ 
Sbjct: 61  MPKENIERAIKKGTGELEGVAYEEMNYEGYGPGGVAVLVDIMTDNRNRAASDIRHIFSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            G+LG  G     F + G I+++ +    +  ME+A+++ A +V  ED ++       +F
Sbjct: 121 GGNLGEAGCVAWMFSKKGSIVFNKDKVSEDELMEIALDAGADDVKDEDDQFEVITSLEEF 180

Query: 177 NNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
            NV     +++L  ++ E   +     P   +R+ +    + ++++++ LED DDVQ+ Y
Sbjct: 181 VNVRAAFDARELAYEVAEITMV-----PQTTVRVEDEKLAQQLLRLMDGLEDSDDVQNAY 235

Query: 235 SNLEIADDII 244
           +N +I D+I+
Sbjct: 236 ANFDIPDEIL 245


>gi|212704984|ref|ZP_03313112.1| hypothetical protein DESPIG_03052 [Desulfovibrio piger ATCC 29098]
 gi|212671648|gb|EEB32131.1| hypothetical protein DESPIG_03052 [Desulfovibrio piger ATCC 29098]
          Length = 275

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/244 (39%), Positives = 152/244 (62%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK R+DA + K+F+K ++EI ++AK +G +P  NPRLR AI  AK  +
Sbjct: 31  MSGHSKWANIQHRKGRQDAKRGKVFTKAAKEIIIAAK-NGGDPAGNPRLRAAIAAAKAVN 89

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AI+K  G D  G+ T   YEGYGP G+AI++E  TDN+NRT + +R +FTK 
Sbjct: 90  LPKDKIEAAIRKGTGEDAGGDLTECFYEGYGPAGIAIMVEVATDNKNRTVAEVRHLFTKH 149

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG+ GS +  F++ G I         +  MEVA+E+ A +V+ ++  +       + 
Sbjct: 150 GGSLGTDGSVSWMFDRKGVITVDKAAYTEDQMMEVAMEAGADDVIDDEDVWTLQTAMADF 209

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE      QS ++   P N + + +A+  + +I+++E L+D+DDVQ+VY+N + 
Sbjct: 210 AAVRDALESAGVAMQSAELAMVPQNLVAV-DAEAAQKVIRLMEALDDNDDVQNVYANADF 268

Query: 240 ADDI 243
            +D+
Sbjct: 269 PEDM 272


>gi|86606896|ref|YP_475659.1| hypothetical protein CYA_2259 [Synechococcus sp. JA-3-3Ab]
 gi|119391298|sp|Q2JSH9|Y2259_SYNJA RecName: Full=UPF0082 protein CYA_2259
 gi|86555438|gb|ABD00396.1| conserved hypothetical protein TIGR01033 [Synechococcus sp.
           JA-3-3Ab]
          Length = 249

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 143/245 (58%), Gaps = 11/245 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA K  +F+KLSR I V+A+    +P  N RLR A++ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAKKGSLFTKLSRAIIVAARNGLPDPDANFRLRSAVEKAKAAG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTN------IRYEGYGPEGVAIIIEALTDNRNRTASSIRS 114
           MP E IERAI K GS   GN+ +      IRYEGYGP GVA++IEA+TDNRNRTA+ +R 
Sbjct: 61  MPAETIERAIAK-GS---GNWADDSPLEEIRYEGYGPGGVAVLIEAMTDNRNRTAAEVRE 116

Query: 115 IFTKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC 174
            F+K  GSLG +G  +  F Q G +I    + D    +    E+   ++  E  +   YC
Sbjct: 117 AFSKVGGSLGESGCVSWLFRQKG-VISLEGVTDPEALLLAVAEAGGEDLKVEGTDAEVYC 175

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           D+  +   +  L+++  + Q   + W P   + + + +  K ++ ++E L+  DDVQ+VY
Sbjct: 176 DYTLLEQVATYLKKEGYQVQEAAIRWIPSTEVHVEDPETAKLVLTLMERLDHLDDVQNVY 235

Query: 235 SNLEI 239
           +N EI
Sbjct: 236 ANFEI 240


>gi|323498743|ref|ZP_08103731.1| hypothetical protein VISI1226_19926 [Vibrio sinaloensis DSM 21326]
 gi|323316210|gb|EGA69233.1| hypothetical protein VISI1226_19926 [Vibrio sinaloensis DSM 21326]
          Length = 248

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 147/246 (59%), Gaps = 6/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REI V+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIFTKLIREIVVAAKEGGGEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ + RA+ +   G  D G  T I YEGYGP G A+++E +TDNRNRT S +R  F+K
Sbjct: 61  MTRDTVNRAVSRGAGGEGDEGMETVI-YEGYGPGGTAVMVECMTDNRNRTVSGVRHAFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFN 177
           A G+LG+ GS +  FE+ G I Y S + D +  MEVA+ES A ++   ED     +    
Sbjct: 120 AGGNLGTDGSVSYLFEKKGVISYASGL-DEDDVMEVALESGADDIETSEDGAIDVFTTPA 178

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     L+    ++   +V   P     L +AD    ++++I+ LED DDVQ VY N 
Sbjct: 179 DFGGVKDALDAAGFKSAHAEVSLIPSTKADL-DADTAPKLLRLIDALEDLDDVQEVYHNG 237

Query: 238 EIADDI 243
           +I+D++
Sbjct: 238 DISDEV 243


>gi|238756967|ref|ZP_04618155.1| hypothetical protein yaldo0001_16200 [Yersinia aldovae ATCC 35236]
 gi|238704797|gb|EEP97326.1| hypothetical protein yaldo0001_16200 [Yersinia aldovae ATCC 35236]
          Length = 247

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + +  + M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGLAEDTV-MDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVALIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|257439631|ref|ZP_05615386.1| glucose-1-phosphate adenylyltransferase [Faecalibacterium
           prausnitzii A2-165]
 gi|257197935|gb|EEU96219.1| glucose-1-phosphate adenylyltransferase [Faecalibacterium
           prausnitzii A2-165]
          Length = 245

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 95/243 (39%), Positives = 146/243 (60%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +KE+ D  ++K+F+K+ REI+V+ +  G NP  N +L   I  AK  S
Sbjct: 1   MSGHSKWNNIKRKKEKTDGARAKVFTKIGREISVAVRDGGPNPASNSKLADLIAKAKRMS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           +P +NI+R IKKA   D   +  I YEGYGP GVA+++E LTDNRNRTA+ +R  F K  
Sbjct: 61  VPNDNIQRIIKKAEGGDKTEFEAITYEGYGPGGVAVMVETLTDNRNRTAADLRHYFDKNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNVG 180
           G+LG+ G     F Q G I       D++ AM  A+++ A +    ++      D  N  
Sbjct: 121 GNLGAMGCVAFLFSQKGVIDISLEDKDADEAMMDALDAGAEDFDAGEEAAEITTDPENYS 180

Query: 181 LTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEIA 240
              K +EEK  E  S  +   P+   RL++ D++K++ K+++ LED+DDVQ+V+ +LE  
Sbjct: 181 AVVKAMEEKGYEILSDDLAMVPMTTTRLTDPDQLKAMGKLLDALEDNDDVQNVWHSLENE 240

Query: 241 DDI 243
           +D+
Sbjct: 241 EDL 243


>gi|282896803|ref|ZP_06304809.1| Protein of unknown function DUF28 [Raphidiopsis brookii D9]
 gi|281198212|gb|EFA73102.1| Protein of unknown function DUF28 [Raphidiopsis brookii D9]
          Length = 252

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 154/249 (61%), Gaps = 7/249 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K   DA K  +F++LSR I ++AK    +P  N +LR AI  AK   
Sbjct: 1   MAGHSKWANIKRQKAVVDAKKGSVFTQLSRAIIIAAKNGIPDPTGNFQLRTAIDKAKAAG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTN----IRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           +P +NIERAI K G+  LG+ +N    IRYEGYGP GVAI++EALTDNRNRTA+ +R  F
Sbjct: 61  IPNDNIERAIAK-GAGILGSDSNSLEEIRYEGYGPGGVAILVEALTDNRNRTAADLRVAF 119

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCD 175
           +K  G+LG TG  +  F Q G  I      + NL +E ++  DA      DQ+    +  
Sbjct: 120 SKNGGNLGETGCVSWMFSQKGVCIVRGIENEENL-LEASLIGDAESYEMIDQQVAEVFTQ 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
            +++   S+ L+ K  +   +++ W P N + +++ D+ KS++K+I+ LE  DDVQSV +
Sbjct: 179 VSDLEKLSQTLKAKDFKLTEVEIRWIPQNEVEVTHIDQAKSLLKLIDTLEGLDDVQSVTA 238

Query: 236 NLEIADDII 244
           N ++A++II
Sbjct: 239 NFDMAENII 247


>gi|297588574|ref|ZP_06947217.1| glucose-1-phosphate adenylyltransferase [Finegoldia magna ATCC
           53516]
 gi|297573947|gb|EFH92668.1| glucose-1-phosphate adenylyltransferase [Finegoldia magna ATCC
           53516]
          Length = 241

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/239 (38%), Positives = 148/239 (61%), Gaps = 1/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I ++K  +DA + K+F+K++R ITV+ +  G +P  NP L+  I+ A+ ++
Sbjct: 1   MSGHNKWSKIKNKKGSEDARRGKVFTKMARAITVAVREGGADPEYNPSLKSVIEKARAEN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKKA  D D  NY NI YEGYGPEGVA+I+E LTDNRNRTAS +R  F K 
Sbjct: 61  MPNDNIDRAIKKASGDGDSANYENIVYEGYGPEGVAVIVECLTDNRNRTASDVRHYFDKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG  GS +  F++ G ++  ++  D    M  ++++ A +   +D  ++      + 
Sbjct: 121 GGNLGQNGSVSFMFQRKGLLLIDADSLDEEEVMMDSLDAGAEDFEADDGIFVINTAMEDF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 L +K  +     ++++P NY+++++   V  + K+I+NLED DDVQ V  N +
Sbjct: 181 AQVRDTLLDKGYKFVKSDLVYEPSNYVKINDEANVDKMEKLIDNLEDSDDVQQVSHNWD 239


>gi|167627792|ref|YP_001678292.1| hypothetical protein Fphi_1565 [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
 gi|189038953|sp|B0TZD8|Y1570_FRAP2 RecName: Full=UPF0082 protein Fphi_1565
 gi|167597793|gb|ABZ87791.1| conserved hypothetical protein [Francisella philomiragia subsp.
           philomiragia ATCC 25017]
          Length = 248

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 150/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+KL REITV+A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKLIREITVAARLGGGDKDANPRLRAAIATAFANN 60

Query: 61  MPKENIERAI-KKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ +ERAI K AG DD  N   +RYEGYGP GVAII++ +TDNRNRT   +R  FTK+
Sbjct: 61  MSKDTVERAILKGAGGDDSANVEEVRYEGYGPGGVAIIVDCMTDNRNRTVGEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D +  MEVA+E+ A +++  ED     +   ++
Sbjct: 121 GGNLGTDGSVAYMFTKKGIISFAPGV-DEDALMEVALEAGAEDIITHEDGSIDVFTTPHD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + L  K   + + +V +       L + +  + ++ +I+ LED DDVQ+VYSN+ 
Sbjct: 180 FSDVQEALIAKGFNSDNAEVTFDAETKAEL-DIEIAEKVMNLIDRLEDLDDVQNVYSNVN 238

Query: 239 IADDII 244
              +++
Sbjct: 239 FTQELM 244


>gi|313894586|ref|ZP_07828149.1| DNA-binding regulatory protein, YebC/PmpR family [Veillonella sp.
           oral taxon 158 str. F0412]
 gi|313440776|gb|EFR59205.1| DNA-binding regulatory protein, YebC/PmpR family [Veillonella sp.
           oral taxon 158 str. F0412]
          Length = 244

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 145/243 (59%), Gaps = 2/243 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K + DALK+K+ +K+ REITV+A++ G +P  N RL+LA+Q A+  +
Sbjct: 1   MSGHSKWANIKHKKGKTDALKAKMATKIGREITVAARMGGADPTGNMRLKLALQKARENN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+NI+RAI K  G+ D+  Y  I YEGYGP GVA+ +E +TDNRNR A+ +R  F+K 
Sbjct: 61  IPKDNIQRAIDKGVGATDMNAYEEIVYEGYGPAGVAVTVEVMTDNRNRAAADVRHAFSKQ 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG +G     F+  G  +      D +    +A+E+ A ++  ED  +  Y    + 
Sbjct: 121 GGNLGESGCVGWMFKSKGVFVIDKEGHDEDELTMLALEAGAEDLKSEDDVFEIYTTPEDY 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L +   E    K+   P   I LS  D VK + KM++ L++ DDVQ+VY N  +
Sbjct: 181 DAVEAALADAGIETVVAKITMIPDTTIELSGDDAVK-MQKMLDVLDNLDDVQNVYHNGIL 239

Query: 240 ADD 242
            DD
Sbjct: 240 PDD 242


>gi|294650143|ref|ZP_06727523.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
 gi|292823962|gb|EFF82785.1| conserved hypothetical protein [Acinetobacter haemolyticus ATCC
           19194]
          Length = 249

 Score =  176 bits (446), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 151/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +A+L G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAARLGGPDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG ++  +   + YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGEENDDLKEVTYEGYGVGGVAVIVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  ++   +  MEVA+E+ A ++  ++   +      + 
Sbjct: 121 NGNLGTNGSVAYLFTKRGEISFE-DVSLEDKIMEVALEAGADDIEVDEDSILVITSPESF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 180 GEVQDALAAAGLKSDNAEVVMSPSTKAEITDVDQAKQIMKMIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +++++
Sbjct: 240 SEEVL 244


>gi|294101864|ref|YP_003553722.1| protein of unknown function DUF28 [Aminobacterium colombiense DSM
           12261]
 gi|293616844|gb|ADE56998.1| protein of unknown function DUF28 [Aminobacterium colombiense DSM
           12261]
          Length = 249

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 145/248 (58%), Gaps = 7/248 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +DA +  +F KL R I V+AK  G +P  N RL+ AI  AK  S
Sbjct: 1   MSGHSKWANIKHRKAAQDAKRGNLFQKLVRAIIVAAKEGGGDPSMNVRLKTAIDRAKAAS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NI RAIK+  G  D  +Y  I YEGYG  GVA++IEALTDNRNRTA+ +R++  + 
Sbjct: 61  VPNDNITRAIKRGTGEIDGASYEEITYEGYGSNGVALMIEALTDNRNRTAADVRALLARG 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDF 176
            GSLG +G     FE+ G I +   NI D    M   +E+ A +  FE+ E  Y  Y   
Sbjct: 121 GGSLGESGCVAWMFERKGVIEVKGENI-DEETIMLACLEAGAED--FEEIEGGYTVYTSP 177

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
             +      LE    E  S +    P N + +   +  + I++++ENLED DDVQ+VY+N
Sbjct: 178 AALSDVQAALEAAGYEVASAESEMVPNNTVAVDTVEHAQKILRLLENLEDHDDVQNVYAN 237

Query: 237 LEIADDII 244
            +I D+I+
Sbjct: 238 FDIPDEIM 245


>gi|261821377|ref|YP_003259483.1| hypothetical protein Pecwa_2101 [Pectobacterium wasabiae WPP163]
 gi|261605390|gb|ACX87876.1| protein of unknown function DUF28 [Pectobacterium wasabiae WPP163]
          Length = 247

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGIGGDDDTNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDAVMDAALEAGADDVVTYDDGAIDVFTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A++ +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGNVKDALDAAGLKAEAAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D+I
Sbjct: 239 ISDEI 243


>gi|332969719|gb|EGK08733.1| YebC like protein [Kingella kingae ATCC 23330]
          Length = 241

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 149/241 (61%), Gaps = 11/241 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R+DA + KIF+KL +EIT++AK  G +P  NPRLRLA+  A + +
Sbjct: 1   MAGHSKWANIQHKKARQDAKRGKIFTKLIKEITIAAKQGGGDPNANPRLRLAMDKAWDNN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G +Y  +RYEGYG  G A++++ +TDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVDYIELRYEGYGIGGAAVMVDCMTDNKTRTVADVRHAFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
            G+LG+ G     FE  G ++Y +   D +  ME A+E+ A +VL +D   I       D
Sbjct: 121 GGNLGTDGCVAFNFEHQGYLVYTN--ADEDALMEAALEAGAEDVLTDDDGVIEVITAPAD 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           +  + +T   LE+   +A+   V  +  N   LS  D  + + K+I+ LED DDVQ+VY+
Sbjct: 179 WAQIKIT---LEQAGFKAEDSDVTMRAQNTTELS-GDDAEKMQKLIDALEDLDDVQNVYT 234

Query: 236 N 236
           +
Sbjct: 235 S 235


>gi|304408866|ref|ZP_07390487.1| protein of unknown function DUF28 [Shewanella baltica OS183]
 gi|307302869|ref|ZP_07582624.1| protein of unknown function DUF28 [Shewanella baltica BA175]
 gi|304352687|gb|EFM17084.1| protein of unknown function DUF28 [Shewanella baltica OS183]
 gi|306913229|gb|EFN43651.1| protein of unknown function DUF28 [Shewanella baltica BA175]
          Length = 248

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 151/248 (60%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRVAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G + Y     D +  ME A+E+ A +++ ++D     + D  +
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGT-DEDALMEAALEAGAEDIVSYDDGAIDVFTDPVD 179

Query: 179 VGLTSKKLEEK--IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
             +    L++   + +   I +I      + L  A+K    +++I+ LED DDVQ VY N
Sbjct: 180 FYMVKDALDKASFVADNAEIAMIASTKAELDLDTAEK---FMRLIDTLEDHDDVQEVYHN 236

Query: 237 LEIADDII 244
            EI+DD++
Sbjct: 237 AEISDDVM 244


>gi|260779083|ref|ZP_05887975.1| hypothetical protein VIC_004490 [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260605247|gb|EEX31542.1| hypothetical protein VIC_004490 [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 247

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 148/246 (60%), Gaps = 6/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REI V+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIFTKLIREIVVAAKEGGGEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ + RA+ +   G  D G  T I YEGYGP G A+++E +TDNRNRT S +R  F+K
Sbjct: 61  MTRDTVNRAVSRGAGGEGDDGMETVI-YEGYGPGGTAVMVECMTDNRNRTVSGVRHAFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFN 177
           A G+LG+ GS    F++ G I Y   + D +  MEVA++S A ++   E+     + + +
Sbjct: 120 AGGNLGTDGSVNYLFDKKGVISYAPGL-DEDEVMEVALDSGADDIETAENGAIDVFTEPH 178

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     L+    EA + +V   P     L +AD    ++++I+ LED DDVQ VY N 
Sbjct: 179 DFGAVKDALDAAGFEAANAEVSLIPSTKAEL-DADTAPKLLRLIDALEDLDDVQEVYHNG 237

Query: 238 EIADDI 243
           +I+D++
Sbjct: 238 DISDEV 243


>gi|157962186|ref|YP_001502220.1| hypothetical protein Spea_2365 [Shewanella pealeana ATCC 700345]
 gi|157847186|gb|ABV87685.1| protein of unknown function DUF28 [Shewanella pealeana ATCC 700345]
          Length = 247

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 148/246 (60%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR AI  + + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRAAIDKSLSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  D      I YEGYGP G A+++E +TDN+NRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELDGQVLETIIYEGYGPGGTAVLVETMTDNKNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFNN 178
            G+LG+ GS    F++ G I Y     D +  M+ A+E+ A +V+  ED          +
Sbjct: 121 GGNLGTDGSVAYLFDKKGIISYEGV--DEDTVMDAALEAGAEDVVTNEDGSIDVLTSPED 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    E+ + +V   P     L +AD     +++I+NLED DDVQ VY N E
Sbjct: 179 FGRVKDALDNAGLESVNAEVTMVPSTKADL-DADTAPKFLRLIDNLEDHDDVQEVYHNAE 237

Query: 239 IADDII 244
           I+D+++
Sbjct: 238 ISDEVM 243


>gi|50121419|ref|YP_050586.1| hypothetical protein ECA2494 [Pectobacterium atrosepticum SCRI1043]
 gi|60390895|sp|Q6D499|Y2494_ERWCT RecName: Full=UPF0082 protein ECA2494
 gi|49611945|emb|CAG75394.1| conserved hypothetical protein [Pectobacterium atrosepticum
           SCRI1043]
          Length = 247

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDTNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M  A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDTVMNAALEAGADDVVTYDDGAIDVFTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A+S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGDVKDALDAAGLKAESAEVSMIPSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|238783296|ref|ZP_04627321.1| hypothetical protein yberc0001_24050 [Yersinia bercovieri ATCC
           43970]
 gi|238715889|gb|EEQ07876.1| hypothetical protein yberc0001_24050 [Yersinia bercovieri ATCC
           43970]
          Length = 247

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDAVMDAALEAGADDIVVYDDGAIDVFTPWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVALIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|330445530|ref|ZP_08309182.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489721|dbj|GAA03679.1| conserved hypothetical protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 248

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 103/246 (41%), Positives = 148/246 (60%), Gaps = 6/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+F NI HRK  +DA + KIF+KL REITV+AK  G     NPRLR AI  A + +
Sbjct: 1   MAGHSKFANIKHRKAAQDAKRGKIFTKLIREITVAAKEGGGEIDNNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RA+ +   G  D G  T I YEGYGP G A+++E LTDNRNRT S +R  F+K
Sbjct: 61  MTRDTINRAVTRGAGGEGDEGVETVI-YEGYGPAGTAVMVECLTDNRNRTVSGVRHAFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFN 177
           A G+LG+ GS +  F++ G I Y + + + +  MEVA+ES A ++   D   I  Y   +
Sbjct: 120 AGGNLGTDGSVSYLFDKKGVISYAAGL-EEDAVMEVALESGADDIETNDDGSIDVYTTPS 178

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     L+     A++ +V   P     L +A     ++++I+ LED DDVQ VY N 
Sbjct: 179 DFGSVKDALDAAGFTAENAEVTLVPSTKAEL-DATTAPKLLRLIDALEDLDDVQEVYHNG 237

Query: 238 EIADDI 243
           +++D++
Sbjct: 238 DMSDEV 243


>gi|197284984|ref|YP_002150856.1| hypothetical protein PMI1113 [Proteus mirabilis HI4320]
 gi|227355388|ref|ZP_03839789.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906]
 gi|226696215|sp|B4ETP5|Y1113_PROMH RecName: Full=UPF0082 protein PMI1113
 gi|194682471|emb|CAR42403.1| conserved hypothetical protein [Proteus mirabilis HI4320]
 gi|227164612|gb|EEI49483.1| conserved hypothetical protein [Proteus mirabilis ATCC 29906]
          Length = 251

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI + AG+D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGAGNDENDNMETIIYEGYGPGGTAVMVECLSDNRNRTVSDVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y     
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGV-DEDAVMEAALEAGAEDVETYDDGAIDVYTTPEA 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     ++     A+S +V   P     L + D    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGEVKDAMDAAGFVAESAEVSMIPSTKAEL-DIDTAPKLMRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|51596364|ref|YP_070555.1| hypothetical protein YPTB2038 [Yersinia pseudotuberculosis IP
           32953]
 gi|108807433|ref|YP_651349.1| hypothetical protein YPA_1437 [Yersinia pestis Antiqua]
 gi|108811695|ref|YP_647462.1| hypothetical protein YPN_1532 [Yersinia pestis Nepal516]
 gi|145598362|ref|YP_001162438.1| hypothetical protein YPDSF_1067 [Yersinia pestis Pestoides F]
 gi|149366016|ref|ZP_01888051.1| hypothetical protein YPE_1201 [Yersinia pestis CA88-4125]
 gi|153950436|ref|YP_001401006.1| hypothetical protein YpsIP31758_2033 [Yersinia pseudotuberculosis
           IP 31758]
 gi|161484794|ref|NP_669564.2| hypothetical protein y2255 [Yersinia pestis KIM 10]
 gi|161511392|ref|NP_993239.2| hypothetical protein YP_1898 [Yersinia pestis biovar Microtus str.
           91001]
 gi|162421505|ref|YP_001606846.1| hypothetical protein YpAngola_A2424 [Yersinia pestis Angola]
 gi|165926409|ref|ZP_02222241.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165938828|ref|ZP_02227382.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|166009204|ref|ZP_02230102.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166211114|ref|ZP_02237149.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|167401361|ref|ZP_02306858.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167420405|ref|ZP_02312158.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167424796|ref|ZP_02316549.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186895405|ref|YP_001872517.1| hypothetical protein YPTS_2097 [Yersinia pseudotuberculosis PB1/+]
 gi|218929162|ref|YP_002347037.1| hypothetical protein YPO2055 [Yersinia pestis CO92]
 gi|229894769|ref|ZP_04509949.1| conserved protein [Yersinia pestis Pestoides A]
 gi|229897471|ref|ZP_04512627.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229898118|ref|ZP_04513267.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229901977|ref|ZP_04517098.1| conserved protein [Yersinia pestis Nepal516]
 gi|270490839|ref|ZP_06207913.1| DNA-binding regulatory protein, YebC/PmpR family [Yersinia pestis
           KIM D27]
 gi|294503879|ref|YP_003567941.1| hypothetical protein YPZ3_1769 [Yersinia pestis Z176003]
 gi|33517079|sp|Q8ZEU8|Y2055_YERPE RecName: Full=UPF0082 protein YPO2055/y2255/YP_1898
 gi|60390888|sp|Q66AU2|Y2038_YERPS RecName: Full=UPF0082 protein YPTB2038
 gi|118573932|sp|Q1C818|Y1437_YERPA RecName: Full=UPF0082 protein YPA_1437
 gi|118573937|sp|Q1CJG8|Y1532_YERPN RecName: Full=UPF0082 protein YPN_1532
 gi|166228136|sp|A4TJK3|Y1067_YERPP RecName: Full=UPF0082 protein YPDSF_1067
 gi|166980261|sp|A7FIC8|Y2033_YERP3 RecName: Full=UPF0082 protein YpsIP31758_2033
 gi|226701163|sp|B2K321|Y2097_YERPB RecName: Full=UPF0082 protein YPTS_2097
 gi|226701611|sp|A9QYX6|Y2424_YERPG RecName: Full=UPF0082 protein YpAngola_A2424
 gi|51589646|emb|CAH21276.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108775343|gb|ABG17862.1| hypothetical protein YPN_1532 [Yersinia pestis Nepal516]
 gi|108779346|gb|ABG13404.1| hypothetical protein YPA_1437 [Yersinia pestis Antiqua]
 gi|115347773|emb|CAL20690.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145210058|gb|ABP39465.1| hypothetical protein YPDSF_1067 [Yersinia pestis Pestoides F]
 gi|149292429|gb|EDM42503.1| hypothetical protein YPE_1201 [Yersinia pestis CA88-4125]
 gi|152961931|gb|ABS49392.1| conserved hypothetical protein TIGR01033 [Yersinia
           pseudotuberculosis IP 31758]
 gi|162354320|gb|ABX88268.1| conserved hypothetical protein TIGR01033 [Yersinia pestis Angola]
 gi|165913191|gb|EDR31814.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Orientalis str. IP275]
 gi|165921630|gb|EDR38827.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Orientalis str. F1991016]
 gi|165991759|gb|EDR44060.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Antiqua str. E1979001]
 gi|166208294|gb|EDR52774.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Antiqua str. B42003004]
 gi|166962100|gb|EDR58121.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Orientalis str. MG05-1020]
 gi|167049057|gb|EDR60465.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Antiqua str. UG05-0454]
 gi|167056678|gb|EDR66447.1| conserved hypothetical protein TIGR01033 [Yersinia pestis biovar
           Mediaevalis str. K1973002]
 gi|186698431|gb|ACC89060.1| protein of unknown function DUF28 [Yersinia pseudotuberculosis
           PB1/+]
 gi|229680873|gb|EEO76968.1| conserved protein [Yersinia pestis Nepal516]
 gi|229688834|gb|EEO80901.1| conserved protein [Yersinia pestis biovar Orientalis str. India
           195]
 gi|229693808|gb|EEO83857.1| conserved protein [Yersinia pestis biovar Orientalis str. PEXU2]
 gi|229702242|gb|EEO90261.1| conserved protein [Yersinia pestis Pestoides A]
 gi|262362002|gb|ACY58723.1| hypothetical protein YPD4_1815 [Yersinia pestis D106004]
 gi|262365861|gb|ACY62418.1| hypothetical protein YPD8_1735 [Yersinia pestis D182038]
 gi|270339343|gb|EFA50120.1| DNA-binding regulatory protein, YebC/PmpR family [Yersinia pestis
           KIM D27]
 gi|294354338|gb|ADE64679.1| hypothetical protein YPZ3_1769 [Yersinia pestis Z176003]
 gi|320015267|gb|ADV98838.1| conserved protein [Yersinia pestis biovar Medievalis str. Harbin
           35]
          Length = 247

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDTVMDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVSLIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|225027968|ref|ZP_03717160.1| hypothetical protein EUBHAL_02228 [Eubacterium hallii DSM 3353]
 gi|224954682|gb|EEG35891.1| hypothetical protein EUBHAL_02228 [Eubacterium hallii DSM 3353]
          Length = 244

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/244 (41%), Positives = 154/244 (63%), Gaps = 9/244 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI V+ K  G +P  N +LR  I  AK+ +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTVIGREIAVAVKEGGPDPANNSKLRDVIAKAKSNN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + IER IKKA  D +  NY    YEGYGP G+AII+E LTDN+NRTA+++RS F+K 
Sbjct: 61  MPNDTIERGIKKAAGDANSVNYVQNTYEGYGPNGIAIIVETLTDNKNRTAANVRSAFSKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEII-----YHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC 174
            G++G++G  +  F++ G+II     Y +   D +  M VA+++ A + + ED  Y    
Sbjct: 121 RGNIGTSGCVSFMFQKKGQIIVSKEEYET---DPDEFMMVALDAGAEDFVEEDDSYEITT 177

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           D +  G   + LE++     S +V   P NY+ L++ + +K++ + ++ L++DDDVQ+VY
Sbjct: 178 DPDAFGEVREALEKEGVPMASAEVTMIPDNYVTLTDPEDIKNLNRTLDLLDEDDDVQAVY 237

Query: 235 SNLE 238
            N E
Sbjct: 238 HNWE 241


>gi|291617756|ref|YP_003520498.1| YebC [Pantoea ananatis LMG 20103]
 gi|291152786|gb|ADD77370.1| YebC [Pantoea ananatis LMG 20103]
 gi|327394175|dbj|BAK11597.1| UPF0082 protein YebC [Pantoea ananatis AJ13355]
          Length = 247

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPGSNPRLRAAMDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G +D  N   I YEGYGP G AI+IE L+DNRNRT   +R  FTK 
Sbjct: 61  MTRDTMNRAIARGVGGEDDSNMETIIYEGYGPGGSAIMIECLSDNRNRTVGEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G +I  +   D +  ME A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKG-VISFAPGHDEDAVMEAALEAGAEDVVGYDDGAIDVFTAWEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 MGTVRDALEAAGFKADSAEVAMIPSTKAEM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|108804157|ref|YP_644094.1| hypothetical protein Rxyl_1318 [Rubrobacter xylanophilus DSM 9941]
 gi|118573928|sp|Q1AWE6|Y1318_RUBXD RecName: Full=UPF0082 protein Rxyl_1318
 gi|108765400|gb|ABG04282.1| protein of unknown function DUF28 [Rubrobacter xylanophilus DSM
           9941]
          Length = 250

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/256 (38%), Positives = 159/256 (62%), Gaps = 23/256 (8%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA +  +F+KLSR ITV+A+  G +P  NP L LA+Q AK+ +
Sbjct: 1   MSGHSKWSTIKRKKGAMDAKRGALFAKLSRAITVAAREGGGDPEANPALALAVQKAKDAN 60

Query: 61  MPKENIERAIKK---AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           MP +NI+RAI +   AGS+  G+Y +I YEGY P GVA+++E LTDNRNR AS IR IF+
Sbjct: 61  MPNDNIQRAIDRGTGAGSE-AGDYEHITYEGYAPGGVAVMVEVLTDNRNRAASDIRYIFS 119

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSN-IGDSNL--------AMEVAIESDAFEVLFEDQ 168
           K  G LG++GS    FE+ G ++  ++ +G+  L        A +V ++ D + V  E  
Sbjct: 120 KHGGKLGTSGSVAYLFERKGVVLVPADAVGEEELMEAALEAGAEDVELDGDHWRVTTEPS 179

Query: 169 EYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDD 228
           E++            + LEE     +S ++  +P+N ++L +A   +  +++I+ LE++D
Sbjct: 180 EFM---------AVRQGLEEAGIRYESAQLSMEPMNTVKL-DASTARQTLRLIDALEEND 229

Query: 229 DVQSVYSNLEIADDII 244
           DVQ VY+N +I+++++
Sbjct: 230 DVQEVYANFDISEEVM 245


>gi|301300038|ref|ZP_07206260.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           salivarius ACS-116-V-Col5a]
 gi|300214264|gb|ADJ78680.1| UPF0082 protein [Lactobacillus salivarius CECT 5713]
 gi|300852356|gb|EFK80018.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           salivarius ACS-116-V-Col5a]
          Length = 242

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 151/244 (61%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF K+SREI ++AK  G +P  NP+LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKISREIYMAAKSGGPDPDGNPQLRLIMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA      +Y  I YEGYGP GVAI++ ALTDNRNRTAS++R+ F +  
Sbjct: 61  MPKDNIKRAIDKATGTGGADYEEITYEGYGPAGVAILVHALTDNRNRTASAVRADFNRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G+LG TGS +  F++ G I I   ++  D +   E  IE+   ++   D+ +  Y D   
Sbjct: 121 GNLGETGSVSFMFDRKGYIAIAREDLDVDEDQMFEDVIEAGGEDLQTSDEVFEIYTDPKA 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 +L++K   A + ++   P N + +  ADKV+ + ++I+ LED+DDV  VY++ +
Sbjct: 181 FADVRDELQKKYDLA-TAELTMVPQNTVPVP-ADKVEQLQRLIDRLEDEDDVSEVYTSAD 238

Query: 239 IADD 242
             +D
Sbjct: 239 FPED 242


>gi|255280962|ref|ZP_05345517.1| glucose-1-phosphate adenylyltransferase [Bryantella formatexigens
           DSM 14469]
 gi|255268410|gb|EET61615.1| glucose-1-phosphate adenylyltransferase [Bryantella formatexigens
           DSM 14469]
          Length = 242

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 154/241 (63%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI V+ K  G +P  N RLR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTIIGREIAVAVKEGGPDPANNSRLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+R IKKA  D +  NY  + YEGYGP G+AII+EALTDN+NRTA+++RS FTK 
Sbjct: 61  MPNDTIDRGIKKAAGDANAVNYEYVSYEGYGPNGIAIIVEALTDNKNRTAANVRSAFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           NGS+G+ G  +  F++ G++I        D++  M +A+++ A +   E+  +    D +
Sbjct: 121 NGSIGTQGCVSYSFDKKGQMIIDKEECDMDADDLMMLALDAGAEDFSEEEDSFEIITDPD 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
             G   + LE++     S +V   P NY+ L++   +K++ + ++ L++DDDVQ+VY+NL
Sbjct: 181 EFGKVREALEKEGLVFASAEVTMIPQNYVALTDETALKNLQRTLDLLDEDDDVQNVYTNL 240

Query: 238 E 238
           E
Sbjct: 241 E 241


>gi|323339448|ref|ZP_08079729.1| glucose-1-phosphate adenylyl transferase [Lactobacillus ruminis
           ATCC 25644]
 gi|323093121|gb|EFZ35712.1| glucose-1-phosphate adenylyl transferase [Lactobacillus ruminis
           ATCC 25644]
          Length = 243

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 152/244 (62%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSR+I ++AK  G +P  NP+LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKLSRDIYMAAKSGGPDPDANPQLRLVMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RA+ KA   +  NY  I YEGYGP GVAI++ ALTDNRNRTAS++R+ F +  
Sbjct: 61  MPKDNIKRALDKATGANGANYEEITYEGYGPAGVAILVHALTDNRNRTASAVRADFNRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G+LG TGS    F++ G I I   ++  D +  +E A+ + A ++   ++ +  Y D   
Sbjct: 121 GNLGETGSVAFMFDRKGYIAIAREDLDVDEDAMLEDALNAGADDLQASEEVFEIYTDPQA 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 +L+ K  +  + ++   P N + +  ADKV+ + ++I+ LED+DDV  V+++ E
Sbjct: 181 FEDVRNELQNKY-DLDTAEITMVPQNTVPVP-ADKVEQLQRLIDRLEDEDDVSEVFTSAE 238

Query: 239 IADD 242
             D+
Sbjct: 239 FPDE 242


>gi|194333339|ref|YP_002015199.1| hypothetical protein Paes_0496 [Prosthecochloris aestuarii DSM 271]
 gi|226707642|sp|B4S5F5|Y496_PROA2 RecName: Full=UPF0082 protein Paes_0496
 gi|194311157|gb|ACF45552.1| protein of unknown function DUF28 [Prosthecochloris aestuarii DSM
           271]
          Length = 250

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/245 (42%), Positives = 148/245 (60%), Gaps = 7/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   D  +  +F+KL REIT++AK+ G +P  NPRLRLA+ NA+  S
Sbjct: 1   MSGHSKWSTIKRKKAATDQKRGNLFTKLVREITIAAKMGGGDPSGNPRLRLALDNARANS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP+ENI+RAIKK  G  D   Y  I YEGYGP G+A+IIE  TDNRNRT + IR I  ++
Sbjct: 61  MPQENIQRAIKKGTGELDGVVYEEITYEGYGPGGIALIIETATDNRNRTVADIRHIINRS 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQE--YIFYCDF 176
           NGSLG  GS +  F + G I +  S+ G+  L   +       E L  D E  Y    D 
Sbjct: 121 NGSLGENGSVSWMFHRKGCIDVLKSSAGEEELMEILLEA--GLEDLNTDDEQFYNVIIDV 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            ++    K L++K    ++ ++   P NY+ L   D VK+ +K+I+ LE+ DDVQ VYSN
Sbjct: 179 KDLESAKKALDDKGIAYENARMDMIPDNYVELEAEDAVKA-VKLIDALENSDDVQVVYSN 237

Query: 237 LEIAD 241
           +E ++
Sbjct: 238 IEFSE 242


>gi|203287497|ref|YP_002222512.1| hypothetical protein BRE_29 [Borrelia recurrentis A1]
 gi|226734019|sp|B5RQK7|Y029_BORRA RecName: Full=UPF0082 protein BRE_29
 gi|201084717|gb|ACH94291.1| uncharacterized conserved protein [Borrelia recurrentis A1]
          Length = 243

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 157/248 (63%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REI+++A++ G +   NPRLRLA+  A+  +
Sbjct: 1   MSGHSKWSTIKRKKGTLDAKRNKIFTKLIREISIAARMGGGDIDSNPRLRLAVNKARVAN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK   D++G+ Y  + YE Y   GVA+II+ LTDN+NRTAS +RS+ +K+
Sbjct: 61  MPKDNIEKAIKKGIGDNMGSEYFKLTYEAYALYGVALIIKCLTDNKNRTASEVRSVLSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ--EYIFYCD-F 176
            GSLG+ GS +  F + G I Y+ +    +  +E+A+E+ A ++  E    E I   D F
Sbjct: 121 GGSLGAPGSVSYMFHKKGLISYNLDKYHEDEIIELALEAGAEDIYSEGSQVEVITSADNF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
            +V  +   K EE I E     V   P + + L + +++  ++ +IE LED DDVQ VY 
Sbjct: 181 ESVSSILRTKFEEDIAE-----VALVPESKVAL-DKEQMDKVLAIIEKLEDCDDVQEVYH 234

Query: 236 NLEIADDI 243
           NLEI DDI
Sbjct: 235 NLEIVDDI 242


>gi|238751588|ref|ZP_04613078.1| hypothetical protein yrohd0001_32930 [Yersinia rohdei ATCC 43380]
 gi|238792581|ref|ZP_04636214.1| hypothetical protein yinte0001_20720 [Yersinia intermedia ATCC
           29909]
 gi|238710150|gb|EEQ02378.1| hypothetical protein yrohd0001_32930 [Yersinia rohdei ATCC 43380]
 gi|238728216|gb|EEQ19737.1| hypothetical protein yinte0001_20720 [Yersinia intermedia ATCC
           29909]
          Length = 247

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDAVMDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVALIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|15639465|ref|NP_218915.1| hypothetical protein TP0474 [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189025705|ref|YP_001933477.1| hypothetical protein TPASS_0474 [Treponema pallidum subsp. pallidum
           SS14]
 gi|6226380|sp|O83487|Y474_TREPA RecName: Full=UPF0082 protein TP_0474
 gi|226706230|sp|B2S369|Y474_TREPS RecName: Full=UPF0082 protein TPASS_0474
 gi|3322762|gb|AAC65461.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum
           str. Nichols]
 gi|189018280|gb|ACD70898.1| hypothetical protein TPASS_0474 [Treponema pallidum subsp. pallidum
           SS14]
 gi|291059857|gb|ADD72592.1| conserved hypothetical protein [Treponema pallidum subsp. pallidum
           str. Chicago]
          Length = 245

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 151/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H K   DA + ++F+K  +EI+V+A+++G +P  NPRLR AI  A+  +
Sbjct: 1   MSGHSKWATIKHAKGAADAKRGQLFTKFIKEISVAARMAGGDPQANPRLRTAILKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK   +  G+ Y  + YEGY P GVA+++E LTDN+NR A+++R++F++ 
Sbjct: 61  MPKDNIERAIKKGTGELSGSSYEELVYEGYAPGGVAVLVEVLTDNKNRAAANVRNLFSRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LGS GS +  F + G I Y S   D    ME+A+E+ A ++                
Sbjct: 121 GGNLGSAGSVSYMFNRKGVIEYDSEQVDEEALMELALEAGAEDIQNAGGVLTVTTVPGTF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L+ K  E+ S  +   P  Y+ L + +  + ++KMI+ LE+++DVQ+VYSN +I
Sbjct: 181 ETVLESLQAKGWESLSAGISMVPDTYLAL-DEETARKVLKMIDRLEEEEDVQAVYSNADI 239

Query: 240 ADDII 244
             +++
Sbjct: 240 PSELV 244


>gi|123442637|ref|YP_001006614.1| hypothetical protein YE2395 [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|332161516|ref|YP_004298093.1| hypothetical protein YE105_C1894 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|166228368|sp|A1JRK5|Y2395_YERE8 RecName: Full=UPF0082 protein YE2395
 gi|122089598|emb|CAL12447.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|318605498|emb|CBY26996.1| hypothetical protein Y11_11851 [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325665746|gb|ADZ42390.1| hypothetical protein YE105_C1894 [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 247

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDAVMDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVSLIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|226954206|ref|ZP_03824670.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
 gi|226835075|gb|EEH67458.1| conserved hypothetical protein [Acinetobacter sp. ATCC 27244]
          Length = 279

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 151/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +A+L G +   NPRLR  ++ A + +
Sbjct: 31  MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTAARLGGPDAASNPRLRAVVEKALSVN 90

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG ++  +   + YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 91  MTRDTINRAIQRGAGGEENDDLKEVTYEGYGVGGVAVIVETMTDNLNRTVPDVRHCFSKT 150

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  ++   +  MEVA+E+ A ++  ++   +      + 
Sbjct: 151 NGNLGTNGSVAYLFTKRGEISFE-DVSLEDKIMEVALEAGADDIEVDEDSILVITSPESF 209

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 210 GEVQDALAAAGLKSDNAEVVMSPSTKAEITDVDQAKQIMKMIDMLEDLDDVQNVYTNVEF 269

Query: 240 ADDII 244
           +++++
Sbjct: 270 SEEVL 274


>gi|203283954|ref|YP_002221694.1| hypothetical protein BDU_30 [Borrelia duttonii Ly]
 gi|226734020|sp|B5RLN2|Y030_BORDL RecName: Full=UPF0082 protein BDU_30
 gi|201083397|gb|ACH92988.1| uncharacterized conserved protein [Borrelia duttonii Ly]
          Length = 243

 Score =  176 bits (445), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 157/248 (63%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REI+++A++ G +   NPRLRLA+  A+  +
Sbjct: 1   MSGHSKWSTIKRKKGTLDAKRNKIFTKLIREISIAARMGGGDIDSNPRLRLAVNKARVAN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK   D++G+ Y  + YE Y   GVA+II+ LTDN+NRTAS +RS+ +K+
Sbjct: 61  MPKDNIEKAIKKGIGDNMGSEYFELTYEAYALYGVALIIKCLTDNKNRTASEVRSVLSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ--EYIFYCD-F 176
            GSLG+ GS +  F + G I Y+ +    +  +E+A+E+ A ++  E    E I   D F
Sbjct: 121 GGSLGAPGSVSYMFHKKGLISYNLDKYHEDEIIELALEAGAEDIYSEGSQVEVITSADNF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
            +V  +   K EE I E     V   P + + L + +++  ++ +IE LED DDVQ VY 
Sbjct: 181 ESVSSILRTKFEEDIAE-----VALVPESKVAL-DKEQMDKVLAIIEKLEDCDDVQEVYH 234

Query: 236 NLEIADDI 243
           NLEI DDI
Sbjct: 235 NLEIVDDI 242


>gi|227891634|ref|ZP_04009439.1| protein of hypothetical function DUF28 [Lactobacillus salivarius
           ATCC 11741]
 gi|227866550|gb|EEJ73971.1| protein of hypothetical function DUF28 [Lactobacillus salivarius
           ATCC 11741]
          Length = 253

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 151/244 (61%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF K+SREI ++AK  G +P  NP+LRL +  A+  +
Sbjct: 12  MSGHSKWHNIQGRKNAQDAKRGKIFQKISREIYMAAKSGGPDPDGNPQLRLIMDKARAAN 71

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA      +Y  I YEGYGP GVAI++ ALTDNRNRTAS++R+ F +  
Sbjct: 72  MPKDNIKRAIDKATGTGGADYEEITYEGYGPAGVAILVHALTDNRNRTASAVRADFNRNG 131

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G+LG TGS +  F++ G I I   ++  D +   E  IE+   ++   D+ +  Y D   
Sbjct: 132 GNLGETGSVSFMFDRKGYIAIAREDLDVDEDQMFEDVIEAGGEDLQTSDEVFEIYTDPKA 191

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 +L++K   A + ++   P N + +  ADKV+ + ++I+ LED+DDV  VY++ +
Sbjct: 192 FADVRDELQKKYDLA-TAELTMVPQNTVPVP-ADKVEQLQRLIDRLEDEDDVSEVYTSAD 249

Query: 239 IADD 242
             +D
Sbjct: 250 FPED 253


>gi|304396237|ref|ZP_07378119.1| protein of unknown function DUF28 [Pantoea sp. aB]
 gi|304356606|gb|EFM20971.1| protein of unknown function DUF28 [Pantoea sp. aB]
          Length = 247

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 143/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPGSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ ++RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT   +R  FTK 
Sbjct: 61  MTRDTMDRAIARGVGGDDNANMETIIYEGYGPGGSAIMIECLSDNRNRTVGEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +     D +  ME A+E+   +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVAYLFNKKGVISFAPGQ-DEDAVMEAALEAGGEDVVTYDDGAIDVFTAWEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 MGTVRDALEALGLKADTAEVAMIPTTKAEM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|74318233|ref|YP_315973.1| hypothetical protein Tbd_2215 [Thiobacillus denitrificans ATCC
           25259]
 gi|119372128|sp|Q3SGS9|Y2215_THIDA RecName: Full=UPF0082 protein Tbd_2215
 gi|74057728|gb|AAZ98168.1| Protein of unknown function DUF28 [Thiobacillus denitrificans ATCC
           25259]
          Length = 243

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 146/245 (59%), Gaps = 6/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KIF+KL +EITV+AK+ G +P  NPRLRLAI+  K +S
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKIFTKLIKEITVAAKMGGGDPAMNPRLRLAIEKGKAES 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+NIE AIK+      G NY   RYEGYG  GVA++++ LTDN+ RT + +R  FTK 
Sbjct: 61  LPKDNIENAIKRGTGQLEGVNYEEARYEGYGIGGVAVMVDCLTDNKTRTVADVRHAFTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ---EYIFYCDF 176
            G++G+ G     F+ +G+I+      +  + ME A+++ A +V+  D    E +   D 
Sbjct: 121 GGNMGTDGCVAFQFKHVGQIVLEPGASEEAV-MEAALDAGADDVIPNDDGSIEVLTSPDP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  + LE+   +    ++  +P     L+  D  K + K+++ LE  DDVQ VY+N
Sbjct: 180 KAFEAVKEALEKAGFKPAVAEITMRPEAETELAGDDAAK-MQKILDALESLDDVQEVYTN 238

Query: 237 LEIAD 241
             + D
Sbjct: 239 AVLPD 243


>gi|332284808|ref|YP_004416719.1| hypothetical protein PT7_1555 [Pusillimonas sp. T7-7]
 gi|330428761|gb|AEC20095.1| hypothetical protein PT7_1555 [Pusillimonas sp. T7-7]
          Length = 247

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 143/238 (60%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+++K+ REITV+A+  G +P  NPRLR+A   A   +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLWTKIIREITVAARAGGPDPDTNPRLRMAWDKATAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++ AG+ D  NY  IRYEGYG  G A+I++ +TDNR RT + +R  F+K 
Sbjct: 61  MPKDNIQRAIQRGAGAADGANYEEIRYEGYGVGGAAVIVDCMTDNRMRTVAEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG  GS    F   G+ ++     +  + ME A+E+ A ++  +++  I        
Sbjct: 121 GGNLGQEGSVAFMFNHCGQFLFAPGTSEEAV-MEAALEAGAEDIHTDEEGMIEVITAPGD 179

Query: 180 GLTSKKLEEKIGEAQSIK-VIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
               K   E+ G    ++ V+ K LN   L+  D +K + KM++ LE  DDVQ VYS 
Sbjct: 180 YAAVKTAFEQAGLMPEVQDVVMKALNEAELTGDDAIK-MQKMLDMLESLDDVQEVYST 236


>gi|317491785|ref|ZP_07950220.1| hypothetical protein HMPREF0864_00983 [Enterobacteriaceae bacterium
           9_2_54FAA]
 gi|316920219|gb|EFV41543.1| hypothetical protein HMPREF0864_00983 [Enterobacteriaceae bacterium
           9_2_54FAA]
          Length = 248

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +AKL G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAAKLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G AI++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDTNMETIIYEGYGPGGSAIMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-DEDTVMDAALEAGADDVVTYDDGAIDVFTPWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A+S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGEVKDALDAAGLVAESAEVSMIPSTKAEM-DAETAPKLMRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           ++D++
Sbjct: 239 VSDEV 243


>gi|94986713|ref|YP_594646.1| hypothetical protein LI0269 [Lawsonia intracellularis PHE/MN1-00]
 gi|118574129|sp|Q1MRQ1|Y269_LAWIP RecName: Full=UPF0082 protein LI0269
 gi|94730962|emb|CAJ54325.1| uncharacterized conserved protein [Lawsonia intracellularis
           PHE/MN1-00]
          Length = 246

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 152/256 (59%), Gaps = 25/256 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K F+K ++EI ++AK +G +P  NPRLR AI  AK+ +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKEFTKAAKEIIIAAK-NGGDPSGNPRLRAAIAAAKSIN 59

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AI+K  G D  G+ T I YEGYGP GVA++IE  TDNRNR+ + +R I +K 
Sbjct: 60  LPKDKIEAAIRKGTGQDSGGDITEIMYEGYGPGGVAVLIEVATDNRNRSVADLRHIMSKN 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI---------ESDAFEVLFEDQEY 170
            GS+G +GS +  FE+ G  ++          ME A+         E D +E+      +
Sbjct: 120 GGSMGESGSVSWMFERKGVFVFEKTAYSEEELMEAALAAGADDLHDEGDTWEI------H 173

Query: 171 IFYCDFNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDD 228
               DFN V     S KL       QS ++   P N I + + +  K ++K++E LED D
Sbjct: 174 TSMSDFNTVREAFESDKL-----IMQSAELAMIPQNMISV-DIETAKKVVKLLEALEDYD 227

Query: 229 DVQSVYSNLEIADDII 244
           DVQ VYSN++I D+I+
Sbjct: 228 DVQQVYSNVDIPDEIM 243


>gi|238796294|ref|ZP_04639803.1| hypothetical protein ymoll0001_21200 [Yersinia mollaretii ATCC
           43969]
 gi|238719739|gb|EEQ11546.1| hypothetical protein ymoll0001_21200 [Yersinia mollaretii ATCC
           43969]
          Length = 247

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDAVMDAALEAGADDIVVYDDGAIDVFTPWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVSLIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|325971235|ref|YP_004247426.1| hypothetical protein SpiBuddy_1407 [Spirochaeta sp. Buddy]
 gi|324026473|gb|ADY13232.1| UPF0082 protein yeeN [Spirochaeta sp. Buddy]
          Length = 249

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 149/249 (59%), Gaps = 12/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K   DA + + F+KL +EI+V+AK+ G +P  N RLR A+  A+ ++
Sbjct: 1   MSGHSKWATIKHKKGIADAKRGQKFTKLIKEISVAAKMGGADPETNARLRTAVLKARAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAIKK AG  D   Y  + YEGY P GVA+II+ LTDN+NRTAS +RS  TK 
Sbjct: 61  MPKDNIDRAIKKGAGELDNSTYYELTYEGYAPGGVALIIDTLTDNKNRTASDVRSTLTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFED---QEYIFYCDF 176
            G+LG++G  +  F+  G I Y +         EVA+E+ A +V   D   +      DF
Sbjct: 121 GGTLGASGCVSYMFQTKGIITYDTEKYSEEQIFEVALENGADDVTTNDGVIEVITTPSDF 180

Query: 177 NNVGLTSKKLE--EKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
            NV      LE  +K G  Q    + K  +     ++DK + ++K+I+ LE+ DDVQ V 
Sbjct: 181 GNV------LEAMQKAGFEQESAEVEKVADQTVTLDSDKARKVLKIIDKLEELDDVQLVS 234

Query: 235 SNLEIADDI 243
           SNLE+ DD 
Sbjct: 235 SNLELPDDF 243


>gi|294141124|ref|YP_003557102.1| hypothetical protein SVI_2353 [Shewanella violacea DSS12]
 gi|293327593|dbj|BAJ02324.1| conserved hypothetical protein [Shewanella violacea DSS12]
          Length = 248

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 150/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +   NPRLR AI  + + +
Sbjct: 1   MAGHSKWDNIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDADSNPRLRAAIDKSLSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ IERA+K+ AG  D      I YEGYGP G A+++E +TDN+NRT S +R+ F+K+
Sbjct: 61  MTRDTIERAVKRGAGELDGQVLETIMYEGYGPGGTAVMVETMTDNKNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F++ G II +    D ++ M+ A+E+ A +V+  ED     +    +
Sbjct: 121 GGNLGTDGSVSYLFDKKG-IISYGEGTDEDIVMDAALEAGADDVVSHEDGAIDVFTSPED 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    E+ + +V   P     L +A      +++I+NLED DDVQ VY N E
Sbjct: 180 FGAVKDALDAAGLESVNAEVTMVPSTKASL-DASTAAKFLRLIDNLEDHDDVQEVYHNAE 238

Query: 239 IADDII 244
           I+D+++
Sbjct: 239 ISDEVM 244


>gi|21959102|gb|AAM85815.1|AE013828_6 hypothetical protein y2255 [Yersinia pestis KIM 10]
 gi|45436562|gb|AAS62116.1| conserved hypothetical protein [Yersinia pestis biovar Microtus
           str. 91001]
          Length = 251

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 5   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 64

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 65  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 124

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 125 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDTVMDAALEAGADDIVVYDDGAIDVFTAWES 183

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 184 LGAVKDALDATGLVAEGAEVSLIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 242

Query: 239 IADDI 243
           I+D++
Sbjct: 243 ISDEV 247


>gi|17231768|ref|NP_488316.1| hypothetical protein all4276 [Nostoc sp. PCC 7120]
 gi|33517074|sp|Q8YPC2|Y4276_ANASP RecName: Full=UPF0082 protein all4276
 gi|17133411|dbj|BAB75975.1| all4276 [Nostoc sp. PCC 7120]
          Length = 252

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 158/249 (63%), Gaps = 7/249 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K   DA K K F++LSR I ++A+    +P  N +LR AI  AK   
Sbjct: 1   MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIILAARSGVPDPSGNFQLRTAIDKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+   D  +   IRYEGYGP GVAI+IEALTDNRNRTA+ +R  F+
Sbjct: 61  IPNDNIERAIAKGAGTFGGDNASLEEIRYEGYGPGGVAILIEALTDNRNRTAADLRVAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLFEDQEYIFYCD 175
           K  G+LG TG  +  F+Q G +   S + D +  +E ++E  A  +E + ED+    + +
Sbjct: 121 KNGGNLGETGCVSWMFDQKG-VCVVSGVVDEDQLLEASLEGGAESYE-MTEDETAEVFTE 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
             N+ + ++ L+++  +    ++ W P N++ ++  D+ +S++K+I+ LE  DDVQ+V S
Sbjct: 179 VANLEILNQTLKDQGFKVTDAELRWIPSNHLEVTEPDQARSLLKLIDTLEGLDDVQNVTS 238

Query: 236 NLEIADDII 244
           N E++++++
Sbjct: 239 NFEMSENLM 247


>gi|57239094|ref|YP_180230.1| hypothetical protein Erum3660 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58579041|ref|YP_197253.1| hypothetical protein ERWE_CDS_03770 [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58617099|ref|YP_196298.1| hypothetical protein ERGA_CDS_03720 [Ehrlichia ruminantium str.
           Gardel]
 gi|67461867|sp|Q5FHN8|Y372_EHRRG RecName: Full=UPF0082 protein ERGA_CDS_03720
 gi|67461880|sp|Q5HBG4|Y377_EHRRW RecName: Full=UPF0082 protein Erum3660/ERWE_CDS_03770
 gi|57161173|emb|CAH58087.1| conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58416711|emb|CAI27824.1| Conserved hypothetical protein [Ehrlichia ruminantium str. Gardel]
 gi|58417667|emb|CAI26871.1| Conserved hypothetical protein [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 249

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/243 (40%), Positives = 147/243 (60%), Gaps = 6/243 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +++ F+KL REI V+ K    +P  N RLR AI  AK ++
Sbjct: 1   MAGHSQFANIKHRKGAQDAKRAQKFTKLIREIIVATKQGLPDPEFNSRLRSAIITAKKEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ I+ AIK A G++   N+  + YEGYGP  +A+II+ LT+NRNRTA+ +R   +K 
Sbjct: 61  LPKDRIDAAIKTASGNNQHDNFEEVVYEGYGPGNIALIIQTLTNNRNRTAAELRHALSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIGDSNLAMEVAIESDAFEV----LFEDQEYIFYC 174
           NG LG +GS +  F  +G I Y  S+I   +     AIE  A +V      E++ Y   C
Sbjct: 121 NGKLGESGSVSFLFNHVGLIAYKASSINSFDTLFNTAIELQALDVEENDYDEEKMYYVTC 180

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           +  + G    +L +K  +A+  ++ WKP+N   + + +  K I+ +++ LE++DDVQ V 
Sbjct: 181 NIQDFGNVRDQLFKKFSDAEFSRLFWKPINITTIDDEELQKRILNLMDVLENNDDVQHVD 240

Query: 235 SNL 237
           SN 
Sbjct: 241 SNF 243


>gi|139438475|ref|ZP_01771991.1| Hypothetical protein COLAER_00981 [Collinsella aerofaciens ATCC
           25986]
 gi|133776014|gb|EBA39834.1| Hypothetical protein COLAER_00981 [Collinsella aerofaciens ATCC
           25986]
          Length = 268

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 154/263 (58%), Gaps = 20/263 (7%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQN-PLENPRLRLAIQNAKNQ 59
           M+GHS++    HRK  +DA +S +FSKLSR ITV+A+L G   P  N  L  A+  AK Q
Sbjct: 1   MSGHSKWATTKHRKGAQDAKRSALFSKLSRNITVAARLGGDPLPENNASLAAAVAKAKAQ 60

Query: 60  SMPKENIERAIKKA-GSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           SMPK+ I+ AI KA GS  D   Y NI YEGYGP GVA+ ++ LTDNRNRTA+ +RS F+
Sbjct: 61  SMPKDKIKSAIDKAFGSGADAAVYENIVYEGYGPAGVAVYVDCLTDNRNRTAADVRSAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI------ESDAFEVL------- 164
            A G+LG++GS    FE+ G+I+    I D N   E  I      + D F +        
Sbjct: 121 HAGGNLGTSGSVAFQFERKGQIVVAKEILDENAKKETMIANGAAGDEDEFMMAIAEAGGE 180

Query: 165 -FED--QEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMI 221
            +ED  +E+I +   N V   SK LEE+  + +  +    P     +S AD  K + ++I
Sbjct: 181 DYEDAGEEWIVWTTANEVMAVSKALEEQGVQVKGSETTMVPTTPTEVSGAD-AKKVQRLI 239

Query: 222 ENLEDDDDVQSVYSNLEIADDII 244
           + LE+ DDVQ VYS +++ D++I
Sbjct: 240 DRLEELDDVQDVYSTMDMTDEVI 262


>gi|238788522|ref|ZP_04632315.1| hypothetical protein yfred0001_1880 [Yersinia frederiksenii ATCC
           33641]
 gi|238723435|gb|EEQ15082.1| hypothetical protein yfred0001_1880 [Yersinia frederiksenii ATCC
           33641]
          Length = 247

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGLAE-DAVMDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVSLIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|262372335|ref|ZP_06065614.1| conserved hypothetical protein [Acinetobacter junii SH205]
 gi|262312360|gb|EEY93445.1| conserved hypothetical protein [Acinetobacter junii SH205]
          Length = 249

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 90/245 (36%), Positives = 150/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA + K+F+K  REI  +++L G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANIKHRKAKQDASRGKVFTKYIREIVTASRLGGPDAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   + YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGEDNDDLKEVTYEGYGVGGVAVIVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS    F + GEI +  ++   +  MEVA+E+ A ++  ++   +      + 
Sbjct: 121 NGNLGTNGSVAYLFTKRGEISF-DDVSLEDKVMEVALEAGADDIEIDEDSILVITSPESF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ D+ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 180 GDVQDALTAAGLKSDNAEVVMSPSTKAEINDIDQAKQIMKMIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
            ++++
Sbjct: 240 TEEVL 244


>gi|325981220|ref|YP_004293622.1| hypothetical protein NAL212_0515 [Nitrosomonas sp. AL212]
 gi|325530739|gb|ADZ25460.1| protein of unknown function DUF28 [Nitrosomonas sp. AL212]
          Length = 241

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 151/237 (63%), Gaps = 4/237 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K  +DA + KIF++L +EITV+A++ G +P  NPRLRLA+  A  Q+
Sbjct: 1   MAGHSKWANIKHKKAAQDAKRGKIFTRLIKEITVAARMGGGDPDSNPRLRLAMDKAYGQN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIK+  G+ D  +Y  IRYEGYG  G A++++ +TDNR RT + +R  FTK 
Sbjct: 61  MPKDNIERAIKRGCGALDGVDYEEIRYEGYGIAGAAVMVDCMTDNRVRTVADVRHAFTKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F+  G++I+     +  + +E A+E+ A +V+  +   I        
Sbjct: 121 GGNLGTDGSVSFLFKHCGQLIFAPGTNEDEI-IEAALENGAEDVIGSEDGSIEVVTAPYE 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
            +  K   EK G +A+  +V  KP N   LS  + +K + K+++ LE+ DDVQ+VY+
Sbjct: 180 FINIKDALEKAGFKAELAEVTMKPGNETVLSGDEAIK-MQKLLDALENLDDVQNVYT 235


>gi|328953688|ref|YP_004371022.1| UPF0082 protein yeeN [Desulfobacca acetoxidans DSM 11109]
 gi|328454012|gb|AEB09841.1| UPF0082 protein yeeN [Desulfobacca acetoxidans DSM 11109]
          Length = 250

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 95/246 (38%), Positives = 148/246 (60%), Gaps = 2/246 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA + KIFSKL++EI V+A++ G +P  N RLR AI  AK ++
Sbjct: 1   MSGHSKWSTIKRKKGAADAKRGKIFSKLNKEIMVAARIGGSDPSGNTRLRAAIAAAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPKENI+RAIKK   +  G   +  + YEGYGP GVA+++E+LTDN+NRT S +R +F+K
Sbjct: 61  MPKENIDRAIKKGAGELEGANAFEEVFYEGYGPSGVALLVESLTDNKNRTVSEVRHLFSK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             GS+G  G     F++ G I +  +    +  +E A+E+ A ++   + EY    D  +
Sbjct: 121 YGGSMGEAGCVAWMFDKKGVIAFSRDAVSEDELLEAALEAGAEDLQVGESEYEVITDLAS 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LEE+  + +  ++   P   IRL      + ++K++E LED DDVQ V++N +
Sbjct: 181 FEKVKNALEEQGFKWEVAEIQMHPKTTIRLEEEKSAQQLLKLMEMLEDLDDVQHVFANFD 240

Query: 239 IADDII 244
           I D ++
Sbjct: 241 IPDSLL 246


>gi|90411661|ref|ZP_01219671.1| hypothetical protein P3TCK_16399 [Photobacterium profundum 3TCK]
 gi|90327551|gb|EAS43904.1| hypothetical protein P3TCK_16399 [Photobacterium profundum 3TCK]
          Length = 247

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+F NI HRK  +D+ + KIF+KL REI V+ K  G     NPRLR A+  A + +
Sbjct: 1   MAGHSKFANIKHRKAAQDSKRGKIFTKLIREIVVATKDGGPEAENNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RA+K+ AG D   +   + YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTINRAVKRGAGGDGEADLETVIYEGYGPAGTAVMVECMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G I Y + + D ++ ME A+ES A ++   D   I  Y   ++
Sbjct: 121 GGNLGTDGSVNYLFDKKGVISYAAGL-DEDVMMEAALESGAEDIETNDDGSIDVYTTPSD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A + +V   P     L + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGSVKDALDAAGFDAANAEVTLVPSTKADL-DLETAPKLLRLIDALEDLDDVQEVYHNGE 238

Query: 239 IADDI 243
           I D+I
Sbjct: 239 ITDEI 243


>gi|154249785|ref|YP_001410610.1| hypothetical protein Fnod_1106 [Fervidobacterium nodosum Rt17-B1]
 gi|171769425|sp|A7HM20|Y1106_FERNB RecName: Full=UPF0082 protein Fnod_1106
 gi|154153721|gb|ABS60953.1| protein of unknown function DUF28 [Fervidobacterium nodosum
           Rt17-B1]
          Length = 252

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 150/243 (61%), Gaps = 5/243 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA +SKIF+KL REI V+A+  G NP  NPRLR  ++ A+  +
Sbjct: 1   MSGHNKWANIKHRKAAQDAKRSKIFTKLIREIIVAAREGGGNPDTNPRLRAVLEKAREAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ +ER+IKK   +  G  Y  I YE Y P GVA+ I ALTDN+NRTA  +R I +K 
Sbjct: 61  MPKDTVERSIKKGTGELEGEKYEEIIYEAYAPGGVALYILALTDNKNRTAQELRHILSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS    FE+ G I I  S I D +    +AI++ A E + E    I Y    +
Sbjct: 121 GGSLAESGSVAWIFERKGAIEISASKISDMDEFTLLAIDAGA-EDIEEGDPVIVYVAPES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +    + L +   E +S K+ +KP N ++++ +D  K ++K+I+ LED+DDVQ V+ N +
Sbjct: 180 LTAVKEALAKNGFEGES-KITYKPKNTVKVTGSDAEK-VLKLIDALEDNDDVQEVFGNFD 237

Query: 239 IAD 241
           I D
Sbjct: 238 IDD 240


>gi|148652820|ref|YP_001279913.1| hypothetical protein PsycPRwf_1013 [Psychrobacter sp. PRwf-1]
 gi|170676080|sp|A5WE72|Y1013_PSYWF RecName: Full=UPF0082 protein PsycPRwf_1013
 gi|148571904|gb|ABQ93963.1| protein of unknown function DUF28 [Psychrobacter sp. PRwf-1]
          Length = 248

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 150/245 (61%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF+K+ RE+  + K    +P  NPRLR A++ A + +
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTKIIRELVSATKQGDPDPESNPRLRAAVEKALSAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ I+RAI++ AG+ D G    + YEGYG  GVA+++E +TDN NRT S +R  FTK 
Sbjct: 61  MTKDTIKRAIERGAGNSDGGEMDELTYEGYGVGGVAVLVETMTDNVNRTVSEVRHAFTKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           +G+LG+ GS    F + GEII+  ++   +  M VA+++ A ++  + +  +   + +  
Sbjct: 121 SGNLGTAGSVAYLFTKRGEIIF-DDVSLEDEIMLVALDAGAVDIENDGESLLVITEPDTF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L+    E+ + +V   P     + N D  + ++KMI+ LED DDVQ V++N++ 
Sbjct: 180 GAVKDALDAAGYESSNAEVTMSPSTTALIDNIDDAEKVMKMIDMLEDLDDVQDVHTNVDF 239

Query: 240 ADDII 244
            DD++
Sbjct: 240 TDDVL 244


>gi|332288348|ref|YP_004419200.1| DNA-binding regulatory protein, YebC/PmpR family [Gallibacterium
           anatis UMN179]
 gi|330431244|gb|AEC16303.1| DNA-binding regulatory protein, YebC/PmpR family [Gallibacterium
           anatis UMN179]
          Length = 247

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 149/248 (60%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AKL G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGADVGANPRLRTAVDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG  D  N  +I YEGYGP G AII+E LTDNR RT S +R  FTK+
Sbjct: 61  MTRDTINRAIQRGAGGGDDTNMESIVYEGYGPGGTAIIVECLTDNRKRTVSEVRHAFTKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ-EYIFYCDFNN 178
            G+LG+ GS    F + G I+   N  D +  ME AIE+ A +V  +D   +  Y  +  
Sbjct: 121 GGNLGTDGSVAYLFTRKGLILI--NEADEDALMEAAIEAGADDVQPQDDGSFEIYTAWEE 178

Query: 179 VGLTSKKLEE---KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           +G     LE+   KI EA+   V   P     L + +    ++++++ LED DDVQ+VY 
Sbjct: 179 LGSVRDALEQAGFKIDEAE---VTMIPSTTAEL-DVETAPKLMRLVDMLEDCDDVQNVYH 234

Query: 236 NLEIADDI 243
           N +++D++
Sbjct: 235 NGDMSDEV 242


>gi|146312078|ref|YP_001177152.1| hypothetical protein Ent638_2432 [Enterobacter sp. 638]
 gi|166987476|sp|A4WBM1|Y2432_ENT38 RecName: Full=UPF0082 protein Ent638_2432
 gi|145318954|gb|ABP61101.1| protein of unknown function DUF28 [Enterobacter sp. 638]
          Length = 246

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/245 (39%), Positives = 144/245 (58%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +   NPRLR AI  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDAGSNPRLRAAIDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDDDANMETIIYEGYGPGGTAVMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +  + GD +  ME A+E+ A +V+ F+D     Y  +  
Sbjct: 121 GGNLGTDGSVAYLFSKKGVISF--DAGDEDAIMEAALEAGAEDVVTFDDGAIDVYTAWEE 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L     +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 179 MGAVRDALAAMGLKADNAEVSMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|170024380|ref|YP_001720885.1| hypothetical protein YPK_2146 [Yersinia pseudotuberculosis YPIII]
 gi|226701189|sp|B1JLL3|Y2146_YERPY RecName: Full=UPF0082 protein YPK_2146
 gi|169750914|gb|ACA68432.1| protein of unknown function DUF28 [Yersinia pseudotuberculosis
           YPIII]
          Length = 247

 Score =  175 bits (444), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDTVMDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDVLDATGLVAEGAEVSLIPSTKAEL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|238762971|ref|ZP_04623938.1| hypothetical protein ykris0001_38920 [Yersinia kristensenii ATCC
           33638]
 gi|238698729|gb|EEP91479.1| hypothetical protein ykris0001_38920 [Yersinia kristensenii ATCC
           33638]
          Length = 247

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDNNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFE-VLFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + + +  M+ A+E+ A + V+++D     +  + +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGL-EEDAVMDAALEAGADDIVVYDDGAIDVFTAWES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+     A+  +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVKDALDATGLVAEGAEVSLIPSTKADL-DAETAPKLLRLIDMLEDSDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|304440194|ref|ZP_07400084.1| glucose-1-phosphate adenylyltransferase [Peptoniphilus duerdenii
           ATCC BAA-1640]
 gi|304371243|gb|EFM24859.1| glucose-1-phosphate adenylyltransferase [Peptoniphilus duerdenii
           ATCC BAA-1640]
          Length = 246

 Score =  175 bits (444), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 149/242 (61%), Gaps = 6/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI ++K ++DA + KIF+KL R I V+AK  G +P  N  L++AI  AK ++
Sbjct: 1   MSGHSKWNNIKNKKGKEDARRGKIFTKLGRYIMVAAKEGGPDPEYNASLKVAIDKAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NIERAIKK G  +LG  N+  I YEGYGP G+A++++ LTDNRNRTA  +R  F K
Sbjct: 61  MPNDNIERAIKK-GCGELGQDNFEEITYEGYGPSGIAVMVKCLTDNRNRTAPEVRHAFDK 119

Query: 119 ANGSLGSTGSTTRFFEQIGE--IIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             G+LG  G  +  FE+ G+  ++ H N+ D    M +A++  A +V+  D+ +      
Sbjct: 120 NGGNLGQPGCVSFMFEKKGQLGVLKHENV-DEEEFMLLALDLGAEDVIDRDEAFEIITSP 178

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LEE   E     + + P NY  L++ + +K + K+I+ LED+DDVQ VY+N
Sbjct: 179 ESYEEVRDGLEENGYEFVQSDITFLPSNYTELTDENDIKLMEKLIDTLEDNDDVQDVYTN 238

Query: 237 LE 238
            +
Sbjct: 239 WD 240


>gi|217973217|ref|YP_002357968.1| hypothetical protein Sbal223_2041 [Shewanella baltica OS223]
 gi|217498352|gb|ACK46545.1| protein of unknown function DUF28 [Shewanella baltica OS223]
          Length = 248

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 150/248 (60%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRVAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G + Y     D +  ME A+E+ A +++ ++D     + D  +
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGT-DEDALMEAALEAGAEDIVSYDDGAMDVFTDPVD 179

Query: 179 VGLTSKKLEEK--IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  L++   + +   I +I      + L  A+K    +++I+ LED DDVQ VY N
Sbjct: 180 FYTVKDALDKASFVADNAEIAMIASTKAELDLDTAEK---FMRLIDTLEDHDDVQEVYHN 236

Query: 237 LEIADDII 244
            EI+DD++
Sbjct: 237 AEISDDVM 244


>gi|238916834|ref|YP_002930351.1| glucose-1-phosphate adenylyltransferase [Eubacterium eligens ATCC
           27750]
 gi|259710169|sp|C4Z5P5|Y902_EUBE2 RecName: Full=UPF0082 protein EUBELI_00902
 gi|238872194|gb|ACR71904.1| glucose-1-phosphate adenylyltransferase [Eubacterium eligens ATCC
           27750]
          Length = 247

 Score =  175 bits (443), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 145/247 (58%), Gaps = 20/247 (8%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+K   DA K KIF++L +E+ ++ K  G +   N +LR  +   K  +
Sbjct: 1   MSGHSKFANIAHKKAANDAAKGKIFTRLGKELMIAVKEGGPDVNNNSKLRQVVAKCKAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MP + I+RAIKKA S+D+ NY ++ YEGYGP G AII+EALTDNRNR AS+IRS FTK  
Sbjct: 61  MPNDTIDRAIKKAASNDMSNYESVTYEGYGPNGTAIIVEALTDNRNRAASNIRSAFTKGG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAI---------ESDAFEVLFEDQE 169
           G++G+ G  +  F+  G++I       GD++  M +A+         E D +E+L   +E
Sbjct: 121 GNVGTPGCVSFMFDNKGQMIVDKEEYTGDADELMMLALDAGADDFNEEEDCYEILTSPEE 180

Query: 170 YIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDD 229
           +    D  N  L    +        S +V   P   + L++ D +K + +++  L++DDD
Sbjct: 181 F----DAVNQALADAGV-----TFASAEVTMIPQTTVDLTSEDDIKKMNRILGLLDEDDD 231

Query: 230 VQSVYSN 236
           VQ+VY N
Sbjct: 232 VQNVYHN 238


>gi|308187175|ref|YP_003931306.1| UPF0082 protein [Pantoea vagans C9-1]
 gi|308057685|gb|ADO09857.1| UPF0082 protein [Pantoea vagans C9-1]
          Length = 247

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 143/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDPGSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ ++RAI +  G DD  N   I YEGYGP G AI+IE L+DNRNRT   +R  FTK 
Sbjct: 61  MTRDTMDRAIARGVGGDDNANMETIIYEGYGPGGSAIMIECLSDNRNRTVGEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +     D +  ME A+E+   +++ ++D     +  +  
Sbjct: 121 GGNLGTDGSVAYLFNKKGVISFAPGQ-DEDAVMEAALEAGGEDIVTYDDGAIDVFTAWEE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A + +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 MGSVRDALEAAGLKADTAEVAMIPTTKAEM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|298490415|ref|YP_003720592.1| hypothetical protein Aazo_1140 ['Nostoc azollae' 0708]
 gi|298232333|gb|ADI63469.1| protein of unknown function DUF28 ['Nostoc azollae' 0708]
          Length = 251

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/249 (40%), Positives = 154/249 (61%), Gaps = 7/249 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA +  +F++LSR I V+A+    +   N +LR AI  AK   
Sbjct: 1   MAGHSKWANIKHQKAIVDAKRGNVFTQLSRAIIVAARNGVPDAAGNFQLRTAIDKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+   D  +   IRYEGYGP GVAI+IEALTDNRNRTA+ +R  F+
Sbjct: 61  IPNDNIERAIAKGAGTFGGDNSSLEEIRYEGYGPGGVAILIEALTDNRNRTAADLRVSFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLFEDQEYIFYCD 175
           K  G+LG TG  +  F Q    I    + +  L +E ++E DA  +E++ E+   +F  +
Sbjct: 121 KNGGNLGETGCVSWIFAQKWVCIVEGRVNEEQL-LEASLEGDAESYEMIAEEMVEVF-TE 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
             N+   S  L+ K      I++ W P N + +++ D+ KS++K+I+ LE  DDVQ+V +
Sbjct: 179 LVNLEKLSHTLKTKGFNVTDIELRWIPGNQVEVTDPDQAKSLLKLIDTLEGLDDVQNVTA 238

Query: 236 NLEIADDII 244
           N E+A++++
Sbjct: 239 NFEMAENLM 247


>gi|297616925|ref|YP_003702084.1| hypothetical protein Slip_0739 [Syntrophothermus lipocalidus DSM
           12680]
 gi|297144762|gb|ADI01519.1| protein of unknown function DUF28 [Syntrophothermus lipocalidus DSM
           12680]
          Length = 253

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/251 (40%), Positives = 155/251 (61%), Gaps = 11/251 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K R D  K K+F+K+++EI ++A+  G +P  NPRL+  IQ AK  +
Sbjct: 1   MSGHSKWANIKHKKARSDEKKGKVFTKIAKEIIIAARDGGGDPDNNPRLKALIQKAKGVN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI RAIK+  G  + GN   + YEGYGP GVA+++  +TDNRNRTA+ IR +F+K 
Sbjct: 61  MPNENILRAIKRGTGEIEGGNIEEVTYEGYGPGGVALMLSIVTDNRNRTAADIRHLFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHS-NIG-DSNLAMEVAIESDAFEVLFEDQEYIFYC--- 174
            G+LG  G  +  F + G +  +S +IG D++  M +AIE+ A +V  ED   +      
Sbjct: 121 GGNLGEAGCVSWMFRKKGLLTLNSEDIGMDADEFMLIAIEAGAEDVR-EDSGVLEVITSP 179

Query: 175 -DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
            DF+ V    ++LE       S +V   P   + +++ +  K ++K+++ LED DDVQ V
Sbjct: 180 EDFSTV---KEQLENYGIRFDSAQVAMVPETIVDVNDLETAKKVLKLVDILEDHDDVQEV 236

Query: 234 YSNLEIADDII 244
           Y+N  I DDI+
Sbjct: 237 YANFSIPDDIM 247


>gi|186685700|ref|YP_001868896.1| hypothetical protein Npun_R5651 [Nostoc punctiforme PCC 73102]
 gi|226707741|sp|B2J7Y8|Y5651_NOSP7 RecName: Full=UPF0082 protein Npun_R5651
 gi|186468152|gb|ACC83953.1| protein of unknown function DUF28 [Nostoc punctiforme PCC 73102]
          Length = 252

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 151/250 (60%), Gaps = 9/250 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K   DA K K F++LSR I V+A+    +P  N +LR AI  AK  S
Sbjct: 1   MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIIVAARSGVPDPALNFQLRTAIDKAKAAS 60

Query: 61  MPKENIERAIKKAGSDDLGN----YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           +P +NIERAI K G+   G     +  IRYEGYGP GVAI+IEA TDNRNRTA+ +R  F
Sbjct: 61  IPNDNIERAIAK-GAGTFGGDNAIFEAIRYEGYGPGGVAILIEAFTDNRNRTAADLRVAF 119

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLFEDQEYIFYC 174
           +K  G+LG TG  +  F+Q G  +    I +  L +E ++E  A  +E + ED+    + 
Sbjct: 120 SKNGGNLGETGCVSWMFDQKGVCVVQGVIDEEQL-LEASLEGGAESYE-MTEDEMAEVFT 177

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           D  N+   S+ L+ +  +    +  W P N + +++ D+ +S+ K+I+ LE  DDVQ+V 
Sbjct: 178 DIGNLEALSQTLKNQGFKVTDAEFRWIPSNSVEVTDPDQARSLFKLIDTLEGLDDVQNVT 237

Query: 235 SNLEIADDII 244
           +N +I ++++
Sbjct: 238 ANFDITEELM 247


>gi|153003533|ref|YP_001377858.1| hypothetical protein Anae109_0661 [Anaeromyxobacter sp. Fw109-5]
 gi|152027106|gb|ABS24874.1| protein of unknown function DUF28 [Anaeromyxobacter sp. Fw109-5]
          Length = 248

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 97/248 (39%), Positives = 156/248 (62%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I  +KE + A K K+FSK+ +EITV+A++ G +P  NPRLR AI  AK  +
Sbjct: 1   MSGHNRWSKIKRKKEAQGAAKGKLFSKVIKEITVAARMGGGDPAGNPRLRAAIDAAKEAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP++NI RA+KK   +  G +Y  + YEGYGP GVA+++E LTDNRNRTA  +RS F+K 
Sbjct: 61  MPQDNITRAVKKGTGELEGVSYEEVVYEGYGPAGVAMMVECLTDNRNRTAGDVRSSFSKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+L + G+    FE+ G +       +  +  E AIE+ A +V+      +      N+
Sbjct: 121 GGNLAAEGAVAWNFEKRGVVEVRPGPTEDRV-TEAAIEAGAEDVVSLGADGFEVRTHPND 179

Query: 179 VGLTSKKLEE--KIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           +   +  LE+  K+G A+ I  + K    +RL++ D+ ++++K+++ LED +DVQSV++N
Sbjct: 180 LHAVAASLEKTLKLG-ARRITFVAK--ETVRLADPDRARAVLKLVDALEDLEDVQSVHAN 236

Query: 237 LEIADDII 244
            EI D ++
Sbjct: 237 FEIDDKLM 244


>gi|312898903|ref|ZP_07758291.1| conserved hypothetical protein TIGR01033 [Megasphaera
           micronuciformis F0359]
 gi|310620065|gb|EFQ03637.1| conserved hypothetical protein TIGR01033 [Megasphaera
           micronuciformis F0359]
          Length = 255

 Score =  175 bits (443), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/244 (38%), Positives = 145/244 (59%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  +K + DA++ KI +K+SREIT++ ++ G +P  N RL+LA+Q AK  +
Sbjct: 10  MSGHSKWANIKRKKGKNDAVRGKITTKISREITIAVRMGGADPTGNMRLKLALQKAKENN 69

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PKENI RAI+K AG+ +  +Y  I YEGYGP GVA+ +  LTDNRNR A+ +R +F+K 
Sbjct: 70  IPKENINRAIQKGAGTLEGQSYEEIVYEGYGPAGVALTVNVLTDNRNRAAADVRHLFSKH 129

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G TG  +  F+ +G  +   +  D +  MEVA+++ A ++  E  EY         
Sbjct: 130 GGNMGETGCVSWMFKNLGLFVVAKDAVDEDKLMEVALDAGADDIRTEGDEYEIVTTPEAY 189

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + L +     +  ++   P   I LS  D  K +  MI+  +D DDVQ VY N E 
Sbjct: 190 DTVEQALADHNIPTEHAQITMVPDTTIALSPEDAQK-LENMIDAFDDLDDVQDVYHNGEF 248

Query: 240 ADDI 243
            DD+
Sbjct: 249 PDDM 252


>gi|145588803|ref|YP_001155400.1| hypothetical protein Pnuc_0618 [Polynucleobacter necessarius subsp.
           asymbioticus QLW-P1DMWA-1]
 gi|189040566|sp|A4SWH2|Y618_POLSQ RecName: Full=UPF0082 protein Pnuc_0618
 gi|145047209|gb|ABP33836.1| protein of unknown function DUF28 [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 239

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 149/241 (61%), Gaps = 10/241 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + KI++KL +EITV+AK+ G +   NPRLRLAI  AK+ +
Sbjct: 1   MAGHSKWANIQHRKGRQDEKRGKIWTKLIKEITVAAKMGGGDLTANPRLRLAIDKAKDAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +N++RAI++  GS +  NY  IRYEGYG  G AII++ LTDNR RT + +R  F K 
Sbjct: 61  MPNDNVQRAIQRGTGSLEGVNYEEIRYEGYGMNGAAIIVDCLTDNRTRTVAEVRHAFNKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G++G+ GS    F+  G++++     +  L MEVA+++ A +V+  D   +       D
Sbjct: 121 GGNMGTEGSVAFLFKHCGQMLFAPGTSEDQL-MEVALDAGAEDVITHDDGSLEVLTPVPD 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F+ V      + +   +A+   V  +P   I L   D+ +S+ K+++ LE+ DDVQ V++
Sbjct: 180 FSKV---QDAISQAGLKAELATVAMRPETEIALE-GDQAESMQKLLDALENLDDVQEVFT 235

Query: 236 N 236
           N
Sbjct: 236 N 236


>gi|322832433|ref|YP_004212460.1| hypothetical protein Rahaq_1715 [Rahnella sp. Y9602]
 gi|321167634|gb|ADW73333.1| protein of unknown function DUF28 [Rahnella sp. Y9602]
          Length = 247

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 147/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +A+L G +   NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAARLGGGDAGSNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G AI++E L+DNRNRT + +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDTNMETIIYEGYGPGGSAIMVECLSDNRNRTVAEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + D ++ ME A+E+ A +++ ++D     +  + N
Sbjct: 121 GGNLGTDGSVAYLFSKKGVITFAPGL-DEDVLMEAALEAGAEDIISYDDGAIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A S +V   P     + +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGEVKDALEAAGYKADSAEVTMIPSTKADM-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D+I
Sbjct: 239 ISDEI 243


>gi|308049719|ref|YP_003913285.1| hypothetical protein Fbal_2008 [Ferrimonas balearica DSM 9799]
 gi|307631909|gb|ADN76211.1| protein of unknown function DUF28 [Ferrimonas balearica DSM 9799]
          Length = 248

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 143/246 (58%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+TVSA+  G +   NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIRELTVSAREGGSDADANPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ IERA+K+ AG  +      I YEGYGP G A+++E +TDNRNRT S +RS F+K+
Sbjct: 61  MTRDTIERAVKRGAGELEGQELETIIYEGYGPGGTAVMVETMTDNRNRTVSGVRSAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F + G I Y     D    M+ A+E+ A +V   D   I  Y     
Sbjct: 121 GGNLGTDGSVAYLFTKQGVISYEPGT-DEEAVMDAALEAGAEDVETSDDGAIDVYTTPEA 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     A + +V   P     L + D  +  +++I+ LED DDVQ VY N +
Sbjct: 180 FGFVKDALDAAGLTAVNAEVTMVPSTKAEL-DLDTAQKFLRLIDVLEDHDDVQEVYHNAD 238

Query: 239 IADDII 244
           I+D+++
Sbjct: 239 ISDEVM 244


>gi|153000826|ref|YP_001366507.1| hypothetical protein Shew185_2306 [Shewanella baltica OS185]
 gi|151365444|gb|ABS08444.1| protein of unknown function DUF28 [Shewanella baltica OS185]
          Length = 248

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 150/248 (60%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRVAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G + Y     D +  ME A+E+ A +++ ++D     + D  +
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGT-DEDALMEAALEAGAEDIVSYDDGAIDVFTDPVD 179

Query: 179 VGLTSKKLEEK--IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  L++   + +   I +I      + L  A+K    +++I+ LED DDVQ VY N
Sbjct: 180 FYTVKDALDKAHFVADNAEIAMIASTKAELDLDTAEK---FMRLIDTLEDHDDVQEVYHN 236

Query: 237 LEIADDII 244
            EI+DD++
Sbjct: 237 AEISDDVM 244


>gi|295092959|emb|CBK82050.1| conserved hypothetical protein TIGR01033 [Coprococcus sp. ART55/1]
          Length = 249

 Score =  174 bits (442), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 148/242 (61%), Gaps = 9/242 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + +EI V+ K  G NP  N +LR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTIIGKEIVVAVKEGGANPENNSKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+R I++A  D +  NY    YEGYGP G AII++ LTDN+NRTA+++R+ FTK 
Sbjct: 61  MPNDTIKRGIERAAGDANSVNYVVNTYEGYGPNGTAIIVDTLTDNKNRTAANVRNCFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYC--- 174
            G++G+TG  +  F+  G+II        D++  M +A+++ A +   ED  Y       
Sbjct: 121 GGNVGTTGCVSYMFDHKGQIIIAKEDCDIDADDLMMMALDAGAEDFSDEDDSYEIITAPE 180

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
           DF+ V  + +K   K+ EA+   +   P NY+ + + + VK   ++I+ LE+DDDVQ+VY
Sbjct: 181 DFSQVRESLEKEGIKMAEAELTMI---PQNYVDIDDPEVVKKFTRIIDMLEEDDDVQAVY 237

Query: 235 SN 236
            N
Sbjct: 238 HN 239


>gi|257066699|ref|YP_003152955.1| hypothetical protein Apre_1210 [Anaerococcus prevotii DSM 20548]
 gi|256798579|gb|ACV29234.1| protein of unknown function DUF28 [Anaerococcus prevotii DSM 20548]
          Length = 243

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 100/239 (41%), Positives = 146/239 (61%), Gaps = 2/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I ++K  +DA K KIF+K +R ITV+AK  G NP  NP L+ AI+ AK  +
Sbjct: 1   MSGHNKWSKIKNKKGSEDAKKGKIFTKHARNITVAAKEGGTNPDYNPALKTAIEKAKADN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAIKKA  DD   N+  + YEGYGP GVA+I++ LTDN+NRTA  +R  F K 
Sbjct: 61  MPNDNIDRAIKKAAGDDASDNFERVIYEGYGPGGVAVIVDCLTDNKNRTAPDVRHAFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    FE+ G+II      D +  M  A+E+   +V    + +    D N+ 
Sbjct: 121 GGNLGTDGSVMFMFERKGDIIVGKEGKDFDEFMMDALEAGCEDVKEMGEYFEAITDVNSF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
              + KL+E   + +S  + +   N I++   D V  + K+I+ LED+DDVQ VYSN +
Sbjct: 181 NDANDKLKELGYKIESADISYLANNMIKVE-EDHVDKLNKLIDTLEDNDDVQEVYSNWD 238


>gi|227499848|ref|ZP_03929941.1| conserved hypothetical protein [Anaerococcus tetradius ATCC 35098]
 gi|227217957|gb|EEI83230.1| conserved hypothetical protein [Anaerococcus tetradius ATCC 35098]
          Length = 243

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 101/239 (42%), Positives = 146/239 (61%), Gaps = 2/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++  I ++K  +DA K KIF+K +R ITV+AK  G NP  NP L+ AI+ AK  +
Sbjct: 1   MSGHNKWSKIKNKKGSEDAKKGKIFTKHARNITVAAKEGGTNPDYNPSLKTAIEKAKADN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NIERAIKKA  DD   N+  + YEGYGP GVA+I++ LTDN+NRTA  +R  F K 
Sbjct: 61  MPNDNIERAIKKAAGDDASDNFVRVIYEGYGPGGVAVIVDCLTDNKNRTAPDVRHAFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS    FE+ G+II   N  D +  M  A+E+   +V    + +    D  + 
Sbjct: 121 GGNLGTDGSVMFMFERKGDIIVEKNGKDFDDFMMDALEAGCEDVKEMGEYFEAITDVASF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
              + KL+E   + +S  + +   N I +S    VK + K+I+ LED+DDVQ VY+N +
Sbjct: 181 NDANDKLKEAGYKIESADISYLANNMISVSEEHVVK-LNKLIDTLEDNDDVQEVYTNWD 238


>gi|296112955|ref|YP_003626893.1| hypothetical protein MCR_0733 [Moraxella catarrhalis RH4]
 gi|295920649|gb|ADG61000.1| conserved hypothetical protein [Moraxella catarrhalis RH4]
 gi|326561180|gb|EGE11545.1| hypothetical protein E9G_05039 [Moraxella catarrhalis 7169]
 gi|326561619|gb|EGE11957.1| hypothetical protein E9M_05798 [Moraxella catarrhalis 46P47B1]
 gi|326563982|gb|EGE14231.1| hypothetical protein E9K_05054 [Moraxella catarrhalis 103P14B1]
 gi|326567632|gb|EGE17740.1| hypothetical protein E9O_00390 [Moraxella catarrhalis 12P80B1]
 gi|326567932|gb|EGE18029.1| hypothetical protein E9Q_04394 [Moraxella catarrhalis BC1]
 gi|326569487|gb|EGE19547.1| hypothetical protein E9U_07636 [Moraxella catarrhalis BC8]
 gi|326572749|gb|EGE22735.1| hypothetical protein E9S_00330 [Moraxella catarrhalis BC7]
 gi|326574031|gb|EGE23980.1| hypothetical protein E9W_05929 [Moraxella catarrhalis CO72]
 gi|326577002|gb|EGE26897.1| hypothetical protein E9Y_00651 [Moraxella catarrhalis 101P30B1]
 gi|326577472|gb|EGE27356.1| hypothetical protein EA1_03605 [Moraxella catarrhalis O35E]
          Length = 249

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 145/245 (59%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK ++DA K KIF+K+ REI  +AK    +P  NPRLR  ++ A   +
Sbjct: 1   MAGHSKWANIKHRKAKQDAAKGKIFTKIIREIVSAAKSGDPDPANNPRLRAVLEKANAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ I+RAI++ AG  D  N   I YEGYG  GVA+I+E +TDN NRT   +R  F+K 
Sbjct: 61  MTKDVIKRAIERGAGGGDNDNMEEITYEGYGIGGVAVIVETMTDNVNRTVGEVRHAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG++GS    F + GEII+H ++   +  ME+A+E+ A ++  + +  +      + 
Sbjct: 121 GGNLGTSGSVAYLFSKRGEIIFH-DLSLEDSIMEIALEAGAEDIENDGESLLVITSPADF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L        S++V   P     + N D  + ++KMI+ LED DDVQ VY+N+  
Sbjct: 180 GTVVDALIAAGLTPNSMEVTMSPSTTADIDNIDDAQKVLKMIDMLEDLDDVQEVYTNVNF 239

Query: 240 ADDII 244
           ++ ++
Sbjct: 240 SEAVM 244


>gi|148284133|ref|YP_001248223.1| hypothetical protein OTBS_0251 [Orientia tsutsugamushi str.
           Boryong]
 gi|166228393|sp|A5CCC2|Y251_ORITB RecName: Full=UPF0082 protein OTBS_0251
 gi|146739572|emb|CAM79317.1| conserved hypothetical protein [Orientia tsutsugamushi str.
           Boryong]
          Length = 249

 Score =  174 bits (442), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 152/244 (62%), Gaps = 2/244 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+FKNI HRK  +D  K+K+F+ L REI++SAK SG +   N RLR AI  AK  +
Sbjct: 1   MAGHSKFKNIQHRKGAQDKKKAKLFASLIREISLSAK-SGTDIQYNHRLRAAISAAKFNN 59

Query: 61  MPKENIERAIKKAGS-DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE+AI +A + D+  NY  I YEG   +G+AII+EALTDN NRTA+++R+IF+K 
Sbjct: 60  LPKDRIEKAIAQANNKDNYENYFEITYEGIIFDGIAIIVEALTDNTNRTAANVRAIFSKY 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+L  TG+ +  F+++G I + S    S    + AIE  A ++  +++  + Y      
Sbjct: 120 GGNLVGTGNASFLFDRLGIIKFESKASTSEKLFDAAIEIGAEDIELDEEYNVVYTPIKLF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               ++L +  G      + W+P N + +S+ +K + +IK++  L+DDDDVQ  + N E 
Sbjct: 180 TNIIEELAQLFGYPVESYIGWRPRNTVLISDTEKAQKLIKLVNALDDDDDVQRFFGNYEF 239

Query: 240 ADDI 243
           ++ I
Sbjct: 240 SEQI 243


>gi|281358767|ref|ZP_06245243.1| protein of unknown function DUF28 [Victivallis vadensis ATCC
           BAA-548]
 gi|281314794|gb|EFA98831.1| protein of unknown function DUF28 [Victivallis vadensis ATCC
           BAA-548]
          Length = 251

 Score =  174 bits (441), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 147/245 (60%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE  D +K K FS++++EI V+AK+ G +P  NPRLR A+ +AK  +
Sbjct: 1   MSGHSKWANIKHKKEAADKVKGKAFSRIAKEIMVAAKMGGSDPNANPRLRAALTSAKAVN 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP  NIERAIKK G+ +LG+  Y  I YEGY   GVA+++E LTDN+NR+ S +R  F +
Sbjct: 61  MPNANIERAIKK-GAGELGDVVYEEITYEGYAAGGVAVMVECLTDNKNRSISDVRMTFDR 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            NG+L ++G+  R F+++       +  D    M+V +E+ A ++  ED     + +   
Sbjct: 120 NNGNLAASGAVARMFKRMAHFTITGDWADEEKLMDVVLEAGADDLTVEDGVAEVWAEPEF 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               +K  EEK    +  +V  +      L++    + +++++E +E+ DDVQ V +N E
Sbjct: 180 FEPLAKVFEEKGIPTEEAEVTRRAEMVTTLTDPGIARQVLRLVERMEELDDVQQVTANYE 239

Query: 239 IADDI 243
           I D I
Sbjct: 240 IDDSI 244


>gi|90961399|ref|YP_535315.1| hypothetical protein LSL_0422 [Lactobacillus salivarius UCC118]
 gi|119391998|sp|Q1WUV3|Y422_LACS1 RecName: Full=UPF0082 protein LSL_0422
 gi|90820593|gb|ABD99232.1| Conserved hypothetical protein [Lactobacillus salivarius UCC118]
          Length = 242

 Score =  174 bits (441), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 150/244 (61%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF K+SREI + AK  G +P  NP+LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKISREIYMVAKSGGPDPDGNPQLRLIMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK+NI+RAI KA      +Y  I YEGYGP GVAI++ ALTDNRNRTAS++R+ F +  
Sbjct: 61  MPKDNIKRAIDKATGTGGADYEEITYEGYGPAGVAILVHALTDNRNRTASAVRADFNRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEI-IYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           G+LG TGS +  F++ G I I   ++  D +   E  IE+   ++   D+ +  Y D   
Sbjct: 121 GNLGETGSVSFMFDRKGYIAIAREDLEVDEDQMFEDVIEAGGEDLQTSDEVFEIYTDPKA 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 +L++K   A + ++   P N + +  ADKV+ + ++I+ LED+DDV  VY++ +
Sbjct: 181 FADVRDELQKKYDLA-TAELTMVPQNTVPVP-ADKVEQLQRLIDRLEDEDDVSEVYTSAD 238

Query: 239 IADD 242
             +D
Sbjct: 239 FPED 242


>gi|256832603|ref|YP_003161330.1| hypothetical protein Jden_1371 [Jonesia denitrificans DSM 20603]
 gi|256686134|gb|ACV09027.1| protein of unknown function DUF28 [Jonesia denitrificans DSM 20603]
          Length = 252

 Score =  174 bits (441), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 140/245 (57%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++    H+K   DA + K+F++L + I V+A+  G +P  NP L  AIQ AK  S
Sbjct: 1   MAGHSKWATTKHKKAAIDAKRGKLFARLIKNIEVAARTGGGDPQGNPTLFDAIQTAKKNS 60

Query: 61  MPKENIERAIKKAGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P +NI+RA+K+     +   +Y  I YEGY P GVAI++E LTDN+NR+A+ +R  FT+
Sbjct: 61  VPGDNIDRAVKRGAGLIEGGADYQTIMYEGYAPGGVAILVECLTDNKNRSAADVRVAFTR 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G L   GS    F + G ++  +N  + +  M   +++ A EV  E   +   C+  +
Sbjct: 121 GGGQLADPGSVAYMFSRKGLVVIPANNHNEDDIMMAVLDAGAEEVNQEGDTFEVLCEATD 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +      LE    E  S + IW P   I L +AD  + + K+I+ LED DDVQ+VY+N +
Sbjct: 181 LRAVRDALESADIEYDSAESIWHPATRIEL-DADGARKVFKLIDALEDSDDVQNVYANYD 239

Query: 239 IADDI 243
           I  D+
Sbjct: 240 ITPDV 244


>gi|292488540|ref|YP_003531424.1| hypothetical protein EAMY_2066 [Erwinia amylovora CFBP1430]
 gi|292899716|ref|YP_003539085.1| hypothetical protein EAM_2006 [Erwinia amylovora ATCC 49946]
 gi|291199564|emb|CBJ46681.1| conserved hypothetical protein [Erwinia amylovora ATCC 49946]
 gi|291553971|emb|CBA21016.1| UPF0082 protein ECA2494 [Erwinia amylovora CFBP1430]
 gi|312172683|emb|CBX80939.1| UPF0082 protein ECA2494 [Erwinia amylovora ATCC BAA-2158]
          Length = 247

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +   NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDAGSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + +  + M+ A+E+ A +V+ ++D     +  + N
Sbjct: 121 GGNLGTDGSVAYLFTKKGVISYAPGLNEDTV-MDAALEAGADDVVTYDDGAIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+    +A+S +V   P     + + +    ++++I+ LED DDVQ VY N +
Sbjct: 180 MGAVKDVLDAAGLQAESAEVTMIPATKADM-DVETAPKLLRLIDMLEDCDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|253997453|ref|YP_003049517.1| hypothetical protein Mmol_2088 [Methylotenera mobilis JLW8]
 gi|253984132|gb|ACT48990.1| protein of unknown function DUF28 [Methylotenera mobilis JLW8]
          Length = 241

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 146/246 (59%), Gaps = 14/246 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + KIF+K+ +EITVSA+L G +P  NPRLR A+  AK ++
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKIFTKIIKEITVSARLGGGDPNMNPRLRAAVALAKEEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI RAIKK   +  G +Y  IRYEGYG  G AIII+ LTDN+ R    +R   +K 
Sbjct: 61  MPSDNITRAIKKGTGELEGVSYEEIRYEGYGINGAAIIIDCLTDNKQRAVMDVRHALSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFY----CD 175
            G+LG+ GS    F+  G ++Y     +  + MEVA+E+ A +V+  D   I       D
Sbjct: 121 GGNLGTDGSVAFMFKHCGSLVYEPGTSEDKV-MEVALEAGAEDVVTNDDGSIEVITPPAD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F  V   L +  L+  +GE     V  KP   +  +  D +K + K+++ LED DDVQ V
Sbjct: 180 FIAVKEALEAAGLKAVMGE-----VTMKPDAEVVFTGDDAIK-MQKILDALEDLDDVQDV 233

Query: 234 YSNLEI 239
           Y++  I
Sbjct: 234 YTSAVI 239


>gi|300312851|ref|YP_003776943.1| hypothetical protein Hsero_3556 [Herbaspirillum seropedicae SmR1]
 gi|124483624|emb|CAM32685.1| Conserved Hypothetical [Herbaspirillum seropedicae]
 gi|300075636|gb|ADJ65035.1| conserved hypothetical protein [Herbaspirillum seropedicae SmR1]
          Length = 241

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 148/241 (61%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + +++++L +EITV+A++ G +P  NPRLRLA+  A + +
Sbjct: 1   MAGHSKWANIQHRKGRQDEKRGRVWTRLIKEITVAARMGGGDPDTNPRLRLAVDRASDAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ RAI++  G+ D  NY  +RYEGYG  G AII++ +TDNR RT + +R  F+K 
Sbjct: 61  MPKDNVTRAIQRGTGALDGVNYEEVRYEGYGINGAAIIVDCMTDNRVRTVAEVRHAFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ GS    F+  G+++Y     D N  ME A+E+ A +V+ +++  I      N+
Sbjct: 121 GGNMGTEGSVAFLFKHCGQLMYAPGT-DENAVMEAALEAGAEDVITDEEGGIEVLTAPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  +E    +A+  ++  KP      +  D V+ + K+++ LE+ DD Q +Y+N  
Sbjct: 180 FSAVKAAMEAAGFKAEVAEITMKPSTETVFAGEDGVR-MQKLLDALENLDDTQELYTNAV 238

Query: 239 I 239
           I
Sbjct: 239 I 239


>gi|269792535|ref|YP_003317439.1| hypothetical protein Taci_0925 [Thermanaerovibrio acidaminovorans
           DSM 6589]
 gi|269100170|gb|ACZ19157.1| protein of unknown function DUF28 [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 250

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 151/245 (61%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA K  ++ +L+R I  +AK  G +P  N RL++AI+ A+  +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKKGAVYQRLTRAIIAAAKAGGGDPNANFRLKVAIERARAGN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P +NIERAIK+   +  G  Y  + YEGYGP GVAI++E +TDNRNRTA+ IRSIF+K 
Sbjct: 61  VPMDNIERAIKRGTGEIEGAIYEEVTYEGYGPAGVAILVETMTDNRNRTAAEIRSIFSKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GS+G  G     F++ G I   +   D    ++VA E+ A ++  E + +  YC+ + +
Sbjct: 121 GGSIGEAGCVAWNFDRKGVIKVEAAGVDEASLLDVAAEAGAEDMQLEGEVFEVYCEPSLM 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + + E      ++++   P N + +S+  +   I+ +I+  ED DDVQ+VYSN+EI
Sbjct: 181 SQVGQAIREAGYVVSNMELAMIPKNTVVVSDKQEASKILALIDKFEDHDDVQNVYSNVEI 240

Query: 240 ADDII 244
            D+++
Sbjct: 241 PDEVL 245


>gi|288574888|ref|ZP_06393245.1| protein of unknown function DUF28 [Dethiosulfovibrio peptidovorans
           DSM 11002]
 gi|288570629|gb|EFC92186.1| protein of unknown function DUF28 [Dethiosulfovibrio peptidovorans
           DSM 11002]
          Length = 248

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 148/251 (58%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK  +DA +  +F KL + I ++AK  G +P  N RL+ A+  AK  S
Sbjct: 1   MSGHSKWANIKHRKAAQDAKRGNLFQKLIKAIIIAAKEGGGDPATNIRLKAALDRAKAAS 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P  NIERAIK+  G  +   Y  + YEGYGPEGVA+I+E LTDN+NRT   IR IF + 
Sbjct: 61  VPSNNIERAIKRGTGEIEGATYEELAYEGYGPEGVAVIVECLTDNKNRTTPEIRMIFDRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNL---AMEVAIESDAFEVLFEDQEYIFYCDF 176
            GSLG+TG     FE+ G I    NIG  +L    +  A      E +  D  ++ Y D 
Sbjct: 121 GGSLGATGCVAWMFERRGVI----NIGGDDLNEEELMEAALEAGAEDVENDGGFVVYTDP 176

Query: 177 NNVGLTSKKLEEK---IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           + V    + LE K   I EA+S  V   P   ++++N DK + I+K+++ LE  DDVQ+V
Sbjct: 177 SVVDEVKEGLESKGFAIDEAESQLV---PKTTVKIANPDKARKILKLMDLLEGHDDVQNV 233

Query: 234 YSNLEIADDII 244
            SN +I ++I+
Sbjct: 234 SSNFDIPEEIM 244


>gi|50085180|ref|YP_046690.1| hypothetical protein ACIAD2052 [Acinetobacter sp. ADP1]
 gi|60390898|sp|Q6FAP5|Y2052_ACIAD RecName: Full=UPF0082 protein ACIAD2052
 gi|49531156|emb|CAG68868.1| conserved hypothetical protein [Acinetobacter sp. ADP1]
          Length = 249

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 89/245 (36%), Positives = 152/245 (62%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK ++DA ++K+F+K  REI  +AKL G +   NPRLR  ++ A + +
Sbjct: 1   MAGHSKWANTKHRKAKQDASRAKVFTKYIREIVTAAKLGGADAASNPRLRAVVEKALSVN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG +D  +   + YEGYG  GVA+++E +TDN NRT   +R  F+K 
Sbjct: 61  MTRDAINRAIQRGAGGEDNDDLNEVTYEGYGVGGVAVLVETMTDNLNRTVPDVRHCFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG+ GS +  F + GEI +  ++   +  M+VA+E+ A ++  E+   +      + 
Sbjct: 121 NGNLGTNGSVSYLFTKRGEISFE-DVSLEDKIMDVALEAGADDIEIEEDGILVITSPESF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
           G     L     ++ + +V+  P     +++ ++ K I+KMI+ LED DDVQ+VY+N+E 
Sbjct: 180 GDVQDALTAAGLKSDNAEVVMSPSTKAEITDIEQAKQIMKMIDMLEDLDDVQNVYTNVEF 239

Query: 240 ADDII 244
           +++++
Sbjct: 240 SEEVL 244


>gi|54294185|ref|YP_126600.1| hypothetical protein lpl1249 [Legionella pneumophila str. Lens]
 gi|67462029|sp|Q5WX49|Y1249_LEGPL RecName: Full=UPF0082 protein lpl1249
 gi|53754017|emb|CAH15488.1| hypothetical protein lpl1249 [Legionella pneumophila str. Lens]
          Length = 247

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 149/245 (60%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK  +DA + KIF+KL REITV+A++ G +   NPRLR A++ A N +
Sbjct: 1   MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+ A+K+  G  D      +RYEGYGP GVAI+++ L+DN+NRT S +R  F+K 
Sbjct: 61  MKRDTIDNAVKRGVGGADGEAMIAMRYEGYGPGGVAILVDCLSDNKNRTVSEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F   GEI+  SN  +  + ME+AI++ A +V  ED +          
Sbjct: 121 GGNLGTDGSVSYLFTNQGEILMASNQPEDKV-MEIAIDAGASDVAVEDSQIEIITPVEAY 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L++   E +   +  +    + +S+ +  +S+IK+I+ LED DDVQ VYSN E 
Sbjct: 180 HTVLNALQDAALEVEQSHLTMRAQTLVPISD-ETAESLIKLIDMLEDLDDVQEVYSNAEF 238

Query: 240 ADDII 244
           ++ I+
Sbjct: 239 SEKIL 243


>gi|167623849|ref|YP_001674143.1| hypothetical protein Shal_1919 [Shewanella halifaxensis HAW-EB4]
 gi|167353871|gb|ABZ76484.1| protein of unknown function DUF28 [Shewanella halifaxensis HAW-EB4]
          Length = 247

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 149/246 (60%), Gaps = 5/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR AI  + + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKVFTKFIRELTVAAREGGSDPDSNPRLRAAIDKSLSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  D      I YEGYGP G A+++E +TDN+NRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELDGQVLETIIYEGYGPGGTAVLVETMTDNKNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F++ G II +  I D +  M+ A+E+ A +V+  ED          +
Sbjct: 121 GGNLGTDGSVAYLFDKKG-IISYEGI-DEDTVMDAALEAGAEDVVTHEDGSIDVLTSPED 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    E+ + +V   P     L +A      +++I+NLED DDVQ VY N E
Sbjct: 179 FGSVKDALDAAGLESINAEVTMVPSTKADL-DASTAPKFLRLIDNLEDHDDVQEVYHNAE 237

Query: 239 IADDII 244
           I+D+++
Sbjct: 238 ISDEVM 243


>gi|285808233|gb|ADC35767.1| hypothetical protein [uncultured bacterium 293]
          Length = 250

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 146/242 (60%), Gaps = 2/242 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I H+K   DA + K+F+K+ RE+T++A++ G +P  NPRLR A+  AK  +
Sbjct: 1   MSGHSKWATIKHKKGALDAKRGKVFTKIIREMTIAARIGGGDPDSNPRLRTAVDKAKASN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+RAI+K   D  G NY +   EGYGP GVA+++E  TDNRNRT S IR IFTK 
Sbjct: 61  MPADNIKRAIQKGTGDLEGVNYEDFILEGYGPGGVAVLVEGTTDNRNRTVSEIRHIFTKQ 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
             +LG  GS +  F+  G +   S        ME+A+++ A ++    + +  Y   N +
Sbjct: 121 GSNLGGAGSVSYLFKPRGYLAVSSGKISEEKLMELALDAGADDIQSTGEVFEVYTPPNAL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               K ++    E +  +V   P N+I L    K + ++K++E LED DDVQ+V++N +I
Sbjct: 181 DPVLKAIKAAGVEPEESQVGKYPDNHIAL-EGQKAQQMLKLMEALEDHDDVQNVWANFDI 239

Query: 240 AD 241
           ++
Sbjct: 240 SE 241


>gi|288817493|ref|YP_003431840.1| hypothetical protein HTH_0172 [Hydrogenobacter thermophilus TK-6]
 gi|288786892|dbj|BAI68639.1| hypothetical protein HTH_0172 [Hydrogenobacter thermophilus TK-6]
 gi|308751100|gb|ADO44583.1| protein of unknown function DUF28 [Hydrogenobacter thermophilus
           TK-6]
          Length = 249

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 154/246 (62%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS +  I H+K + DA + K+FSK+ REITV+ +  G NP  N RLR AI+NA+  +
Sbjct: 1   MAGHSHWAQIKHKKAKVDAQRGKLFSKIIREITVAVREGGPNPETNSRLRTAIENARRVN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP E IERAIKK G+ +LG  +Y  + YEGYGP G AI++ A TDNRNRT + IR +F+K
Sbjct: 61  MPAETIERAIKK-GAGELGGESYEEVLYEGYGPGGAAIMVMATTDNRNRTTAEIRHVFSK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+LGS+G  +  FE++G +         ++  E AIE+ A ++   +  YI Y     
Sbjct: 120 HGGNLGSSGCVSYMFERVGYMEVPKEGLSEDVLYEKAIEAGAEDIETGETSYIIYTKPEM 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  L ++    ++  + +KPL+ +++++ +  K +IK+++ L++ DDVQ+V SN +
Sbjct: 180 FYTVKDSLLKENIPVENATITYKPLSTVQITDPETAKKLIKLLDALDELDDVQNVISNFD 239

Query: 239 IADDII 244
           I ++++
Sbjct: 240 IPEEVL 245


>gi|160875534|ref|YP_001554850.1| hypothetical protein Sbal195_2422 [Shewanella baltica OS195]
 gi|160861056|gb|ABX49590.1| protein of unknown function DUF28 [Shewanella baltica OS195]
 gi|315267722|gb|ADT94575.1| protein of unknown function DUF28 [Shewanella baltica OS678]
          Length = 248

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 96/248 (38%), Positives = 150/248 (60%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRVAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G + Y     +  L ME A+E+ A +++ ++D     + D  +
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGTEEDAL-MEAALEAGAEDIVSYDDGAMDVFTDPVD 179

Query: 179 VGLTSKKLEEK--IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  L++   + +   I +I      + L  A+K    +++I+ LED DDVQ VY N
Sbjct: 180 FYTVKDALDKAHFVADNAEIAMIASTKAELDLDTAEK---FMRLIDTLEDHDDVQEVYHN 236

Query: 237 LEIADDII 244
            EI+DD++
Sbjct: 237 AEISDDVM 244


>gi|158520388|ref|YP_001528258.1| hypothetical protein Dole_0371 [Desulfococcus oleovorans Hxd3]
 gi|226705841|sp|A8ZT17|Y371_DESOH RecName: Full=UPF0082 protein Dole_0371
 gi|158509214|gb|ABW66181.1| protein of unknown function DUF28 [Desulfococcus oleovorans Hxd3]
          Length = 246

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 149/245 (60%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ +I H+K   DA + K+F+KL +EIT++A+  G +P  NPRLR AI  AK+++
Sbjct: 1   MSGHNKWSSIKHKKGAADAKRGKVFTKLIKEITLAARTGGGDPDGNPRLRTAIAAAKDEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK   D  G NY    YEGYGP G A+++E+LTDN+NR  S IR IF+K 
Sbjct: 61  MPKDNIERAIKKGTGDLEGVNYEENTYEGYGPGGAAVLVESLTDNKNRAVSEIRHIFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG++G  G     F++ G I    +  + +  MEVAIE+ A +V   D  +    +  ++
Sbjct: 121 NGNMGENGCVAWMFDKKGYIEVEKSAAEEDHLMEVAIEAGAEDVRESDDTFEVITEVEDL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKV-KSIIKMIENLEDDDDVQSVYSNLE 238
               + L+    +    ++   P   + L   DK  + +I++++ L+D +DVQ VY+N  
Sbjct: 181 ETVRQALDGASIQYAFAEITMLPQTMVDLD--DKTSEQMIRLLDALDDCEDVQKVYTNAS 238

Query: 239 IADDI 243
           ++D +
Sbjct: 239 LSDSV 243


>gi|170078248|ref|YP_001734886.1| hypothetical protein SYNPCC7002_A1640 [Synechococcus sp. PCC 7002]
 gi|226736390|sp|B1XP37|Y1640_SYNP2 RecName: Full=UPF0082 protein SYNPCC7002_A1640
 gi|169885917|gb|ACA99630.1| conserved hypothetical protein (DUF28) [Synechococcus sp. PCC 7002]
          Length = 250

 Score =  174 bits (440), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 147/245 (60%), Gaps = 6/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA K K F++LSR I V+A+    +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAKKGKTFTQLSRAIIVAARHGLPDPAGNFQLRTAIEKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P ENIERAI K AG+  D   NY  IRYEGYG  GVAI+IEALTDNRNRTA+ +RS F+
Sbjct: 61  IPNENIERAIAKGAGTYNDGEANYEEIRYEGYGAGGVAILIEALTDNRNRTAADLRSAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAI--ESDAFEVLFEDQEYIFYCD 175
           K  G+LG TG  +  F   G +     I D    +E ++  E++ +  + +  E      
Sbjct: 121 KNGGNLGETGCVSWMFSHKGVVTLTGEI-DEEALLEASLIGEAEGYSAIEDSDEVEVLSA 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
             N+   ++ L++     +  ++ W P   + L++  ++++I+KMIE +E  DDVQ+V S
Sbjct: 180 VENLEHLNQTLQDAGFTVKEAELRWFPETEMNLTDEVQIQTILKMIETIEALDDVQTVTS 239

Query: 236 NLEIA 240
           NL IA
Sbjct: 240 NLAIA 244


>gi|254516711|ref|ZP_05128770.1| conserved hypothetical protein TIGR01033 [gamma proteobacterium
           NOR5-3]
 gi|219675134|gb|EED31501.1| conserved hypothetical protein TIGR01033 [gamma proteobacterium
           NOR5-3]
          Length = 248

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 95/251 (37%), Positives = 150/251 (59%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+KL RE+ V+AK  G  P +NPRLR A+  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKMFTKLIRELVVAAKQGGPLPEDNPRLRAAVDKALGSN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI + AG+++  +   + YEGY P GVA+++E +TDNRNRT + +R  F+K 
Sbjct: 61  MTRDTIDRAIARGAGNNEADDVEELTYEGYAPGGVAVLVEVMTDNRNRTVAEVRHAFSKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
            G+LG+ GS    FE+ G+I +     D    ME A+E+ A ++   D   I     + D
Sbjct: 121 GGNLGTDGSVAYLFERKGQISFAPG-ADEEQVMEAALEAGAEDIETADDGSIEVTTAWED 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F+ V   +    LE   GE   +     P+      +A   ++++ +I+ LE+ DDVQ+V
Sbjct: 180 FSGVKAAMEEAGLEPADGEVTMVASTTVPV------DASGAETVMGLIDALEELDDVQNV 233

Query: 234 YSNLEIADDII 244
           YSN++I D+++
Sbjct: 234 YSNVDIPDEVL 244


>gi|75907451|ref|YP_321747.1| hypothetical protein Ava_1228 [Anabaena variabilis ATCC 29413]
 gi|119391247|sp|Q3MDT4|Y1228_ANAVT RecName: Full=UPF0082 protein Ava_1228
 gi|75701176|gb|ABA20852.1| Protein of unknown function DUF28 [Anabaena variabilis ATCC 29413]
          Length = 252

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/249 (39%), Positives = 157/249 (63%), Gaps = 7/249 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K   DA K K F++LSR I ++A+    +P  N +LR AI  AK   
Sbjct: 1   MAGHSKWANIKRQKAVVDAKKGKTFTQLSRAIILAARSGIPDPSGNFQLRTAIDKAKAAG 60

Query: 61  MPKENIERAIKK-AGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           +P +NIERAI K AG+   D  +   IRYEGYGP GVAI+IEALTDNRNRTA+ +R  F+
Sbjct: 61  IPNDNIERAIAKGAGTFGGDNASLEEIRYEGYGPGGVAILIEALTDNRNRTAADLRVAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVLFEDQEYIFYCD 175
           K  G+LG TG  +  F+Q G +   S + D +  +E ++E  A  +E + ED+    + +
Sbjct: 121 KNGGNLGETGCVSWMFDQKG-VCVVSGVVDEDQLLEASLEGGAESYE-MTEDETAEVFTE 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
             N+ + ++ L+++  +    ++ W P N + ++  D+ +S++K+I+ LE  DDVQ+V S
Sbjct: 179 VANLEILNQTLKDQGFKVTDAELRWIPSNNVEVTEPDQARSLLKLIDTLEGLDDVQNVTS 238

Query: 236 NLEIADDII 244
           N E++++++
Sbjct: 239 NFEMSENLM 247


>gi|226329881|ref|ZP_03805399.1| hypothetical protein PROPEN_03794 [Proteus penneri ATCC 35198]
 gi|225200676|gb|EEG83030.1| hypothetical protein PROPEN_03794 [Proteus penneri ATCC 35198]
          Length = 251

 Score =  173 bits (439), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDENDNMETIIYEGYGPAGTAVMVECLSDNRNRTVSDVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y    +
Sbjct: 121 GGNLGTDGSVSYLFTKKGVISYAPGV-DEDAVMEAALEAGADDVETYDDGAIDVYTTPES 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     ++     A+S +V   P     L + +    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGEVKDAMDAAGFVAESAEVSMIPSTKAEL-DIETAPKLMRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|271500734|ref|YP_003333759.1| hypothetical protein Dd586_2200 [Dickeya dadantii Ech586]
 gi|270344289|gb|ACZ77054.1| protein of unknown function DUF28 [Dickeya dadantii Ech586]
          Length = 247

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 94/247 (38%), Positives = 147/247 (59%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPGSNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGGDEDANMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  M+ A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFSKKGVISYAPGL-DEDTVMDAALEAGADDVVSYDDGAIDVFTPWEI 179

Query: 179 VGLTSKKLEEK--IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            G     L+    + EA  + +I  P     + +A+    ++++I+ LED DDVQ VY N
Sbjct: 180 FGQVKDALDAAGLVSEAAEVSMI--PSTKADM-DAETAPKLMRLIDMLEDCDDVQEVYHN 236

Query: 237 LEIADDI 243
            EI+D++
Sbjct: 237 GEISDEV 243


>gi|119896865|ref|YP_932078.1| hypothetical protein azo0574 [Azoarcus sp. BH72]
 gi|166229070|sp|A1K2Y6|Y574_AZOSB RecName: Full=UPF0082 protein azo0574
 gi|119669278|emb|CAL93191.1| conserved hypothetical protein [Azoarcus sp. BH72]
          Length = 241

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 143/238 (60%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+F+KL +E+TV+AK+ G +P  NPRLRLAI  AK +S
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKVFTKLIKEVTVAAKMGGGDPNANPRLRLAIDKAKAES 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE AIK+      G  Y   RYEGYG  G A++++ LTDN+ RT + +R  F+K 
Sbjct: 61  MPKDNIENAIKRGTGQLEGVTYEEARYEGYGIAGAAVMVDCLTDNKTRTVADVRHAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G+ G     F+  G++++     D +  ME A+E+ A +V+  D   I        
Sbjct: 121 GGNMGTDGCVAFQFKHCGQLMFAPGT-DEDALMEAALEAGAEDVVANDDGSIEVITGPWE 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
             T K+  EK G  A+  +V  K  N   LS  D  + + K+++ LE  DDVQ VY++
Sbjct: 180 FTTVKETLEKAGFTAEFGEVTMKAQNETELSGDDAAR-MQKLLDALESLDDVQEVYTS 236


>gi|258545754|ref|ZP_05705988.1| YebC protein of hypothetical function DUF28 [Cardiobacterium
           hominis ATCC 15826]
 gi|258518999|gb|EEV87858.1| YebC protein of hypothetical function DUF28 [Cardiobacterium
           hominis ATCC 15826]
          Length = 244

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 153/254 (60%), Gaps = 23/254 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + K+F++L RE+T++A+  G +   NPRLRLAI  A+ ++
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKVFTRLIRELTIAARHGGSDASSNPRLRLAIAKAQAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ +ERAIK+ AG  +      IRYEGYGP GVA++++ LTDN+NRT   +R  FTKA
Sbjct: 61  MTKDTMERAIKRGAGELEGAQMEEIRYEGYGPGGVAVMVDCLTDNKNRTVGEVRHAFTKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA---------FEVLFEDQEY 170
            G+LG++GS    F + G +++   + + +  MEVA+++ A          EVL   ++Y
Sbjct: 121 GGNLGTSGSVAFQFTERG-VLFFEKVANEDAFMEVALDAGAADLEIDENGAEVLTAPEDY 179

Query: 171 -IFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDD 229
              Y      G T  + E        + +    L+ +   +ADKV   +++IE LE+ DD
Sbjct: 180 AAVYDALVAAGFTPDESE--------VTMRADNLSPVSADDADKV---MRLIERLEELDD 228

Query: 230 VQSVYSNLEIADDI 243
           VQSVY+N +  +D 
Sbjct: 229 VQSVYTNADFPEDF 242


>gi|56477509|ref|YP_159098.1| hypothetical protein ebA3674 [Aromatoleum aromaticum EbN1]
 gi|67462021|sp|Q5P3B7|Y2072_AZOSE RecName: Full=UPF0082 protein AZOSEA20720
 gi|56313552|emb|CAI08197.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 241

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 148/241 (61%), Gaps = 10/241 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+F+KL +EITV+A++ G +P  NPRLRLA+  AK ++
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKVFTKLIKEITVAARMGGGDPNFNPRLRLAVDKAKAEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI+RAIK+  G  D  +Y   RYEGYG  G A++++ LTDN+ RT + +R  F+K 
Sbjct: 61  MPSENIDRAIKRGTGELDGVSYEEARYEGYGIGGAAVMVDCLTDNKTRTVADVRHAFSKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G++G+ G     F+  G++++     +  L ME A+E+ A +V+  D   I       +
Sbjct: 121 GGNMGTDGCVAFQFKHCGQLMFAPGTSEDAL-MEAALEAGAEDVVTNDDGSIEVITAPYE 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           ++NV      LE+    A+  +V  KP N   LS  D  + + K+++ LE  DDVQ VY+
Sbjct: 180 YSNV---KDALEKASFRAEFGEVTMKPQNETELSGGD-AERMQKLLDALESLDDVQEVYT 235

Query: 236 N 236
           +
Sbjct: 236 S 236


>gi|54308306|ref|YP_129326.1| hypothetical protein PBPRA1113 [Photobacterium profundum SS9]
 gi|60390916|sp|Q6LT52|Y1113_PHOPR RecName: Full=UPF0082 protein PBPRA1113
 gi|46912734|emb|CAG19524.1| Conserved hypothetical protein [Photobacterium profundum SS9]
          Length = 247

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS+F NI HRK  +D+ + KIF+KL REI V+ K  G     NPRLR A+  A + +
Sbjct: 1   MAGHSKFANIKHRKAAQDSKRGKIFTKLIREIIVATKDGGPEAENNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RA+K+ AG D   +   + YEGYGP G A+++E +TDNRNRT S +R+ F+K+
Sbjct: 61  MTRDTINRAVKRGAGGDGEADLETVIYEGYGPAGTAVMVECMTDNRNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G I Y + + D ++ ME A+ES A ++   D   I  Y   ++
Sbjct: 121 GGNLGTDGSVNYLFDKKGVISYAAGL-DEDVMMEAALESGAEDIETNDDGSIDVYTTPSD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    ++ + +V   P     L + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 FGAVKDALDAAGFDSVNAEVTLVPSTKADL-DLETAPKLLRLIDALEDLDDVQEVYHNGE 238

Query: 239 IADDI 243
           I D+I
Sbjct: 239 ITDEI 243


>gi|15594371|ref|NP_212159.1| hypothetical protein BB0025 [Borrelia burgdorferi B31]
 gi|195941765|ref|ZP_03087147.1| hypothetical protein Bbur8_02649 [Borrelia burgdorferi 80a]
 gi|216264634|ref|ZP_03436626.1| conserved hypothetical protein [Borrelia burgdorferi 156a]
 gi|218249293|ref|YP_002374559.1| hypothetical protein BbuZS7_0025 [Borrelia burgdorferi ZS7]
 gi|221217353|ref|ZP_03588824.1| conserved hypothetical protein [Borrelia burgdorferi 72a]
 gi|223889065|ref|ZP_03623654.1| conserved hypothetical protein [Borrelia burgdorferi 64b]
 gi|224532564|ref|ZP_03673187.1| conserved hypothetical protein [Borrelia burgdorferi WI91-23]
 gi|224533883|ref|ZP_03674468.1| conserved hypothetical protein [Borrelia burgdorferi CA-11.2a]
 gi|225549230|ref|ZP_03770203.1| conserved hypothetical protein [Borrelia burgdorferi 94a]
 gi|225549679|ref|ZP_03770644.1| conserved hypothetical protein [Borrelia burgdorferi 118a]
 gi|226321145|ref|ZP_03796686.1| conserved hypothetical protein [Borrelia burgdorferi 29805]
 gi|226322060|ref|ZP_03797585.1| conserved hypothetical protein [Borrelia burgdorferi Bol26]
 gi|6226313|sp|O51056|Y025_BORBU RecName: Full=UPF0082 protein BB_0025
 gi|226734013|sp|B7J0W4|Y025_BORBZ RecName: Full=UPF0082 protein BbuZS7_0025
 gi|2687898|gb|AAC66408.1| conserved hypothetical protein [Borrelia burgdorferi B31]
 gi|215981107|gb|EEC21914.1| conserved hypothetical protein [Borrelia burgdorferi 156a]
 gi|218164481|gb|ACK74542.1| conserved hypothetical protein [Borrelia burgdorferi ZS7]
 gi|221192631|gb|EEE18847.1| conserved hypothetical protein [Borrelia burgdorferi 72a]
 gi|223885314|gb|EEF56415.1| conserved hypothetical protein [Borrelia burgdorferi 64b]
 gi|224512507|gb|EEF82885.1| conserved hypothetical protein [Borrelia burgdorferi WI91-23]
 gi|224512886|gb|EEF83252.1| conserved hypothetical protein [Borrelia burgdorferi CA-11.2a]
 gi|225369639|gb|EEG99087.1| conserved hypothetical protein [Borrelia burgdorferi 118a]
 gi|225370088|gb|EEG99528.1| conserved hypothetical protein [Borrelia burgdorferi 94a]
 gi|226232650|gb|EEH31404.1| conserved hypothetical protein [Borrelia burgdorferi Bol26]
 gi|226233437|gb|EEH32177.1| conserved hypothetical protein [Borrelia burgdorferi 29805]
 gi|312147885|gb|ADQ30544.1| conserved hypothetical protein [Borrelia burgdorferi JD1]
 gi|312149469|gb|ADQ29540.1| conserved hypothetical protein [Borrelia burgdorferi N40]
          Length = 243

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 151/248 (60%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REIT++AK+ G +   NPRLR+A+  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAVNKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I+ LTDN+NRT+S ++S+  K 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKSVLAKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G I+Y+      +  ME A+E  A ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGLIVYNLEKYLEDEIMEFALEVGAEDILVSNNEAEVITSPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V      K +E++ E   I     P N I L N D+ + II ++E LED DDVQ V  
Sbjct: 181 DKVLSFLKTKFKEEVAEIALI-----PENKISL-NKDQAEKIILLVEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|291522356|emb|CBK80649.1| conserved hypothetical protein TIGR01033 [Coprococcus catus GD/7]
          Length = 242

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 149/242 (61%), Gaps = 5/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + RE+ V+ K  G +P  N RLR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTIIGRELAVAVKEGGSDPNNNSRLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP + IER IKKA  D LG  NY N  YEGYGP GVAII+E LTDNRNRTA+++RS FTK
Sbjct: 61  MPNDTIERGIKKAAGD-LGSVNYENNTYEGYGPSGVAIIVETLTDNRNRTAANVRSAFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIG--DSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
             GS+G++G  +  F++ G+II        D++  M +A+++ A +   E+  Y    D 
Sbjct: 120 GGGSIGTSGCVSFMFDKKGQIIIDKEECDMDADDLMMIALDAGAEDFSDEEDSYEIITDP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
           ++       LE++       +V   P  +  L+N D +K + ++++ L++DDDVQ+VY N
Sbjct: 180 DDFSAVRDALEKEGIPMAEAEVTMVPQTWATLTNEDDIKKMNRILDLLDEDDDVQNVYHN 239

Query: 237 LE 238
            +
Sbjct: 240 WD 241


>gi|29654857|ref|NP_820549.1| hypothetical protein CBU_1566 [Coxiella burnetii RSA 493]
 gi|153208307|ref|ZP_01946686.1| conserved hypothetical protein TIGR01033 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154706307|ref|YP_001423842.1| hypothetical protein CBUD_0422 [Coxiella burnetii Dugway 5J108-111]
 gi|161830968|ref|YP_001597403.1| hypothetical protein COXBURSA331_A1752 [Coxiella burnetii RSA 331]
 gi|212212082|ref|YP_002303018.1| hypothetical protein CbuG_0446 [Coxiella burnetii CbuG_Q212]
 gi|212219278|ref|YP_002306065.1| hypothetical protein CbuK_1793 [Coxiella burnetii CbuK_Q154]
 gi|33516993|sp|Q83BE4|Y1566_COXBU RecName: Full=UPF0082 protein CBU_1566
 gi|189038999|sp|A9N9A0|Y1752_COXBR RecName: Full=UPF0082 protein COXBURSA331_A1752
 gi|189040287|sp|A9KF43|Y422_COXBN RecName: Full=UPF0082 protein CBUD_0422
 gi|226695969|sp|B6J503|Y1793_COXB1 RecName: Full=UPF0082 protein CbuK_1793
 gi|226706190|sp|B6IYU5|Y446_COXB2 RecName: Full=UPF0082 protein CbuG_0446
 gi|29542126|gb|AAO91063.1| hypothetical cytosolic protein [Coxiella burnetii RSA 493]
 gi|120576091|gb|EAX32715.1| conserved hypothetical protein TIGR01033 [Coxiella burnetii 'MSU
           Goat Q177']
 gi|154355593|gb|ABS77055.1| hypothetical cytosolic protein [Coxiella burnetii Dugway 5J108-111]
 gi|161762835|gb|ABX78477.1| conserved hypothetical protein TIGR01033 [Coxiella burnetii RSA
           331]
 gi|212010492|gb|ACJ17873.1| hypothetical cytosolic protein [Coxiella burnetii CbuG_Q212]
 gi|212013540|gb|ACJ20920.1| hypothetical cytosolic protein [Coxiella burnetii CbuK_Q154]
          Length = 244

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 146/249 (58%), Gaps = 10/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H K R+DA + K+F+KL REITV+A+L G++   NPRLR  +  A   +
Sbjct: 1   MAGHSKWANIKHAKARQDAKRGKVFTKLIREITVAARLGGEDIDSNPRLRAVVDKAFAAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ I RAIK+ AGS    N   +RYEGYGP GVA++++ LTDN+NRT + +R  F+K 
Sbjct: 61  MPKDTITRAIKRGAGSGAGDNLVEVRYEGYGPSGVAVMVDCLTDNKNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
           +G+LG+ GS    F+Q G I +  N  D    ME+A+E  A +V   D   I       D
Sbjct: 121 DGNLGTEGSVAYLFKQRGLITFPPN-SDEEKIMEIALEVGAEDVTTNDDGSIDVTTLPED 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  +    K  +     A+   +    +      + D  + ++++ E LED DDVQ+VYS
Sbjct: 180 FEKIRNAMKAADLNPSHAEVTVLASTEVGL----DKDSAEQMLRLTEMLEDLDDVQNVYS 235

Query: 236 NLEIADDII 244
           N +  ++++
Sbjct: 236 NADYPEEVL 244


>gi|219684761|ref|ZP_03539703.1| conserved hypothetical protein [Borrelia garinii PBr]
 gi|219685381|ref|ZP_03540200.1| conserved hypothetical protein [Borrelia garinii Far04]
 gi|219671706|gb|EED28761.1| conserved hypothetical protein [Borrelia garinii PBr]
 gi|219673154|gb|EED30174.1| conserved hypothetical protein [Borrelia garinii Far04]
          Length = 243

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 152/248 (61%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REIT++AK+ G +   NPRLR+A+  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDVESNPRLRVAVNKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I+ LTDN+NRT+S ++S+  K 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKSVLAKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G I+Y+      +  ME A+E+ A ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGIIVYNLEKYLEDEIMEFALEAGAEDILVSNNEAEVITNPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V      K +E++ E   I     P N I L N ++ + II +IE LED DDVQ V  
Sbjct: 181 DKVLSFLKTKFKEEMAEVALI-----PENKISL-NKEQAEKIILLIEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|303325469|ref|ZP_07355912.1| glucose-1-phosphate adenylyltransferase [Desulfovibrio sp.
           3_1_syn3]
 gi|302863385|gb|EFL86316.1| glucose-1-phosphate adenylyltransferase [Desulfovibrio sp.
           3_1_syn3]
          Length = 245

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 150/244 (61%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI HRK R+DA + KIF+K ++EI ++AK +G +P  N RLR AI  AK  +
Sbjct: 1   MSGHSKWANIQHRKGRQDAKRGKIFTKAAKEIIIAAK-NGGDPSGNSRLRAAIAAAKAVN 59

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AI+K  G D  G++    YEGYGP G+AI++E  TDN+NRT + +R +FTK 
Sbjct: 60  LPKDKIEAAIRKGTGEDAGGDFVEGFYEGYGPGGIAIMVEVATDNKNRTVAEVRHLFTKH 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GS+G  GS    FE+ G I         +  ME A+E+ A +VL ++  +       + 
Sbjct: 120 GGSMGENGSVGWMFERKGVISVDKAAYAEDKIMEAALEAGADDVLDDEDVWTLQTAMADF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE    E QS ++   P N + +S AD  + +++++E L+D+DDVQ+VY+N++ 
Sbjct: 180 AAVRDALEAAGIEMQSAELAMVPQNLVAVS-ADMGQKVLRLMEALDDNDDVQNVYANVDF 238

Query: 240 ADDI 243
            DD+
Sbjct: 239 PDDM 242


>gi|183598997|ref|ZP_02960490.1| hypothetical protein PROSTU_02442 [Providencia stuartii ATCC 25827]
 gi|188021213|gb|EDU59253.1| hypothetical protein PROSTU_02442 [Providencia stuartii ATCC 25827]
          Length = 247

 Score =  173 bits (439), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 144/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +A+L G +P  NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAARLGGGDPATNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G+D+  N   I YEGYGP G A+++E L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGVGNDENDNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y   + D +  ME A+E+ A +V  ++D     Y     
Sbjct: 121 GGNLGTDGSVSYLFTKRGVITYAPGV-DEDALMEAALEAGAEDVETYDDGAIDVYTTPET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+     +++ +V   P     L + +    ++++I+ LED DDVQ VY N +
Sbjct: 180 FGEVKDALDAAGFTSEAAEVSMIPSTKAEL-DVETAPKLLRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|296129639|ref|YP_003636889.1| protein of unknown function DUF28 [Cellulomonas flavigena DSM
           20109]
 gi|296021454|gb|ADG74690.1| protein of unknown function DUF28 [Cellulomonas flavigena DSM
           20109]
          Length = 251

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/246 (36%), Positives = 144/246 (58%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++    H+K   DA + K+F+KL + I V+A+  G +P  NP L  AIQ AK  S
Sbjct: 1   MSGHSKWATTKHKKAVIDAKRGKLFAKLIKNIEVAARTGGGDPAGNPTLFDAIQKAKKSS 60

Query: 61  MPKENIERAIKKAGSDDLG--NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P +NI+RA+K+    + G  +Y  I YEGYGP GVA+++E LTDNRNR AS +R  FT+
Sbjct: 61  VPNDNIDRAVKRGSGQEAGGADYQTIMYEGYGPGGVAVLVECLTDNRNRAASDVRVAFTR 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G +   GS +  F + G +I      D +  ME  +E+   EV    +++    +  +
Sbjct: 121 NGGQMADPGSVSYIFSRKGVVIVPKEGTDEDAVMEAVLEAGGEEVTDLGEQFEVLSEATD 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +      L+E   E  S  V++ P   I + +A+  + I+++I+ LED DDVQ+VY+N +
Sbjct: 181 LVPVRTALQEAGIEYDSADVVFWPATQIEV-DAEGARKILRLIDALEDSDDVQNVYANFD 239

Query: 239 IADDII 244
            +D+++
Sbjct: 240 ASDEVM 245


>gi|254284016|ref|ZP_04958984.1| conserved hypothetical protein TIGR01033 [gamma proteobacterium
           NOR51-B]
 gi|219680219|gb|EED36568.1| conserved hypothetical protein TIGR01033 [gamma proteobacterium
           NOR51-B]
          Length = 247

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 149/246 (60%), Gaps = 4/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+KL RE+ VSAK  G    +NPRLR A+  A   +
Sbjct: 1   MAGHSKWANIKHRKSAQDAKRGKLFTKLIRELVVSAKQGGPLVEDNPRLRAAVDKALGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+RAI + AG+ D  N   + YEGY   GVA++IEA+TDNRNRT + +R  F+K 
Sbjct: 61  MTRDTIDRAIDRGAGNTDSENMEELTYEGYAAGGVAVLIEAMTDNRNRTVAEVRHAFSKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV-LFEDQEYIFYCDFNN 178
            G+LG+ GS    FE+ G I +   + +  L MEVA+E+ A ++   +D  +     + +
Sbjct: 121 GGNLGTDGSVAYLFERKGSISFAPGVDEEQL-MEVALEAGAEDIEGHDDGSFDVTTPWED 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           VG     L E   E  + +V   P   + + +    +++I +++ LED DDVQ+VY+N +
Sbjct: 180 VGAVKAALVESGLEPANAEVTMIPSTTVPV-DVSGAETVIGLVDMLEDLDDVQNVYTNAD 238

Query: 239 IADDII 244
           I D+++
Sbjct: 239 IPDEVL 244


>gi|121594258|ref|YP_986154.1| hypothetical protein Ajs_1898 [Acidovorax sp. JS42]
 gi|222110896|ref|YP_002553160.1| hypothetical protein Dtpsy_1703 [Acidovorax ebreus TPSY]
 gi|166227483|sp|A1W753|Y1898_ACISJ RecName: Full=UPF0082 protein Ajs_1898
 gi|120606338|gb|ABM42078.1| protein of unknown function DUF28 [Acidovorax sp. JS42]
 gi|221730340|gb|ACM33160.1| protein of unknown function DUF28 [Acidovorax ebreus TPSY]
          Length = 239

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 150/246 (60%), Gaps = 14/246 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + KI++++ REITV+A+  G +P  NPRLRLAI  AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDEKRGKIWTRIIREITVAARTGGGDPSANPRLRLAIDKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+  I KA G+ +  +Y  IRYEGYG  G AII++ +TDNR RT + +R  F+K 
Sbjct: 61  MPADRIKYNIDKASGTLEGVSYEEIRYEGYGIGGAAIIVDTMTDNRVRTVAEVRHAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G++G+ GS    F+ +G+II+     +  + MEVA+E+ A +V+ +D+  I       D
Sbjct: 121 GGNMGTEGSVAFQFKNVGQIIFAPGTSEDKV-MEVALEAGAEDVITDDEGAIEVLTAPGD 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F  V   L +  L+ ++ E     V  +P N I L   D V  + K+++ +ED DDVQ V
Sbjct: 180 FEAVRDALGAAGLQPEVAE-----VTMRPENTIALEG-DDVARMQKLLDMIEDLDDVQEV 233

Query: 234 YSNLEI 239
           Y N E+
Sbjct: 234 YHNAEL 239


>gi|257888643|ref|ZP_05668296.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257897402|ref|ZP_05677055.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257899962|ref|ZP_05679615.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|293378839|ref|ZP_06624994.1| DNA-binding regulatory protein, YebC/PmpR family [Enterococcus
           faecium PC4.1]
 gi|293571067|ref|ZP_06682108.1| conserved hypothetical protein [Enterococcus faecium E980]
 gi|257824697|gb|EEV51629.1| conserved hypothetical protein [Enterococcus faecium 1,141,733]
 gi|257833967|gb|EEV60388.1| conserved hypothetical protein [Enterococcus faecium Com12]
 gi|257837874|gb|EEV62948.1| conserved hypothetical protein [Enterococcus faecium Com15]
 gi|291608850|gb|EFF38131.1| conserved hypothetical protein [Enterococcus faecium E980]
 gi|292642380|gb|EFF60535.1| DNA-binding regulatory protein, YebC/PmpR family [Enterococcus
           faecium PC4.1]
          Length = 240

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 146/242 (60%), Gaps = 5/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  AK  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKAGGPDPSMNPALRLVVDKAKAAN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +N+ERAIKKA S  D  NY  I YEGYGP GV I++ ALTDNRNRTA+++R  FT+ 
Sbjct: 61  MPNDNVERAIKKATSAVDETNYDEITYEGYGPGGVGILVHALTDNRNRTATNVRVAFTRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            GSLG TGS +  F++ G I+   +    D     E  +E+ A ++    + +  Y    
Sbjct: 121 GGSLGETGSVSYLFDRKGYIVIERDGLAVDEETMFEDVLEAGAEDLQTSPEVFEIYTAPE 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +      +LE++   AQ+ ++   P   I L N ++ + + ++++ LEDDDDV  V++  
Sbjct: 181 DFAAVRDELEKEFTLAQA-ELTMIPQTTIDL-NEEQREQLERLVDKLEDDDDVSEVFTAA 238

Query: 238 EI 239
           E+
Sbjct: 239 EM 240


>gi|312622889|ref|YP_004024502.1| hypothetical protein Calkro_1837 [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203356|gb|ADQ46683.1| protein of unknown function DUF28 [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 243

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 100/240 (41%), Positives = 142/240 (59%), Gaps = 3/240 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+KE+ DA K K+F+KL RE+ V AK+ G +P  NP+LR  I  AK  +
Sbjct: 1   MAGHSKWANIKHKKEKTDAQKGKLFTKLGRELMVVAKMYGPDPETNPKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I   IK+A G  D   Y +I YEGYGP GVA+I+EA+T+NRNRTA  +R IF K 
Sbjct: 61  MPMDKIMGFIKRAAGEIDTTGYEDITYEGYGPGGVAVIVEAMTNNRNRTAGELRHIFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LG TG  +  F + G I+    +  D +  ME A+E  A +   ED  Y       +
Sbjct: 121 GGNLGQTGCVSWMFSRKGVIVIEKESFPDEDFVMEKALEYGAEDFSSEDDIYEIITSPED 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + LE++       ++   P  Y++LS+ D  K + ++I+ LED+DDV+ VY N E
Sbjct: 181 FSKVREGLEKEGFTFIRAQIEMIPQTYVKLSSEDAQK-MRRLIDMLEDNDDVKEVYHNWE 239


>gi|146295998|ref|YP_001179769.1| hypothetical protein Csac_0964 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|166227541|sp|A4XI43|Y964_CALS8 RecName: Full=UPF0082 protein Csac_0964
 gi|145409574|gb|ABP66578.1| protein of unknown function DUF28 [Caldicellulosiruptor
           saccharolyticus DSM 8903]
          Length = 242

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 140/240 (58%), Gaps = 3/240 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+KE+ DA K KIFSKL RE+ V AK+ G +P  NP+LR  I  AK  +
Sbjct: 1   MSGHSKWANIRHKKEKTDAQKGKIFSKLGRELMVVAKMYGPDPETNPKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I   IK+A G  D   Y +I YEGYGP GVA+I+EA+T+NRNRTA  IR IF K 
Sbjct: 61  MPMDKIMGFIKRAAGEIDTTGYEDITYEGYGPGGVAVIVEAMTNNRNRTAGEIRHIFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LG TG  +  F + G I+    N  D +  ME A+E  A +   E+  Y       +
Sbjct: 121 GGNLGQTGCVSWMFNRKGVIVIEKENFPDEDFVMEKALEYGAEDFASEEDVYEIITTPED 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + LE++       ++   P   +RLS  D  K + ++I+ LED+DDV+ VY N E
Sbjct: 181 FSKVREGLEKEGFTFIRAQIEMIPQTTVRLSEEDAQK-MRRLIDMLEDNDDVKEVYHNWE 239


>gi|227552674|ref|ZP_03982723.1| protein of hypothetical function DUF28 [Enterococcus faecium
           TX1330]
 gi|227178203|gb|EEI59175.1| protein of hypothetical function DUF28 [Enterococcus faecium
           TX1330]
          Length = 251

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 146/242 (60%), Gaps = 5/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  AK  +
Sbjct: 12  MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKAGGPDPSMNPALRLVVDKAKAAN 71

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +N+ERAIKKA S  D  NY  I YEGYGP GV I++ ALTDNRNRTA+++R  FT+ 
Sbjct: 72  MPNDNVERAIKKATSAVDETNYDEITYEGYGPGGVGILVHALTDNRNRTATNVRVAFTRN 131

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            GSLG TGS +  F++ G I+   +    D     E  +E+ A ++    + +  Y    
Sbjct: 132 GGSLGETGSVSYLFDRKGYIVIERDGLAVDEETMFEDVLEAGAEDLQTSPEVFEIYTAPE 191

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +      +LE++   AQ+ ++   P   I L N ++ + + ++++ LEDDDDV  V++  
Sbjct: 192 DFAAVRDELEKEFTLAQA-ELTMIPQTTIDL-NEEQREQLERLVDKLEDDDDVSEVFTAA 249

Query: 238 EI 239
           E+
Sbjct: 250 EM 251


>gi|148358828|ref|YP_001250035.1| hypothetical protein LPC_0711 [Legionella pneumophila str. Corby]
 gi|296106873|ref|YP_003618573.1| YebC [Legionella pneumophila 2300/99 Alcoy]
 gi|166228840|sp|A5IBD9|Y711_LEGPC RecName: Full=UPF0082 protein LPC_0711
 gi|148280601|gb|ABQ54689.1| YebC [Legionella pneumophila str. Corby]
 gi|295648774|gb|ADG24621.1| YebC [Legionella pneumophila 2300/99 Alcoy]
          Length = 247

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 149/245 (60%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK  +DA + KIF+KL REITV+A++ G +   NPRLR A++ A N +
Sbjct: 1   MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+ A+K+  G  D      +RYEGYGP GVAI+++ L+DN+NRT S +R  F+K 
Sbjct: 61  MKRDTIDNAVKRGVGGADGEAMIAMRYEGYGPGGVAILVDCLSDNKNRTVSEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F   GEI+  SN  +  + ME+AI++ A +V  ED +          
Sbjct: 121 GGNLGTDGSVSYLFTNQGEILMASNQPEDKV-MEIAIDAGASDVAVEDSQVEIITPVEAY 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L++   E +   +  +    + +S+ +  +S+IK+I+ LED DDVQ VYSN E 
Sbjct: 180 HTVLNALQDAGLEVEQSHLTMRAQTLVPISD-ETAESLIKLIDMLEDLDDVQEVYSNAEF 238

Query: 240 ADDII 244
           ++ I+
Sbjct: 239 SEKIL 243


>gi|54297204|ref|YP_123573.1| hypothetical protein lpp1249 [Legionella pneumophila str. Paris]
 gi|67462030|sp|Q5X5S1|Y1249_LEGPA RecName: Full=UPF0082 protein lpp1249
 gi|53750989|emb|CAH12400.1| hypothetical protein lpp1249 [Legionella pneumophila str. Paris]
 gi|307609998|emb|CBW99530.1| hypothetical protein LPW_13011 [Legionella pneumophila 130b]
          Length = 247

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 149/245 (60%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK  +DA + KIF+KL REITV+A++ G +   NPRLR A++ A N +
Sbjct: 1   MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+ A+K+  G  D      +RYEGYGP GVAI+++ L+DN+NRT S +R  F+K 
Sbjct: 61  MKRDTIDNAVKRGVGGADGEAMIAMRYEGYGPGGVAILVDCLSDNKNRTVSEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F   GEI+  SN  +  + ME+AI++ A +V  ED +          
Sbjct: 121 GGNLGTDGSVSYLFTNQGEILMASNQPEDKV-MEIAIDAGASDVAVEDSQIEIITPVEAY 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L++   E +   +  +    + +S+ +  +S+IK+I+ LED DDVQ VYSN E 
Sbjct: 180 HTVLNALQDAGLEVEQSHLTMRAQTLVPISD-ETAESLIKLIDMLEDLDDVQEVYSNAEF 238

Query: 240 ADDII 244
           ++ I+
Sbjct: 239 SEKIL 243


>gi|312796932|ref|YP_004029854.1| hypothetical protein RBRH_02488 [Burkholderia rhizoxinica HKI 454]
 gi|312168707|emb|CBW75710.1| Hypothetical cytosolic protein [Burkholderia rhizoxinica HKI 454]
          Length = 256

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 147/243 (60%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA + K++++L +EITV+A+L G +   NPRLRLAI  A + +
Sbjct: 15  MAGHSKWANIKHKKAAADAKRGKVWTRLIKEITVAARLGGGDAGSNPRLRLAIDKATDAN 74

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N+ RAI++  G  +  NY  IRYEGYG  G AII++ +TDNR RT + +R  F+K 
Sbjct: 75  MPKDNVNRAIQRGVGGVEGANYEEIRYEGYGIGGAAIIVDTMTDNRTRTVAEVRHAFSKH 134

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F+ +G+ ++     +  L ME A+E+ A +V   D   I   C  N+
Sbjct: 135 GGNLGTDGSVAFLFDHVGQFLFAPGTPEDKL-MEAALEAGADDVTTNDDGSIEVLCAPND 193

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +A+  +V  KP   +  +  D VK + K+++ LE+ DDVQ VY+N  
Sbjct: 194 FAQVKAALEAAGFKAELAEVTMKPQTEVEFTGDDAVK-MQKLLDALENLDDVQEVYTNAV 252

Query: 239 IAD 241
           IAD
Sbjct: 253 IAD 255


>gi|167562120|ref|ZP_02355036.1| hypothetical protein BoklE_06107 [Burkholderia oklahomensis EO147]
 gi|167569369|ref|ZP_02362243.1| hypothetical protein BoklC_05962 [Burkholderia oklahomensis C6786]
          Length = 242

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 144/238 (60%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA + KI+++L +EI V+A+L G +P  NPRLRLA+  A + +
Sbjct: 1   MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDPNSNPRLRLAVDKAADAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI +  G  D  NY  IRYEGYG  G AII++ LTDNR RT + +R  F+K 
Sbjct: 61  MPKDNVKRAIDRGVGGADGANYEEIRYEGYGIGGAAIIVDTLTDNRTRTVAEVRHAFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ GS    F+ +G+ ++     +  L ME A+E+ A +V   D   I   CD+  
Sbjct: 121 GGNMGTDGSVAFMFDHVGQFLFAPGTSEDAL-MEAALEAGANDVNTNDDGSIEVLCDWQE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE    +A+  +V  KP N I  +  D  K + K+++ LE+ DDVQ VY+N
Sbjct: 180 FSKVKDALEAAGFKAELAEVTMKPQNEIEFTGEDAAK-MQKLLDALENLDDVQEVYTN 236


>gi|302344657|ref|YP_003809186.1| hypothetical protein Deba_3239 [Desulfarculus baarsii DSM 2075]
 gi|301641270|gb|ADK86592.1| protein of unknown function DUF28 [Desulfarculus baarsii DSM 2075]
          Length = 250

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 145/246 (58%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA + +IF++L +EITV+A++ G +   N RLR A+  AK Q+
Sbjct: 1   MSGHSKWSTIKRKKGAADAKRGQIFTRLMKEITVAARMGGGDIEGNSRLRSAVAAAKAQN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIERAIKK  G  D  +Y  I YEGYGP GVA IIE LTDN+NR A+ +R I  K 
Sbjct: 61  MPKDNIERAIKKGTGELDGVSYEEIVYEGYGPGGVAFIIECLTDNKNRAAAEVRHILNKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIY-HSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSLG  G+ +  FE  G   +  + +G+  L MEVA+E+ A +V  ED  +   C    
Sbjct: 121 GGSLGKNGAVSFMFEAKGVFSFDKAAVGEDQL-MEVALEAGADDVSDEDDAWQVTCAPGA 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               +   E    + QS +        + + +  +   ++K+ E L+D DDVQ+VYSN +
Sbjct: 180 FSAVAAAFEAAGLQPQSAEFTKIATTTVDIKDPVEAGKVLKLFEALDDADDVQNVYSNFD 239

Query: 239 IADDII 244
           I DD++
Sbjct: 240 IDDDVM 245


>gi|259501480|ref|ZP_05744382.1| glucose-1-phosphate adenylyltransferase [Lactobacillus iners DSM
           13335]
 gi|302191551|ref|ZP_07267805.1| hypothetical protein LineA_06049 [Lactobacillus iners AB-1]
 gi|309803904|ref|ZP_07697988.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LactinV 11V1-d]
 gi|309806210|ref|ZP_07700226.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LactinV 03V1-b]
 gi|309808350|ref|ZP_07702253.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LactinV 01V1-a]
 gi|309809489|ref|ZP_07703347.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners SPIN 2503V10-D]
 gi|312871681|ref|ZP_07731770.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 3008A-a]
 gi|312872829|ref|ZP_07732892.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 2062A-h1]
 gi|312873671|ref|ZP_07733717.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 2052A-d]
 gi|312875256|ref|ZP_07735265.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 2053A-b]
 gi|315653329|ref|ZP_07906251.1| glucose-1-phosphate adenylyltransferase [Lactobacillus iners ATCC
           55195]
 gi|325911877|ref|ZP_08174281.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners UPII 143-D]
 gi|325913061|ref|ZP_08175432.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners UPII 60-B]
 gi|329920006|ref|ZP_08276884.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners SPIN 1401G]
 gi|259167111|gb|EEW51606.1| glucose-1-phosphate adenylyltransferase [Lactobacillus iners DSM
           13335]
 gi|308163999|gb|EFO66262.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LactinV 11V1-d]
 gi|308167429|gb|EFO69592.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LactinV 03V1-b]
 gi|308168413|gb|EFO70528.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LactinV 01V1-a]
 gi|308170161|gb|EFO72196.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners SPIN 2503V10-D]
 gi|311089219|gb|EFQ47654.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 2053A-b]
 gi|311090771|gb|EFQ49169.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 2052A-d]
 gi|311091638|gb|EFQ50019.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 2062A-h1]
 gi|311092781|gb|EFQ51136.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners LEAF 3008A-a]
 gi|315489254|gb|EFU78894.1| glucose-1-phosphate adenylyltransferase [Lactobacillus iners ATCC
           55195]
 gi|325476383|gb|EGC79545.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners UPII 143-D]
 gi|325477617|gb|EGC80758.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners UPII 60-B]
 gi|328936777|gb|EGG33217.1| DNA-binding regulatory protein, YebC/PmpR family [Lactobacillus
           iners SPIN 1401G]
          Length = 243

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 148/241 (61%), Gaps = 11/241 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA K KIF KLSRE+ ++AK  G +P  NP LRL +  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKKGKIFQKLSRELFMAAKSGGPDPSGNPSLRLVMDKARAAN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK NIERAIKKA  +   +Y  I YEGY P GVA+++EALTDN+NRTAS++R  FT+  
Sbjct: 61  MPKSNIERAIKKAEGNSDEHYDEITYEGYAPGGVAVLVEALTDNKNRTASAVRVAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCD-- 175
           G++G+TGS    F++ G I+   +  D++   + M+V +++   ++   D  +  Y D  
Sbjct: 121 GTMGATGSVAYMFDRKGYIVIDRSTTDADEDQVLMDV-MDAGGDDLQASDDAFEIYTDPK 179

Query: 176 -FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
            F  V    +K   K+ +A+   V   P N   +  A+K +   ++I+ LEDDDDV +VY
Sbjct: 180 AFTGVRDALEKAGYKLADAELTMV---PQNTTAVP-AEKKEQFERLIDALEDDDDVSNVY 235

Query: 235 S 235
           +
Sbjct: 236 T 236


>gi|301060228|ref|ZP_07201095.1| DNA-binding regulatory protein, YebC/PmpR family [delta
           proteobacterium NaphS2]
 gi|300445740|gb|EFK09638.1| DNA-binding regulatory protein, YebC/PmpR family [delta
           proteobacterium NaphS2]
          Length = 248

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 150/249 (60%), Gaps = 10/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ +I H+K   DA + KIF+KL +EITV+A++ G +P  NPRLR AI  AK ++
Sbjct: 1   MSGHSKWSSIKHKKGAADAKRGKIFTKLIKEITVAARMGGGDPEGNPRLRTAIAAAKAEN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKENIER IKK   +  G NY    YEGYGP G A++++ LTDN+NR+ + I+ +F + 
Sbjct: 61  MPKENIERGIKKGTGELEGVNYEEASYEGYGPGGSAVLVDCLTDNKNRSVADIKHLFERN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEV---LFEDQEYIFYCDF 176
            G+LG  G     FEQ G I+   +  D    +++A+E+ A +V     E +      DF
Sbjct: 121 GGNLGEPGCVAWIFEQRGLIVLEKDQVDEEQLIDLALEAGAEDVKEEETEFEVVTAPSDF 180

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWK-PLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
             V    +K  +  G   ++  + K P N +++    K + +I +++ LED DDV  VY+
Sbjct: 181 EAV----RKAIDDAGLPYTLAEVTKIPKNTVKVE-GKKAQQMINLMQALEDHDDVSHVYA 235

Query: 236 NLEIADDII 244
           N +IADD++
Sbjct: 236 NFDIADDVM 244


>gi|259908217|ref|YP_002648573.1| hypothetical protein EpC_15620 [Erwinia pyrifoliae Ep1/96]
 gi|224963839|emb|CAX55341.1| conserved uncharacterized protein [Erwinia pyrifoliae Ep1/96]
 gi|283478147|emb|CAY74063.1| UPF0082 protein ECA2494 [Erwinia pyrifoliae DSM 12163]
          Length = 247

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +   NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDAGSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  F+K 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + +  + M+ A+E+ A +V+ ++D     +  + N
Sbjct: 121 GGNLGTDGSVAYLFTRKGVISYAPGLNEDTV-MDAALEAGADDVVTYDDGAIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+    +A+S +V   P     + + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 MGAVKDVLDAAGLQAESAEVTMIPSTKADM-DMETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|282900371|ref|ZP_06308321.1| protein of unknown function DUF28 [Cylindrospermopsis raciborskii
           CS-505]
 gi|281194684|gb|EFA69631.1| protein of unknown function DUF28 [Cylindrospermopsis raciborskii
           CS-505]
          Length = 252

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/249 (40%), Positives = 152/249 (61%), Gaps = 7/249 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K   DA K  +F++LSR I ++AK    +P  N +LR AI  AK   
Sbjct: 1   MAGHSKWANIKRQKAVVDAKKGSVFTQLSRAIIIAAKNGIPDPTGNFQLRTAIDKAKAAG 60

Query: 61  MPKENIERAIKKAGSDDLGNYTN----IRYEGYGPEGVAIIIEALTDNRNRTASSIRSIF 116
           +P +NIERAI K G+  LG+ +N    IRYEGYGP GVAI++EALTDNRNRTA+ +R  F
Sbjct: 61  IPNDNIERAIAK-GAGTLGSDSNNLEEIRYEGYGPGGVAILVEALTDNRNRTAADLRVAF 119

Query: 117 TKANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCD 175
           +K  G+LG TG  +  F Q G  I      + NL +E ++  +A      DQ+    +  
Sbjct: 120 SKNGGNLGETGCVSWMFSQKGVCIVTGVEDEENL-LEASLVGNAESYEMIDQQVAEVFTQ 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
            +++   S+ L+ K  +   +++ W P   + +++ D+ KS++K+I  LE  DDVQSV +
Sbjct: 179 VSDLEKLSQTLKAKDFKLTEVEIRWIPQTEVEVTHVDQAKSLLKLIYTLEGLDDVQSVTA 238

Query: 236 NLEIADDII 244
           N ++A++II
Sbjct: 239 NFDMAENII 247


>gi|126174261|ref|YP_001050410.1| hypothetical protein Sbal_2039 [Shewanella baltica OS155]
 gi|125997466|gb|ABN61541.1| protein of unknown function DUF28 [Shewanella baltica OS155]
          Length = 248

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 95/248 (38%), Positives = 149/248 (60%), Gaps = 8/248 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR+AI  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDSNPRLRVAIDKALGGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  +      I YEGYGP G A+++E +TDN NRT S +R+ F+K+
Sbjct: 61  MTRDTVERAIKRGAGELEGQQLETILYEGYGPGGTAVMVETMTDNSNRTVSGVRNAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G + Y     D +  ME A+E+ A +++ ++D     + D  +
Sbjct: 121 GGNLGTDGSVSYLFTKRGVLSYAPGT-DEDALMEAALEAGAEDIVSYDDGAMDVFTDPVD 179

Query: 179 VGLTSKKLEEK--IGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  L++   + +   I +I      + L  A+K    +++I+ LED DDVQ VY N
Sbjct: 180 FYTVKDALDKASFVADNAEIAMIASTKAELDLDTAEK---FMRLIDTLEDHDDVQEVYHN 236

Query: 237 LEIADDII 244
            EI+DD++
Sbjct: 237 AEISDDVM 244


>gi|119952831|ref|YP_945040.1| hypothetical protein BT0025 [Borrelia turicatae 91E135]
 gi|254799456|sp|A1QYH8|Y025_BORT9 RecName: Full=UPF0082 protein BT0025
 gi|119861602|gb|AAX17370.1| hypothetical cytosolic protein [Borrelia turicatae 91E135]
          Length = 244

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 104/249 (41%), Positives = 153/249 (61%), Gaps = 12/249 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REI+++AK+ G +   N RLRLA+  A+  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIESNSRLRLAVNKARVSN 60

Query: 61  MPKENIERAIKK-AGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NIE+AIKK +G D++G+ Y  + YE Y P GVA+II+ LTDN+NRTAS +RS+ +K
Sbjct: 61  MPKDNIEKAIKKGSGDDNIGSEYFELTYEAYAPHGVALIIKCLTDNKNRTASEVRSVLSK 120

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
           + GSLG+ GS +  F + G I Y  +    +  +E+A+E+ A ++  E  +        N
Sbjct: 121 SGGSLGAPGSVSYMFHKKGLISYSLDKYPEDEIIELALEAGAEDIYSEGSQIEVITSAEN 180

Query: 179 VGLTSK----KLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
               S     K EE I E   I     P N + L N +++  ++ +IE LED DDVQ V 
Sbjct: 181 FEAISSFLRTKFEEDIAEIALI-----PGNKLSL-NKEQMDKVLALIEKLEDFDDVQEVV 234

Query: 235 SNLEIADDI 243
            NLEI D+I
Sbjct: 235 HNLEIIDEI 243


>gi|295425963|ref|ZP_06818638.1| glucose-1-phosphate adenylyltransferase [Lactobacillus amylolyticus
           DSM 11664]
 gi|295064346|gb|EFG55279.1| glucose-1-phosphate adenylyltransferase [Lactobacillus amylolyticus
           DSM 11664]
          Length = 243

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 144/238 (60%), Gaps = 5/238 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + KIF KLSREI ++AK  G +P  NP LR+ I  A+  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKIFQKLSREIYMAAKSGGPDPSGNPNLRMVIDKARANN 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKAN 120
           MPK NIERAIKKA  +   +Y  I YEGY P GVA+ +EALTDN+NRTAS +R  FT+  
Sbjct: 61  MPKNNIERAIKKAEGNSDEHYDEITYEGYAPGGVAVFVEALTDNKNRTASDVRVAFTRNG 120

Query: 121 GSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           GSLG+TGS +  F++ G I+   +  D++   + ++V +++   ++   D  +  Y D  
Sbjct: 121 GSLGATGSVSYMFDRKGYIVIDRSTTDADEDQVLLDV-MDAGGDDLQTSDDAFEIYTDPK 179

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
                   LE+   +  + ++   P N   +  ADK +    +++ LED+DDVQ+VY+
Sbjct: 180 QFAQVRDALEKDGYKLANAELTMIPKNTTPVP-ADKKEQFEHLVDALEDNDDVQNVYT 236


>gi|296122800|ref|YP_003630578.1| hypothetical protein Plim_2554 [Planctomyces limnophilus DSM 3776]
 gi|296015140|gb|ADG68379.1| protein of unknown function DUF28 [Planctomyces limnophilus DSM
           3776]
          Length = 248

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 143/245 (58%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS + NI H+K R D  + K+F KLS+ I V+A+  G +P  N  LR AI  AK  S
Sbjct: 1   MAGHSHWANIAHKKGRYDQKRGKLFGKLSKAIIVAAQRGG-DPAANLALRYAIDRAKKSS 59

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + IERAIKK  G     NY  + YEGYGP GVA++ + LT+NRNRTA  +R IF   
Sbjct: 60  MPADTIERAIKKGTGELQADNYEQVLYEGYGPGGVAVLCDILTENRNRTAGEVRRIFDIH 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LGSTG     F++ G     + + D +  ME+A+++ A +V  +   +   C     
Sbjct: 120 GGNLGSTGCVAWMFDRRGLYAVKAGVTDEDTLMEIALDAGALDVTADAGGFSVICPPETF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
               + LE+     +S ++   P N + L + +  ++++ +I+ LED+DD+Q+V SN  +
Sbjct: 180 TPVGEALEKAGIPMESAEITMLPQNTVEL-DLEMGRAVLALIDALEDNDDIQNVMSNFSV 238

Query: 240 ADDII 244
           +++++
Sbjct: 239 SEEVL 243


>gi|149191828|ref|ZP_01870065.1| hypothetical protein VSAK1_00370 [Vibrio shilonii AK1]
 gi|148834346|gb|EDL51346.1| hypothetical protein VSAK1_00370 [Vibrio shilonii AK1]
          Length = 248

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 142/245 (57%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REI V+AK  G  P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKIFTKLIREIVVAAKEGGGEPENNPRLRAAIDKALSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RA+ + AG +   N   + YEGYGP G A+++E +TDNRNRT S +R  F+KA
Sbjct: 61  MTRDTVNRAVSRGAGGEGDDNMETVIYEGYGPGGTAVMVECMTDNRNRTVSGVRHAFSKA 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F++ G I Y   + D +  MEVA+E  A ++   D   I  Y    +
Sbjct: 121 GGNLGTDGSVNYLFDKKGVISYAPGL-DEDEVMEVALEGGADDIETGDDGAIDVYTTPAD 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     L+    +A + +V   P            K ++++I+ LED DDVQ VY N +
Sbjct: 180 FGAVKDALDGAGYQAANAEVTLVPSTKAEHDETTAPK-LLRLIDALEDLDDVQEVYHNGD 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|146329317|ref|YP_001210063.1| hypothetical protein DNO_1179 [Dichelobacter nodosus VCS1703A]
 gi|166228903|sp|A5EXG2|Y1179_DICNV RecName: Full=UPF0082 protein DNO_1179
 gi|146232787|gb|ABQ13765.1| conserved hypothetical protein [Dichelobacter nodosus VCS1703A]
          Length = 244

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 154/254 (60%), Gaps = 23/254 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K ++DA + KIF++L RE+TV+A+  G +   NPRLRLA+  A+ ++
Sbjct: 1   MAGHSKWANIKHKKAKEDAKRGKIFTRLIRELTVAARHGGSDINANPRLRLAVSKAQAEN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M KE +ERAIK+ AG  D      +R+EGYGP GVAII++ LTDN NRT   +R  F+K 
Sbjct: 61  MTKETMERAIKRGAGELDGVQMEEVRFEGYGPSGVAIIVDCLTDNNNRTVGEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFED---------QEY 170
            G+LG++GS    F++ G +++  N+ D +  ME A+ + A ++ F+D         +EY
Sbjct: 121 GGNLGTSGSVAFQFKEQG-VLFFENVDDEDALMEAALNAGAEDIEFDDKSAEILTAPEEY 179

Query: 171 I-FYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDD 229
              Y      G T+ + E        + +  + L+ + L +A++V  +++M+E L   DD
Sbjct: 180 ANVYEALVQAGFTADESE--------VTLRAENLSAVSLEDAEQVARLLEMLEEL---DD 228

Query: 230 VQSVYSNLEIADDI 243
           VQSV SN +  ++ 
Sbjct: 229 VQSVVSNADFPEEF 242


>gi|251793069|ref|YP_003007795.1| hypothetical protein NT05HA_1356 [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534462|gb|ACS97708.1| conserved hypothetical protein [Aggregatibacter aphrophilus NJ8700]
          Length = 246

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 147/246 (59%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AK+ G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI++   G DD    T + YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIERGVGGGDDTNMETRV-YEGYGPGGTAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFE-DQEYIFYCDFN 177
             G+LG+ GS    F + G I+   N  D +  ME AIE  A +V  + D  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILV--NQADEDALMEAAIEGGADDVQPQDDSSFEIYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++G     +E    + +S +V   P   + L +A+    ++++I+ LED DDVQ+VY N 
Sbjct: 178 DLGSVRDAIEAAGFKIESAEVTMIPSTTVDL-DAETAPKLLRLIDMLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D++
Sbjct: 237 EISDEV 242


>gi|73666976|ref|YP_302992.1| hypothetical protein Ecaj_0351 [Ehrlichia canis str. Jake]
 gi|119391972|sp|Q3YSB1|Y351_EHRCJ RecName: Full=UPF0082 protein Ecaj_0351
 gi|72394117|gb|AAZ68394.1| protein of unknown function DUF28 [Ehrlichia canis str. Jake]
          Length = 248

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 150/245 (61%), Gaps = 8/245 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHSQF NI HRK  +DA +++ F+KL REI VSAK    +P  N RLR AI  AK ++
Sbjct: 1   MAGHSQFANIKHRKGAQDAKRAQRFTKLIREIIVSAKQGLPDPEFNSRLRSAIIAAKKEN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ I+ AIK A G+    NY  + YEGYGP  +A++I+ LT+NRNRTA+ +R   +K 
Sbjct: 61  LPKDRIDAAIKSATGNTQSDNYEEVVYEGYGPGNIALMIQTLTNNRNRTAAELRHALSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIGDSNLAMEVAIESDAFEV----LFEDQEYIFY- 173
           NG LG +GS +  F  +G I Y  ++I + +    +AIE  A +V      E QE ++Y 
Sbjct: 121 NGKLGESGSVSFLFNHVGVIAYKAASIDNFDSLFNIAIELQALDVEETTQDESQEKMYYV 180

Query: 174 -CDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
            C+  + G    +L  K  +A+  ++ WKP + +++ + +  K I  +++ LE++DDVQ 
Sbjct: 181 TCNVQDFGNVRDQLFNKFSDAEFSRLFWKPSDILKIEDEEIQKKISSLMDLLENNDDVQY 240

Query: 233 VYSNL 237
           + SN 
Sbjct: 241 IDSNF 245


>gi|325266856|ref|ZP_08133527.1| YebC like protein [Kingella denitrificans ATCC 33394]
 gi|324981597|gb|EGC17238.1| YebC like protein [Kingella denitrificans ATCC 33394]
          Length = 242

 Score =  172 bits (436), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 99/248 (39%), Positives = 153/248 (61%), Gaps = 13/248 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R+DA + KIF+KL +EIT++AK  G +P  NPRLRLA++ A + +
Sbjct: 1   MAGHSKWANIQHKKARQDAKRGKIFTKLIKEITIAAKQGGGDPNANPRLRLAMEKAWDAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G  Y  +RYEGYG  G A++++ +TDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVEYIELRYEGYGIGGAAVMVDCMTDNKTRTVADVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
            G+LG+ G     F   G ++Y +   D +  ME A+E+ A +V+ +++  I       D
Sbjct: 121 GGNLGTDGCVAFNFVHQGYLLYTN--ADEDALMEAALEAGAEDVIADEEGVIEVITAPTD 178

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + NV      LE+   +A+   V  +P     LS A+  K + K+I+ LED DDVQ+VY+
Sbjct: 179 WANV---KTALEQAGFKAEDGDVTMRPQTTTELSGAEAEK-MQKLIDALEDLDDVQNVYT 234

Query: 236 N--LEIAD 241
           +  L++ D
Sbjct: 235 SAVLDLGD 242


>gi|111114847|ref|YP_709465.1| hypothetical protein BAPKO_0024 [Borrelia afzelii PKo]
 gi|122956436|sp|Q0SPD9|Y024_BORAP RecName: Full=UPF0082 protein BAPKO_0024
 gi|110890121|gb|ABH01289.1| conserved hypothetical protein [Borrelia afzelii PKo]
          Length = 243

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 152/248 (61%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REIT++AK+ G +   NPRLR+A+  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAVSKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I+ LTDN+NRT+S ++S+  K 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKSVLAKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G ++Y+      +  ME A+E  A ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGLVVYNLEKYLEDEIMEFALEFGAEDILVSNNEAEVITNPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V  L   K +E++ E   I     P N I L N ++ + II +IE LED DDVQ V  
Sbjct: 181 DKVLSLLRTKFKEEMAEIALI-----PENKISL-NKEQAEKIILLIEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|261868505|ref|YP_003256427.1| hypothetical protein D11S_1850 [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413837|gb|ACX83208.1| dATP pyrophosphohydrolase [Aggregatibacter actinomycetemcomitans
           D11S-1]
          Length = 246

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 146/246 (59%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AK+ G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSSNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI++   G DD    T + YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIERGVGGGDDTNMETRV-YEGYGPGGAAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFN 177
             G+LG+ GS    F + G I+   N  D +  ME AIE  A +V   ED  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILV--NQADEDALMEAAIEGGADDVQPQEDGSFEIYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++G     +E      ++ +V   P   + L +A+    ++++I+ LED DDVQ+VY N 
Sbjct: 178 DLGSVRDAIEAAGFNVENAEVTMIPSTTVDL-DAETAPKLLRLIDMLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D+I
Sbjct: 237 EISDEI 242


>gi|238023201|ref|ZP_04603627.1| hypothetical protein GCWU000324_03128 [Kingella oralis ATCC 51147]
 gi|237865584|gb|EEP66724.1| hypothetical protein GCWU000324_03128 [Kingella oralis ATCC 51147]
          Length = 241

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 147/238 (61%), Gaps = 5/238 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R DA + KIF+KL +EITV+AK  G +P  NPRLRLA+  A + +
Sbjct: 1   MAGHSKWANIQHKKARVDAQRGKIFTKLIKEITVAAKQGGGDPASNPRLRLAMDKAWDAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G +Y  +RYEGYG  G A++++ +TDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVDYVELRYEGYGIGGAALMVDCMTDNKTRTVADVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ G     F   G +++ +N+ D +  ME A+E+ A +V+ +D+  I      N+
Sbjct: 121 GGNLGTDGCVAFNFVHQGYLVF-ANV-DEDALMEAALEAGAEDVIVDDEGIIEVITAPND 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
                  LE+   +A+   V  +  N   LS AD  K + K+I+ LE  DDVQ+VY++
Sbjct: 179 WAAIKAALEQAGFKAEDGDVTMRAQNTTELSGADAEK-MQKLIDALESLDDVQNVYTS 235


>gi|91793241|ref|YP_562892.1| hypothetical protein Sden_1886 [Shewanella denitrificans OS217]
 gi|91715243|gb|ABE55169.1| protein of unknown function DUF28 [Shewanella denitrificans OS217]
          Length = 248

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 102/251 (40%), Positives = 147/251 (58%), Gaps = 14/251 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K  RE+TV+A+  G +P  NPRLR AI  + + +
Sbjct: 1   MAGHSKWANIRHRKAAQDAKRGKLFTKFIRELTVAAREGGSDPDANPRLRAAIDKSLSNN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ +ERAIK+ AG  D      I YEGYGP G A+++E +TDNRNRT S +R+ F K+
Sbjct: 61  MTRDTVERAIKRGAGELDGQQLETIIYEGYGPGGTAVMVETMTDNRNRTVSGVRNAFNKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G+LG+ GS    F + G II   N  D ++ ME A+E+ A +V+  D   +        
Sbjct: 121 GGNLGTDGSVAYLFTKSG-IISFDNSNDEDVLMEQALEAGAEDVISHDDGSVDVLTSPDT 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F  V   L S  L     E   +  +   L+   L  A+K    +++I+ LED DDVQ V
Sbjct: 180 FGKVKDALDSAGLNALNAEVTMLASLKAELD---LETAEK---FLRLIDTLEDHDDVQEV 233

Query: 234 YSNLEIADDII 244
           Y N EI+DD++
Sbjct: 234 YHNAEISDDVM 244


>gi|94309730|ref|YP_582940.1| hypothetical protein Rmet_0785 [Cupriavidus metallidurans CH34]
 gi|118574400|sp|Q1LQA5|Y785_RALME RecName: Full=UPF0082 protein Rmet_0785
 gi|93353582|gb|ABF07671.1| conserved hypothetical protein [Cupriavidus metallidurans CH34]
          Length = 241

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 98/238 (41%), Positives = 146/238 (61%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA + K++++L +EITV+AKL G     NPRLRLA++ A + +
Sbjct: 1   MAGHSKWANIKHKKAAADAKRGKVWTRLIKEITVAAKLGGGEFDSNPRLRLAMEKAMDAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++  G  +  NY  IRYEGYG  G AII++ LTDNR RT + +R  F+K 
Sbjct: 61  MPKDNIQRAIQRGVGGLEGANYEEIRYEGYGLAGAAIIVDCLTDNRTRTVAEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ GS    F   G+ ++     +  L M+ A+E+ A +V+  D E I   C  N+
Sbjct: 121 GGNMGTEGSVAFMFTHCGQFLFAPGTPEDKL-MDAALEAGADDVVTNDDESIEVTCPPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            G     LE    +A+   V+ KP N +     D VK + K+++ LE+ DDVQ V++N
Sbjct: 180 FGAVKAALEAAGFKAEVADVVMKPQNEVSFVGDDAVK-MQKLLDALENLDDVQEVFTN 236


>gi|225552242|ref|ZP_03773182.1| conserved hypothetical protein [Borrelia sp. SV1]
 gi|225371240|gb|EEH00670.1| conserved hypothetical protein [Borrelia sp. SV1]
          Length = 243

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 151/248 (60%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REIT++AK+ G +   NPRLR+AI  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAINKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I+ LTDN+NRT+S ++S+  K 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKSVLAKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G I+Y+      +  ME A+E  A ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGLIVYNLEKYLEDEIMEFALEVGAEDILVSNNEAEVITSPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V      K +E++ E   I     P N I L N ++ + II ++E LED DDVQ V  
Sbjct: 181 DKVLSFLKTKFKEEVAEIALI-----PENKISL-NKEQAEKIILLVEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|317051311|ref|YP_004112427.1| hypothetical protein Selin_1136 [Desulfurispirillum indicum S5]
 gi|316946395|gb|ADU65871.1| protein of unknown function DUF28 [Desulfurispirillum indicum S5]
          Length = 249

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 147/245 (60%), Gaps = 2/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+K+++EI ++A+ +G +P  NP LRLA+Q AK  +
Sbjct: 1   MAGHSKWANIRHRKGAQDAKRGKIFTKVAKEIAIAAR-NGADPDMNPALRLALQKAKGVN 59

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +N++RAIK+  G  D  NY +I YEGY P G+A+++E+LTDN+NRT + +R IF+K 
Sbjct: 60  MPNDNVQRAIKRGIGGMDGDNYESITYEGYAPGGIAVMVESLTDNKNRTVAEVRHIFSKR 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GSLG +G     F + G I  ++     +  M VA+++ A +V   D  +       + 
Sbjct: 120 GGSLGESGCVGYLFSRKGVITVNAESASEDDVMLVALDAGAEDVKSGDGMFEIIAAAEDF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 +EE     ++ ++   P   I + +      ++ ++E LED DDVQ+VY N +I
Sbjct: 180 MAVRDAMEEAGIPIETAEMNMVPATTITVEDEKIATQVLSLMEALEDCDDVQNVYMNFDI 239

Query: 240 ADDII 244
            D ++
Sbjct: 240 DDALM 244


>gi|310767868|gb|ADP12818.1| hypothetical protein EJP617_31370 [Erwinia sp. Ejp617]
          Length = 247

 Score =  172 bits (436), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 145/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +   NPRLR A+  A   +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDAGSNPRLRAAMDKALANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  F+K 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I Y   + +  + M+ A+E+ A +V+ ++D     +  + N
Sbjct: 121 GGNLGTDGSVAYLFTRKGVISYAPGLNEDTV-MDAALEAGADDVVTYDDGAIDVFTAWEN 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     L+    +A+S +V   P     + + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 MGAVKDVLDAAGLQAESSEVTMIPSTKADM-DMETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|293390521|ref|ZP_06634855.1| dATP pyrophosphohydrolase [Aggregatibacter actinomycetemcomitans
           D7S-1]
 gi|290951055|gb|EFE01174.1| dATP pyrophosphohydrolase [Aggregatibacter actinomycetemcomitans
           D7S-1]
          Length = 246

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 146/246 (59%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AK+ G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVGSNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI++   G DD    T + YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIERGVGGGDDTNMETRV-YEGYGPGGAAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFN 177
             G+LG+ GS    F + G I+   N  D +  ME AIE  A +V   ED  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILV--NQADEDALMEAAIEGGADDVQPQEDGSFEIYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++G     +E      ++ +V   P   + L +A+    ++++I+ LED DDVQ+VY N 
Sbjct: 178 DLGSVRDAIEAAGFNVENAEVTMIPSTTVDL-DAETAPKLLRLIDMLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D+I
Sbjct: 237 EISDEI 242


>gi|117618272|ref|YP_856060.1| hypothetical protein AHA_1522 [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|166231395|sp|A0KIF9|Y1522_AERHH RecName: Full=UPF0082 protein AHA_1522
 gi|117559679|gb|ABK36627.1| conserved hypothetical protein [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
          Length = 246

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 146/246 (59%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL REIT SA+L   +P  NPRLR A+  A   +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKIFTKLIREITTSARLGDADPANNPRLRAAVAAALTGN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I RAI++ AG  D      I YEGYGP G A+++E LTDNRNRT + +R  F+K 
Sbjct: 61  MTRDTINRAIQRGAGGGDGEQLETIVYEGYGPAGSAVMVECLTDNRNRTVAEVRHAFSKC 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYI-FYCDFN 177
            G+LG+ GS    F + G + +   +G D +  M+ A+E+ A +V+ E+   I  Y   N
Sbjct: 121 GGNLGTDGSVAYLFSKKGLLTF---VGVDEDALMDAALEAGADDVVTEEDGSIEVYTTPN 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           + G     LE    + QS +V   P     L +A+    ++++I+ LED DDVQ VY N 
Sbjct: 178 DFGTVLDGLEAAGFKPQSAEVTMIPSTEAEL-DAETAPKLMRLIDMLEDLDDVQEVYHNG 236

Query: 238 EIADDI 243
            I+D++
Sbjct: 237 SISDEV 242


>gi|220903813|ref|YP_002479125.1| hypothetical protein Ddes_0536 [Desulfovibrio desulfuricans subsp.
           desulfuricans str. ATCC 27774]
 gi|254806474|sp|B8J4I9|Y536_DESDA RecName: Full=UPF0082 protein Ddes_0536
 gi|219868112|gb|ACL48447.1| protein of unknown function DUF28 [Desulfovibrio desulfuricans
           subsp. desulfuricans str. ATCC 27774]
          Length = 245

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 93/244 (38%), Positives = 151/244 (61%), Gaps = 3/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+DA + K+F+K ++EI ++AK  G +P  NPRLR AI  AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDAKRGKLFTKAAKEIIIAAK-GGGDPSMNPRLRAAIAAAKAVN 59

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +PK+ IE AI+K  G D  G+ T   YEGYGP G+A+++E  TDN+NRT + +R +F+K 
Sbjct: 60  LPKDKIEAAIRKGTGEDAGGDLTETFYEGYGPGGIAVMVEVATDNKNRTVAEVRHLFSKH 119

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            GS+G  GS    F++ G I    +       ME A+E+ A +V+ + +E+  +    + 
Sbjct: 120 GGSMGENGSVAWMFDRKGVISVEKSAYPEEKIMEAALEAGADDVIDDGEEWTIHTAMTDF 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE      QS ++   P N + + +AD  + ++++++ L+D+DDVQ+VY+N++ 
Sbjct: 180 TAVRDSLETAGIVMQSAELAMVPQNLVAV-DADMGQKVLRLMDALDDNDDVQNVYANVDF 238

Query: 240 ADDI 243
            +D+
Sbjct: 239 PEDM 242


>gi|317048522|ref|YP_004116170.1| hypothetical protein Pat9b_2312 [Pantoea sp. At-9b]
 gi|316950139|gb|ADU69614.1| protein of unknown function DUF28 [Pantoea sp. At-9b]
          Length = 247

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 95/245 (38%), Positives = 143/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA + KIF+K+ RE+  +AKL G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKRGKIFTKIIRELVTAAKLGGGDAGSNPRLRAAMDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G +D  N   I YEGYGP G A+++E L+DNRNRT   +R  FTK 
Sbjct: 61  MTRDTMNRAIARGVGGEDDSNMETIIYEGYGPGGSAVMVECLSDNRNRTVGEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS +  F + G I Y     D +  ME A+E+ A +V+ ++D     +  +  
Sbjct: 121 GGNLGTDGSVSYLFSKKGVISYAPGQ-DEDALMEAALEAGAEDVVSYDDGAIDVFTAWEQ 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +G     LE    +A   +V   P     L +A+    ++++I+ LED DDVQ VY N E
Sbjct: 180 LGAVRDALEAAGLKADEAEVTMIPSTKAEL-DAETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|217077314|ref|YP_002335032.1| hypothetical protein THA_1246 [Thermosipho africanus TCF52B]
 gi|226696296|sp|B7IHX7|Y1246_THEAB RecName: Full=UPF0082 protein THA_1246
 gi|217037169|gb|ACJ75691.1| conserved hypothetical protein [Thermosipho africanus TCF52B]
          Length = 252

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 147/243 (60%), Gaps = 5/243 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GH+++ NI HRK  +DA KSKIF+KL REI V+AK  G +P  NPRLR  ++ A+  +
Sbjct: 1   MSGHNKWANIKHRKAAQDAKKSKIFTKLIREIIVAAKEGGGDPETNPRLRAVLERARAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ IE++IKK   +  G +Y  I YE Y P GVA+ I A+TDN+NRTA  +R + +K 
Sbjct: 61  MPKDTIEKSIKKGTGELEGVDYQEIIYEAYAPAGVALYIYAMTDNKNRTAQELRHLLSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEI-IYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            GSL  +GS    FE+ G I I    I D      VAI++ A E + ED         + 
Sbjct: 121 GGSLAESGSVAWLFERKGIIEIPKEKIADFEEFAMVAIDAGA-EDIIEDDPIQVITAPDM 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           +     KL E   E ++ KV + P N ++++ AD  K ++K++  LED+DDVQ VY+N E
Sbjct: 180 LTEVKDKLAENGFEGEA-KVTFIPKNTVKVTGADAEK-VLKLVSVLEDNDDVQEVYANFE 237

Query: 239 IAD 241
           I D
Sbjct: 238 IDD 240


>gi|51246760|ref|YP_066644.1| hypothetical protein DP2908 [Desulfotalea psychrophila LSv54]
 gi|60390894|sp|Q6AJ43|Y2908_DESPS RecName: Full=UPF0082 protein DP2908
 gi|50877797|emb|CAG37637.1| conserved hypothetical protein [Desulfotalea psychrophila LSv54]
          Length = 250

 Score =  172 bits (435), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 149/245 (60%), Gaps = 1/245 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA + KIF++L +EITV+A+  G +P  NPRLR AI  AK+++
Sbjct: 1   MSGHSKWSTIKRKKGANDAKRGKIFTRLIKEITVAARGGGGDPEGNPRLRSAILVAKSEN 60

Query: 61  MPKENIERAIKKAGSDDLGN-YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI RAIKK   +  G  Y  I YEGYGP GVA+++E +TDNRNRT + IR  F K 
Sbjct: 61  MPKDNITRAIKKGTGEIAGEVYDEILYEGYGPGGVAVLVECMTDNRNRTVADIRHYFAKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
           NG+LG  G  +  FE+ G I+        +  M+ A+E+ A +V+ ++ E+    +   +
Sbjct: 121 NGNLGEAGCVSWMFEKKGLILVDKATITEDELMDQALEAGAEDVVEDETEFQVLTNPTEL 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 +E          +   P N + +++    K++++++E+LED DDVQ+V+SN +I
Sbjct: 181 DAVRGAMEAAGIAFVDASISMLPKNVVDVTDEKVGKNLLRLLESLEDHDDVQNVHSNFDI 240

Query: 240 ADDII 244
            ++++
Sbjct: 241 DEELM 245


>gi|51598288|ref|YP_072476.1| hypothetical protein BG0025 [Borrelia garinii PBi]
 gi|60390795|sp|Q662Y7|Y025_BORGA RecName: Full=UPF0082 protein BG0025
 gi|51572859|gb|AAU06884.1| conserved hypothetical protein [Borrelia garinii PBi]
          Length = 243

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 151/248 (60%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REIT++AK+ G +   NPRLR+A+  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDVESNPRLRVAVNKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I+ LTDN+NRT+S ++S+  K 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKSVLAKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G I+Y+      +  ME A+E+   ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGLIVYNLEKYLEDEIMEFALEAGVEDILVSNNEAEVITSPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V      K +E++ E   I     P N I L N ++ + II +IE LED DDVQ V  
Sbjct: 181 DKVLSFLKTKFKEEMAEVALI-----PENKISL-NKEQAEKIILLIEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|216263952|ref|ZP_03435946.1| conserved hypothetical protein [Borrelia afzelii ACA-1]
 gi|215979996|gb|EEC20818.1| conserved hypothetical protein [Borrelia afzelii ACA-1]
          Length = 243

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 104/248 (41%), Positives = 152/248 (61%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++KIF+KL REIT++AK+ G +   NPRLR+A+  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKIFTKLIREITIAAKIGGGDIESNPRLRVAVNKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I+ LTDN+NRT+S ++S+  K 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMIKCLTDNKNRTSSDVKSVLAKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G ++Y+      +  ME A+E  A ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGLVVYNLEKYLEDEIMEFALEFGAEDILVSNNEAEVITNPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V  L   K +E++ E   I     P N I L N ++ + II +IE LED DDVQ V  
Sbjct: 181 DKVLSLLRTKFKEEMAEIALI-----PENKISL-NKEQAEKIILLIEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|331091071|ref|ZP_08339913.1| hypothetical protein HMPREF9477_00556 [Lachnospiraceae bacterium
           2_1_46FAA]
 gi|330405293|gb|EGG84829.1| hypothetical protein HMPREF9477_00556 [Lachnospiraceae bacterium
           2_1_46FAA]
          Length = 242

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 104/247 (42%), Positives = 155/247 (62%), Gaps = 15/247 (6%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI V+ K  G +P  N RLR  I  AK+ +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTIIGREIAVAVKEGGPDPANNSRLRDVIAKAKSNN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + IER IKKA  D +  NY ++ YEGYGP GVAII++ALTDN+NRTAS++R+ FTK 
Sbjct: 61  MPNDTIERGIKKAAGDANSVNYESVTYEGYGPSGVAIIVDALTDNKNRTASNVRNAFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEII-----YHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC 174
           +GS+G+ G  +  F++ G+II     Y +   D++  M +A+++ A +   E+  Y    
Sbjct: 121 SGSVGTQGCVSYMFDKKGQIIVAKEEYET---DADELMMIALDAGAEDFAEEEDSYEILT 177

Query: 175 ---DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQ 231
              DF++V L    LEE      S +V   P  ++ L++   +K++ K ++ L++DDDVQ
Sbjct: 178 APEDFSDVRLA---LEEAGVPMASAEVTMIPQTWVELTDETDLKNLQKTLDLLDEDDDVQ 234

Query: 232 SVYSNLE 238
            VY N +
Sbjct: 235 VVYHNWD 241


>gi|314938219|ref|ZP_07845519.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133a04]
 gi|314943114|ref|ZP_07849913.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133C]
 gi|314949311|ref|ZP_07852654.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0082]
 gi|314952245|ref|ZP_07855260.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133A]
 gi|314992103|ref|ZP_07857553.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133B]
 gi|314996285|ref|ZP_07861341.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133a01]
 gi|313589529|gb|EFR68374.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133a01]
 gi|313593317|gb|EFR72162.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133B]
 gi|313595640|gb|EFR74485.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133A]
 gi|313598173|gb|EFR77018.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133C]
 gi|313642415|gb|EFS06995.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0133a04]
 gi|313644317|gb|EFS08897.1| conserved hypothetical protein TIGR01033 [Enterococcus faecium
           TX0082]
          Length = 251

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 145/242 (59%), Gaps = 5/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  AK  +
Sbjct: 12  MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKAGGPDPSMNPALRLVVDKAKAAN 71

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +N+ERAIKKA S  D  NY  I YEGYGP GV I++ ALTDNRNRTA+++R  FT+ 
Sbjct: 72  MPNDNVERAIKKATSAVDETNYDEITYEGYGPGGVGILVHALTDNRNRTATNVRVAFTRN 131

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            GSLG TGS +  F++ G I    +    D     E  +E+ A ++    + +  Y    
Sbjct: 132 GGSLGETGSVSYLFDRKGYIAIERDGLTVDEETMFEDVLEAGAEDLQTSPEVFEIYTAPE 191

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +      +LE++   AQ+ ++   P   I L N ++ + + ++++ LEDDDDV  V++  
Sbjct: 192 DFAAVRDELEKEFTLAQA-ELTMIPQTTIDL-NEEQKEQLERLVDKLEDDDDVSEVFTAA 249

Query: 238 EI 239
           E+
Sbjct: 250 EM 251


>gi|69245439|ref|ZP_00603434.1| Protein of unknown function DUF28 [Enterococcus faecium DO]
 gi|257879850|ref|ZP_05659503.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257882576|ref|ZP_05662229.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257886026|ref|ZP_05665679.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257891691|ref|ZP_05671344.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257894166|ref|ZP_05673819.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|258614278|ref|ZP_05712048.1| hypothetical protein EfaeD_01057 [Enterococcus faecium DO]
 gi|260559523|ref|ZP_05831704.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|261206674|ref|ZP_05921372.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289565035|ref|ZP_06445489.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|293553688|ref|ZP_06674312.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|293563189|ref|ZP_06677645.1| conserved hypothetical protein [Enterococcus faecium E1162]
 gi|293570111|ref|ZP_06681191.1| conserved hypothetical protein [Enterococcus faecium E1071]
 gi|294614904|ref|ZP_06694795.1| hypothetical protein EfmE1636_0985 [Enterococcus faecium E1636]
 gi|294623700|ref|ZP_06702533.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|68195821|gb|EAN10257.1| Protein of unknown function DUF28 [Enterococcus faecium DO]
 gi|257814078|gb|EEV42836.1| conserved hypothetical protein [Enterococcus faecium 1,230,933]
 gi|257818234|gb|EEV45562.1| conserved hypothetical protein [Enterococcus faecium 1,231,502]
 gi|257821882|gb|EEV49012.1| conserved hypothetical protein [Enterococcus faecium 1,231,501]
 gi|257828051|gb|EEV54677.1| conserved hypothetical protein [Enterococcus faecium 1,231,410]
 gi|257830545|gb|EEV57152.1| conserved hypothetical protein [Enterococcus faecium 1,231,408]
 gi|260074622|gb|EEW62943.1| conserved hypothetical protein [Enterococcus faecium C68]
 gi|260079167|gb|EEW66860.1| conserved hypothetical protein [Enterococcus faecium TC 6]
 gi|289163242|gb|EFD11088.1| conserved hypothetical protein [Enterococcus faecium D344SRF]
 gi|291587483|gb|EFF19367.1| conserved hypothetical protein [Enterococcus faecium E1071]
 gi|291592190|gb|EFF23808.1| hypothetical protein EfmE1636_0985 [Enterococcus faecium E1636]
 gi|291596915|gb|EFF28133.1| conserved hypothetical protein [Enterococcus faecium U0317]
 gi|291602263|gb|EFF32491.1| conserved hypothetical protein [Enterococcus faecium E1039]
 gi|291604839|gb|EFF34317.1| conserved hypothetical protein [Enterococcus faecium E1162]
          Length = 240

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 145/242 (59%), Gaps = 5/242 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LRL +  AK  +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKAGGPDPSMNPALRLVVDKAKAAN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +N+ERAIKKA S  D  NY  I YEGYGP GV I++ ALTDNRNRTA+++R  FT+ 
Sbjct: 61  MPNDNVERAIKKATSAVDETNYDEITYEGYGPGGVGILVHALTDNRNRTATNVRVAFTRN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN--IGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            GSLG TGS +  F++ G I    +    D     E  +E+ A ++    + +  Y    
Sbjct: 121 GGSLGETGSVSYLFDRKGYIAIERDGLTVDEETMFEDVLEAGAEDLQTSPEVFEIYTAPE 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           +      +LE++   AQ+ ++   P   I L N ++ + + ++++ LEDDDDV  V++  
Sbjct: 181 DFAAVRDELEKEFTLAQA-ELTMIPQTTIDL-NEEQKEQLERLVDKLEDDDDVSEVFTAA 238

Query: 238 EI 239
           E+
Sbjct: 239 EM 240


>gi|196228181|ref|ZP_03127048.1| protein of unknown function DUF28 [Chthoniobacter flavus Ellin428]
 gi|196227584|gb|EDY22087.1| protein of unknown function DUF28 [Chthoniobacter flavus Ellin428]
          Length = 252

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 142/240 (59%), Gaps = 3/240 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++  + H K   D  + ++FSKL++EITV+AK+ G +P  NPRLR AI  A+ QS
Sbjct: 1   MAGHSKWSKVKHIKGPLDQKRGQLFSKLAKEITVAAKMGGGDPGGNPRLRSAILAARAQS 60

Query: 61  MPKENIERAIKKAGSDDLGNYTNIR---YEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           MP +NI+RAIK+    +    +NI    YE Y P GVA+I+E  TDNRNRTA+ +R I T
Sbjct: 61  MPNDNIDRAIKRGTGAEGTEASNIEESVYEAYAPGGVALIVEVATDNRNRTAADLRLILT 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
           K +G+L S G+ +  F + G +   +         ++ IE+   E+  ED+ YI     +
Sbjct: 121 KNHGNLASPGAVSYMFHRKGRVTVPTTTIQEERLFDLVIEAGGEEMAREDEHYIITTAPD 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
            +   ++ L+ K  +A S K+ + P   + +++      ++++IE L+D DDVQ V++N 
Sbjct: 181 QLYAVAETLKNKGVQADSQKLTFVPETQVTVTDPTVATQVVRLIEALDDSDDVQHVHTNF 240


>gi|300717086|ref|YP_003741889.1| hypothetical protein [Erwinia billingiae Eb661]
 gi|299062922|emb|CAX60042.1| Conserved uncharacterized protein [Erwinia billingiae Eb661]
          Length = 247

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/245 (37%), Positives = 146/245 (59%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +D+ + KIF+K+ RE+  +AKL G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDSKRGKIFTKIIRELVTAAKLGGGDAGSNPRLRAAMDKALSNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G DD  N   I YEGYGP G A+++E L+DNRNRT S +R  F+K 
Sbjct: 61  MTRDTMNRAIARGVGGDDDSNMETIIYEGYGPGGTAVMVECLSDNRNRTVSEVRHAFSKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVL-FEDQEYIFYCDFNN 178
            G+LG+ GS    F + G I +   + + ++ M+ A+E+ A +++ ++D     +  +  
Sbjct: 121 GGNLGTDGSVAYLFTRKGVITFAPGLAEDDV-MDAALEAGADDIVTYDDGTIDVFTAWET 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
           VG     LE    +A+S +V   P     + + +    ++++I+ LED DDVQ VY N E
Sbjct: 180 VGQVKDTLEAAGLKAESAEVTMIPSTKADM-DEETAPKLLRLIDMLEDCDDVQEVYHNGE 238

Query: 239 IADDI 243
           I+D++
Sbjct: 239 ISDEV 243


>gi|229816698|ref|ZP_04446986.1| hypothetical protein COLINT_03746 [Collinsella intestinalis DSM
           13280]
 gi|229807750|gb|EEP43564.1| hypothetical protein COLINT_03746 [Collinsella intestinalis DSM
           13280]
          Length = 268

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 107/263 (40%), Positives = 155/263 (58%), Gaps = 20/263 (7%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQ-NPLENPRLRLAIQNAKNQ 59
           M+GHS++    HRK  +DA +S +FSKLSR ITV+A+L    NP  N  L  A+  AK Q
Sbjct: 1   MSGHSKWATTKHRKGAQDAKRSALFSKLSRNITVAARLGNDPNPDNNASLAAAVAKAKAQ 60

Query: 60  SMPKENIERAIKKA-GSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFT 117
           SMPK+ I+ AI KA GS  D   Y NI YEGYGP GVA+ +E LTDNRNRTA+ +RS F+
Sbjct: 61  SMPKDKIKAAIDKAFGSGADAAVYENIVYEGYGPAGVAVYVECLTDNRNRTAADVRSAFS 120

Query: 118 KANGSLGSTGSTTRFFEQIGEIIYHSNIGDSN------LAMEVAIESDAFEVL------- 164
            A G+LG+TGS    FE+ G+++    I D N      +A   A + + F ++       
Sbjct: 121 HAGGNLGTTGSVAFQFERKGQVVVSKQIVDPNDKKENLMANGAAGDEEEFMMVIAEAGGD 180

Query: 165 -FED--QEYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMI 221
            +ED   E++ +    ++   SK +E +  E +  ++   P     +S AD  K + ++I
Sbjct: 181 DYEDAGDEWVVWTAAGDLMAVSKGIEAQGIEVKGAELTMVPTTPTAVSGAD-AKKVQRLI 239

Query: 222 ENLEDDDDVQSVYSNLEIADDII 244
           + LED DDVQ VYS +++ D++I
Sbjct: 240 DRLEDLDDVQDVYSTMDMTDEVI 262


>gi|149926740|ref|ZP_01915000.1| hypothetical protein LMED105_08650 [Limnobacter sp. MED105]
 gi|149824669|gb|EDM83885.1| hypothetical protein LMED105_08650 [Limnobacter sp. MED105]
          Length = 241

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 93/241 (38%), Positives = 145/241 (60%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + K+++K+ RE++V+A++ G +   NPRLRLA++ A   +
Sbjct: 1   MAGHSKWANIQHRKNRQDEKRGKVWTKIIREVSVAARVGGGDVATNPRLRLAMEKAAAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI KA  +  G NY  IRYEGYG  G A+II+ +TDN+ RT + +R   TK 
Sbjct: 61  MPKDNVQRAIAKATGEAEGVNYEEIRYEGYGVGGAAVIIDCMTDNKVRTVAEVRHALTKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS +  F+  G+ I+     +  + MEVA+E+   +V+  D   I   C    
Sbjct: 121 GGNLGTDGSVSFMFKHCGQFIFAPGHSEDTI-MEVALENGGDDVITSDDGVIEVTCPVPE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                   E    + ++ ++  KP +   L   D ++ + K+I+ LED DDVQ VY+N+ 
Sbjct: 180 FHTLKTAFEAANMQFENAELTMKPASETELEGDDAIR-MQKIIDMLEDLDDVQQVYTNVI 238

Query: 239 I 239
           I
Sbjct: 239 I 239


>gi|302391485|ref|YP_003827305.1| hypothetical protein Acear_0700 [Acetohalobium arabaticum DSM 5501]
 gi|302203562|gb|ADL12240.1| protein of unknown function DUF28 [Acetohalobium arabaticum DSM
           5501]
          Length = 254

 Score =  171 bits (434), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 155/247 (62%), Gaps = 3/247 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K+++D  ++K+FSKLS+ I V A+  G +P +NP LR+AIQ AK+ +
Sbjct: 1   MAGHSKWANIKHQKKKEDRRRAKLFSKLSKRIAVEAREGGGDPEKNPDLRMAIQKAKDNN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI +  G+ D   Y  I YEGYGP GVA+ ++ ++DNRNRTAS +R + ++ 
Sbjct: 61  MPKDNIQRAIDRGTGNLDGVEYERIIYEGYGPAGVALYLDLMSDNRNRTASELRHLLSQH 120

Query: 120 NGSLGSTGSTTRFFEQIGE-IIYHSNIG-DSNLAMEVAIESDAFEVLFEDQEYIFYCDFN 177
            G+LG  G     F++ G+ II  + +  D +  +  A+E+ A ++  E+Q      + +
Sbjct: 121 GGNLGEKGCVAWMFKRKGQLIIDRTEVEVDEDEVLMSALEAGAEDISIEEQMIEIIIEPS 180

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
            +    K +EE   E  S  V+  P N + + N  + + ++ +++ LED DDVQ VYSN 
Sbjct: 181 GLEDARKSMEEDGYEFSSGDVVMIPENTVDVDNKKEAQKVLDLMDELEDHDDVQEVYSNF 240

Query: 238 EIADDII 244
            I D+I+
Sbjct: 241 NIPDEIM 247


>gi|58337048|ref|YP_193633.1| hypothetical protein LBA0733 [Lactobacillus acidophilus NCFM]
 gi|227903611|ref|ZP_04021416.1| protein of hypothetical function DUF28 [Lactobacillus acidophilus
           ATCC 4796]
 gi|67461868|sp|Q5FL22|Y733_LACAC RecName: Full=UPF0082 protein LBA0733
 gi|58254365|gb|AAV42602.1| hypothetical protein LBA0733 [Lactobacillus acidophilus NCFM]
 gi|227868498|gb|EEJ75919.1| protein of hypothetical function DUF28 [Lactobacillus acidophilus
           ATCC 4796]
          Length = 242

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 149/243 (61%), Gaps = 15/243 (6%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI  RK  +DA + K+F KLSREI ++AK  G +P  NP LR+ I  A++ +
Sbjct: 1   MSGHSKWHNIQGRKNAQDAKRGKVFQKLSREIYMAAKSGGPDPDGNPALRMVIDKARSNN 60

Query: 61  MPKENIERAIKKA--GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MPK+NI+RAIKKA  GSD+  +Y  I YEGY P GVA+ +EALTDN+NRTAS +R  FT+
Sbjct: 61  MPKDNIQRAIKKAEGGSDE--HYDEITYEGYAPGGVAVFVEALTDNKNRTASDVRVAFTR 118

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSN---LAMEVAIESDAFEVLFEDQEYIFYCD 175
             GSLG+TGS    F++ G I+   +  D++   + ++V +++   ++   D  Y  Y D
Sbjct: 119 NGGSLGATGSVAYMFDRKGYIVIDRSTTDADEDQVLLDV-MDAGGDDLQTSDDAYEIYTD 177

Query: 176 ---FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQS 232
              F  V     K   K+ +A+   +   P N   +  ADK +    ++E LED DDVQ+
Sbjct: 178 PKQFAEVRDALIKAGYKLADAELTMI---PQNTTPVP-ADKKEQFEHLVEALEDSDDVQN 233

Query: 233 VYS 235
           VY+
Sbjct: 234 VYT 236


>gi|113866941|ref|YP_725430.1| hypothetical protein H16_A0916 [Ralstonia eutropha H16]
 gi|123329469|sp|Q0KD59|Y916_RALEH RecName: Full=UPF0082 protein H16_A0916
 gi|113525717|emb|CAJ92062.1| conserved hypothetical protein [Ralstonia eutropha H16]
          Length = 241

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 146/243 (60%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA + KI+++L +EITV+AKL G +   NPRLRL+I  A + +
Sbjct: 1   MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAAKLGGGDVDSNPRLRLSIDKAMDAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++  G  +  NY  IRYEGYG  G AII++ LTDNR RT + +R  F+K 
Sbjct: 61  MPKDNIQRAIQRGVGGMEGANYEEIRYEGYGLAGAAIIVDCLTDNRTRTVAEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ GS    F   G+ +Y     +  L ME A+E+ A +V+  D   I   C  N+
Sbjct: 121 GGNMGTEGSVAFMFTHCGQFLYAPGTPEDKL-MEAALEAGADDVVTNDDGSIEVTCPPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +A+   V+ KP N +  +  D  K + K+++ LE+ DDVQ V++N  
Sbjct: 180 FSAVKAALEAAGFKAEVADVVMKPQNEVSFAGDDAAK-MQKLLDALENLDDVQEVFTNAV 238

Query: 239 IAD 241
           I D
Sbjct: 239 IED 241


>gi|16079834|ref|NP_390660.1| hypothetical protein BSU27820 [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|221315046|ref|ZP_03596851.1| hypothetical protein BsubsN3_15117 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221319966|ref|ZP_03601260.1| hypothetical protein BsubsJ_15033 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|6226494|sp|P94447|YRBC_BACSU RecName: Full=UPF0082 protein yrbC
 gi|2635247|emb|CAB14742.1| conserved hypothetical protein [Bacillus subtilis subsp. subtilis
           str. 168]
 gi|6977799|emb|CAB75324.1| hypothetical protein [Bacillus subtilis subsp. subtilis str. 168]
          Length = 240

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 143/248 (57%), Gaps = 23/248 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + KIF KL++EI V+AK  G +P  N  LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGGADPEANSALRLVIEKAKGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI+RAIKK AG  D  +Y  I YEGYGP G+A+++E +TDN+NRTAS++R+ F K 
Sbjct: 61  MPNENIDRAIKKAAGGQDGSSYEEITYEGYGPSGIAVMVECVTDNKNRTASNVRTAFNKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEII---YHSNIGDSNLAM--------EVAIESDAFEVLFEDQ 168
            GSLG +G     FE+ G I        I +  L +        E+ IE D +EV  E +
Sbjct: 121 GGSLGESGCVAFLFERKGFITIDRTERQIEEDELMLDVLEAGGEELRIEEDLYEVFTEPE 180

Query: 169 EYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDD 228
            +    +     L SK L        S +V   P  Y   ++   V+ +  +I+ LEDDD
Sbjct: 181 HF----EEVKTALESKYL------ISSAEVTMLPNTYAE-ADDQAVEKLETLIDVLEDDD 229

Query: 229 DVQSVYSN 236
           DVQ VY+N
Sbjct: 230 DVQEVYTN 237


>gi|284051138|ref|ZP_06381348.1| hypothetical protein AplaP_06660 [Arthrospira platensis str.
           Paraca]
 gi|291569019|dbj|BAI91291.1| hypothetical protein [Arthrospira platensis NIES-39]
          Length = 254

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 153/247 (61%), Gaps = 8/247 (3%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  +K R DA+K K+F+K+SREI V+A+  G +P  N +LR AI+ AK   
Sbjct: 1   MAGHSKWANIKRQKARVDAVKGKVFTKISREIIVAAR-QGADPGGNFQLRTAIEKAKAAG 59

Query: 61  MPKENIERAIKKAGS--DDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           +P ENIERAI K      D     +IRYEGYG  GVA++IE LTDNRNRTA+ +RS FTK
Sbjct: 60  IPNENIERAIAKGSGTFSDGSQLESIRYEGYGIGGVAVLIEGLTDNRNRTAADLRSAFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDA--FEVL-FEDQEYI-FYC 174
             G+LG TG  +  FEQ G +     I +  L +E ++E +A  +E+   +D + +  + 
Sbjct: 120 NGGNLGETGCVSWMFEQKGVVTLAGPIDEEKL-LEASVEGEAESYELTPVDDTDGVEVFT 178

Query: 175 DFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVY 234
              N+   ++ L++        ++ W P N + + + +K +S++K++  L+D DDVQ+V 
Sbjct: 179 VAENLEHLNQVLDDFGFRVVEAELRWIPSNIVEVDDVEKARSLMKLMNALDDLDDVQNVT 238

Query: 235 SNLEIAD 241
           +N E++D
Sbjct: 239 ANFEMSD 245


>gi|222528822|ref|YP_002572704.1| hypothetical protein Athe_0816 [Caldicellulosiruptor bescii DSM
           6725]
 gi|254806618|sp|B9MQH7|Y816_ANATD RecName: Full=UPF0082 protein Athe_0816
 gi|222455669|gb|ACM59931.1| protein of unknown function DUF28 [Caldicellulosiruptor bescii DSM
           6725]
          Length = 243

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 142/240 (59%), Gaps = 3/240 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+KE+ DA K K+F+KL RE+ V AK+ G +P  NP+LR  I  AK  +
Sbjct: 1   MAGHSKWANIKHKKEKTDAQKGKLFTKLGRELMVVAKMYGPDPETNPKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I   IK+A G  D   Y +I YEGYGP GVA+I+EA+T+NRNRTA  +R IF K 
Sbjct: 61  MPMDKIMGFIKRAAGEIDTTGYEDITYEGYGPGGVAVIVEAMTNNRNRTAGELRHIFDKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYH-SNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
            G+LG TG  +  F + G I+    +  D +  ME A+E  A +   E+  Y       +
Sbjct: 121 GGNLGQTGCVSWMFSRKGVIVIEKESFPDEDFVMEKALEYGAEDFTSENGIYEIITSPED 180

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                + LE++       ++   P  Y++LS+ D  K + ++I+ LED+DDV+ VY N E
Sbjct: 181 FSKVREGLEKEGFTFIRAQIEMIPQTYVKLSSEDAQK-MRRLIDMLEDNDDVKEVYHNWE 239


>gi|296331673|ref|ZP_06874142.1| hypothetical protein BSU6633_11223 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305675368|ref|YP_003867040.1| hypothetical protein BSUW23_13470 [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|296151268|gb|EFG92148.1| hypothetical protein BSU6633_11223 [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305413612|gb|ADM38731.1| conserved hypothetical protein [Bacillus subtilis subsp. spizizenii
           str. W23]
          Length = 240

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 146/242 (60%), Gaps = 11/242 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + KIF KL++EI V+AK  G +P  N  LRL I+ AK  +
Sbjct: 1   MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGGADPEANSALRLVIEKAKGAN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI+RAIKK AGS D  +Y  I YEGYGP G+A+++E +TDN+NRTAS++R+ F K 
Sbjct: 61  MPNENIDRAIKKAAGSLDGSSYEEITYEGYGPSGIAVMVECVTDNKNRTASNVRTAFNKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEII---YHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            GSLG +G     FE+ G I        I +  L ++V +E+   E+  E+ +Y    + 
Sbjct: 121 GGSLGESGCVAFLFERKGFIAIDRTDRQIEEDELMLDV-LEAGGEELQTEEDQYEVLTEP 179

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNAD--KVKSIIKMIENLEDDDDVQSVY 234
           +        L+ K     S +V   P  Y   ++AD   V+ + K+I  LEDDDDVQ VY
Sbjct: 180 DRFEEVKTALKSKY-PISSAEVTMLPKTY---ADADDQAVEKLEKLISILEDDDDVQEVY 235

Query: 235 SN 236
           +N
Sbjct: 236 TN 237


>gi|261379116|ref|ZP_05983689.1| protein YebC [Neisseria cinerea ATCC 14685]
 gi|269144438|gb|EEZ70856.1| protein YebC [Neisseria cinerea ATCC 14685]
          Length = 242

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 143/238 (60%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R+DA + KIF++L +EITV+A++ G +P  NPRLRLA++ A   +
Sbjct: 1   MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G  Y  +RYEGYG  G A++++ LTDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVEYIELRYEGYGIGGAALMVDCLTDNKTRTVADVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ G     F   G +++   + D +  ME A+E+ A +V+  D   I      N+
Sbjct: 121 GGNLGTDGCVAFNFVHQGYLVFEPGV-DEDALMEAALEAGAEDVVANDDGSIEVITAPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
             +    LE    ++    V  +  N   LS  D VK + K+I+ LED DDVQ VY++
Sbjct: 180 WAVVKSTLEAAGYKSVDGDVTMRAQNETELSGDDAVK-MQKLIDALEDLDDVQDVYTS 236


>gi|160898960|ref|YP_001564542.1| hypothetical protein Daci_3521 [Delftia acidovorans SPH-1]
 gi|160364544|gb|ABX36157.1| protein of unknown function DUF28 [Delftia acidovorans SPH-1]
          Length = 239

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 98/246 (39%), Positives = 150/246 (60%), Gaps = 14/246 (5%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + K+++++ REI V+A+  G +   NPRLRLA++ AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDEKRGKVWTRIIREIMVAARTGGGDLSANPRLRLAVEKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP +NI+R I KA  +  G  Y  IRYEGYG  G AII++ +TDNR RT + +R  F+K 
Sbjct: 61  MPADNIKRNIDKATGNLEGVTYEEIRYEGYGIGGAAIIVDTMTDNRVRTVADVRHAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI----FYCD 175
            G++G+ GS +  F+ +G++I+     D +  MEVA+E+ A +V+ +D+  I       +
Sbjct: 121 GGNMGTEGSVSFQFKHVGQLIFAPG-SDEDQIMEVALEAGAEDVITDDEGAIEVLTAPAE 179

Query: 176 FNNV--GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSV 233
           F  V   L +K L  ++ E     V  +P N I L   D  + + K+++ +ED DDVQ V
Sbjct: 180 FETVRDALQAKGLTPEVAE-----VTMRPENTIALQGDDAAR-MQKLLDMIEDLDDVQDV 233

Query: 234 YSNLEI 239
           Y N E+
Sbjct: 234 YHNAEL 239


>gi|255065724|ref|ZP_05317579.1| protein YebC [Neisseria sicca ATCC 29256]
 gi|255050042|gb|EET45506.1| protein YebC [Neisseria sicca ATCC 29256]
          Length = 242

 Score =  171 bits (433), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 143/238 (60%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R+DA + KIF++L +EITV+A++ G +P  NPRLRLA++ A   +
Sbjct: 1   MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G  Y  +RYEGYG  G A++++ LTDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVEYIELRYEGYGIGGAALMVDCLTDNKTRTVADVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ G     F   G +++   + D ++ ME A+E+ A +V+  D   I      N 
Sbjct: 121 GGNLGTDGCVAFNFVHQGYLVFEPGV-DEDVLMEAALEAGAEDVIANDDGSIEVITAPND 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
               K   E  G ++    V  +  N   LS  D VK + K+I+ LED DDVQ VY++
Sbjct: 180 WAGVKAALEAAGYKSVDGDVTMRAQNETELSGEDAVK-MQKLIDALEDLDDVQDVYTS 236


>gi|221310721|ref|ZP_03592568.1| hypothetical protein Bsubs1_15211 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221324247|ref|ZP_03605541.1| hypothetical protein BsubsS_15177 [Bacillus subtilis subsp.
           subtilis str. SMY]
          Length = 260

 Score =  171 bits (433), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 143/248 (57%), Gaps = 23/248 (9%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + KIF KL++EI V+AK  G +P  N  LRL I+ AK  +
Sbjct: 21  MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGGADPEANSALRLVIEKAKGAN 80

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI+RAIKK AG  D  +Y  I YEGYGP G+A+++E +TDN+NRTAS++R+ F K 
Sbjct: 81  MPNENIDRAIKKAAGGQDGSSYEEITYEGYGPSGIAVMVECVTDNKNRTASNVRTAFNKN 140

Query: 120 NGSLGSTGSTTRFFEQIGEII---YHSNIGDSNLAM--------EVAIESDAFEVLFEDQ 168
            GSLG +G     FE+ G I        I +  L +        E+ IE D +EV  E +
Sbjct: 141 GGSLGESGCVAFLFERKGFITIDRTERQIEEDELMLDVLEAGGEELRIEEDLYEVFTEPE 200

Query: 169 EYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDD 228
            +    +     L SK L        S +V   P  Y   ++   V+ +  +I+ LEDDD
Sbjct: 201 HF----EEVKTALESKYL------ISSAEVTMLPNTYAE-ADDQAVEKLETLIDVLEDDD 249

Query: 229 DVQSVYSN 236
           DVQ VY+N
Sbjct: 250 DVQEVYTN 257


>gi|319762839|ref|YP_004126776.1| hypothetical protein Alide_2149 [Alicycliphilus denitrificans BC]
 gi|330824918|ref|YP_004388221.1| hypothetical protein Alide2_2338 [Alicycliphilus denitrificans
           K601]
 gi|317117400|gb|ADU99888.1| protein of unknown function DUF28 [Alicycliphilus denitrificans BC]
 gi|329310290|gb|AEB84705.1| UPF0082 protein yeeN [Alicycliphilus denitrificans K601]
          Length = 239

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 99/244 (40%), Positives = 148/244 (60%), Gaps = 10/244 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  + KI++++ REITV+A+  G +P  NPRLRLAI  AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDEKRGKIWTRIIREITVAARQGGGDPAANPRLRLAIDKAKAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+  I KA G+ +  NY  IRYEGYG  G AII++ +TDNR RT + +R  F+K 
Sbjct: 61  MPADRIKYNIDKASGTLEGINYEEIRYEGYGIGGAAIIVDTMTDNRVRTVAEVRHAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC----D 175
            G++G+ GS    F+  G++I+     +  + MEVA+E+ A +V+ +D   I       D
Sbjct: 121 GGNMGTEGSVAFQFKHAGQLIFAPGTSEDKV-MEVALEAGAEDVVTDDDGAIEVLTAPGD 179

Query: 176 FNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           F  V      LE +  +A+  +V  +P N + L   D  + + K+++ +ED DDVQ VY 
Sbjct: 180 FEAV---KNALEARGLKAEVAEVTMRPENTVALEGDDAAR-MQKLLDVIEDLDDVQEVYH 235

Query: 236 NLEI 239
           N E+
Sbjct: 236 NAEL 239


>gi|237747752|ref|ZP_04578232.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
 gi|229379114|gb|EEO29205.1| conserved hypothetical protein [Oxalobacter formigenes OXCC13]
          Length = 243

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 147/241 (60%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++ NI H+K   DA + KI+++L +EITV+A++ G +   NPRLRLA + A   +
Sbjct: 1   MSGHSKWANIKHKKAATDAKRGKIWTRLIKEITVAARMGGGDINSNPRLRLAAEKATAAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPKEN++RAI +  G+ D  NY  IRYEGYG  G AII++ LTDNR RT S +R  F+K 
Sbjct: 61  MPKENVQRAIARGTGTLDGVNYEEIRYEGYGINGAAIIVDCLTDNRVRTVSEVRHAFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQ-EYIFYCDFNN 178
            G++G+ GS +  F+  G++ +     +  L MEVA+E+ A +++ +D+  +   C  N+
Sbjct: 121 GGNMGTEGSVSFMFKHCGQLFFAPGTDEDKL-MEVALEAGAEDIISDDEGGFEVICAPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE+     +  +++ KP      +  D  K + K+++ LE+ DDVQ VY+N  
Sbjct: 180 FAQVKDALEKAGFIPEMAEIVMKPDTETEFTGTDAEK-MQKLLDALENLDDVQDVYTNAV 238

Query: 239 I 239
           I
Sbjct: 239 I 239


>gi|258512081|ref|YP_003185515.1| hypothetical protein Aaci_2117 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
 gi|257478807|gb|ACV59126.1| protein of unknown function DUF28 [Alicyclobacillus acidocaldarius
           subsp. acidocaldarius DSM 446]
          Length = 247

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 90/239 (37%), Positives = 148/239 (61%), Gaps = 2/239 (0%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK ++DA++ ++F+KLS++I  +A+  G NP  N RLR+AI+ A+  +
Sbjct: 1   MAGHSKWHNIQRRKGKQDAIRGQLFTKLSKDIYQAAREGGGNPETNFRLRVAIERARANN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P ENI+R I KA G  +   Y  + YEGYGP GVA+++E LTDNRNRTA+ +R +F K 
Sbjct: 61  LPMENIQRTIAKATGQLEGATYEELLYEGYGPHGVALLLEILTDNRNRTAAEVRHLFRKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+L  +G+    F++ GEI+   +  D++  M VA+E+ A +V+   + Y+     +N 
Sbjct: 121 GGNLAESGAVAWMFQRFGEIVVPKDKVDADDLMMVALEAGAEDVIERSRTYVVKTTPDNF 180

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                 LEEK    +   + ++    + L   + ++ +  ++E LE  DDVQ+V++NL+
Sbjct: 181 RAVRMSLEEKGIPYEEASLTYEASTKMDLPE-EALEQVYDLVEALESLDDVQTVFTNLD 238


>gi|237809453|ref|YP_002893893.1| hypothetical protein Tola_2714 [Tolumonas auensis DSM 9187]
 gi|259646892|sp|C4LBN3|Y2714_TOLAT RecName: Full=UPF0082 protein Tola_2714
 gi|237501714|gb|ACQ94307.1| protein of unknown function DUF28 [Tolumonas auensis DSM 9187]
          Length = 247

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 98/245 (40%), Positives = 146/245 (59%), Gaps = 5/245 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + K+F+K+ REIT +A+L G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAKRGKMFTKMIREITTAARLGGPDGGSNPRLRAAVAAALSIN 60

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ ++RAIK+ AG DD      + YEGYGP G A+++E +TDNRNRT + +R  F+K+
Sbjct: 61  MTRDTVDRAIKRGAGGDDGVELETLVYEGYGPSGTAVMVECMTDNRNRTVAGVRHAFSKS 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G+LG+ GS    F + G + + S   D +  ME A+E+ A +V   D   I  Y   N+
Sbjct: 121 GGALGTDGSVAYLFTKKGILSFTS--ADEDALMEAALEAGADDVETNDDGSIDVYTSPND 178

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
            G     LE    +  +  V   P   + L NAD    ++++I+ LED DDVQ VY N  
Sbjct: 179 FGTVLDALEAAGFKPDNANVSMIPSTEVDL-NADDAPKLLRLIDMLEDLDDVQEVYHNGT 237

Query: 239 IADDI 243
           I+D++
Sbjct: 238 ISDEV 242


>gi|194288988|ref|YP_002004895.1| hypothetical protein RALTA_A0859 [Cupriavidus taiwanensis LMG
           19424]
 gi|226695990|sp|B3R3E4|Y859_CUPTR RecName: Full=UPF0082 protein RALTA_A0859
 gi|193222823|emb|CAQ68826.1| conserved hypothetical protein, DUF28 [Cupriavidus taiwanensis LMG
           19424]
          Length = 241

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 99/243 (40%), Positives = 147/243 (60%), Gaps = 4/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA + KI+++L +EITV+AKL G +P  NPRLRL++  A + +
Sbjct: 1   MAGHSKWANIKHKKAAADAKRGKIWTRLIKEITVAAKLGGGDPDSNPRLRLSMDKAMDAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NI+RAI++  G  +  NY  IRYEGYG  G AII++ LTDNR RT + +R  F+K 
Sbjct: 61  MPKDNIQRAIQRGVGGLEGVNYEEIRYEGYGLSGAAIIVDCLTDNRTRTVAEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ GS    F   G+ ++     +  L M+ A+E+ A +V+  D   I   C  N+
Sbjct: 121 GGNMGTEGSVAFMFTHCGQFLFAPGTPEDKL-MDAALEAGADDVVTNDDGSIEVTCPPND 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +A+   V+ KP N +  S  D  K + K+++ LE+ DDVQ V++N  
Sbjct: 180 FSAVKAALEGAGFKAEVADVVMKPQNEVSFSGDDAAK-MQKLLDALENLDDVQEVFTNAV 238

Query: 239 IAD 241
           I D
Sbjct: 239 IED 241


>gi|52841517|ref|YP_095316.1| hypothetical protein lpg1286 [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|67462033|sp|Q5ZW02|Y1286_LEGPH RecName: Full=UPF0082 protein lpg1286
 gi|52628628|gb|AAU27369.1| YebC [Legionella pneumophila subsp. pneumophila str. Philadelphia
           1]
          Length = 247

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 148/245 (60%), Gaps = 3/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI  RK  +DA + KIF+KL REITV+A++ G +   NPRLR A++ A N +
Sbjct: 1   MAGHSKWANIKFRKGVQDAKRGKIFTKLIREITVAARMGGGDESSNPRLRDAVKKALNAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ I+ A+K+  G  D      +RYEGYGP GVAI+++ L+DN+NRT S +R  F+K 
Sbjct: 61  MKRDTIDNAVKRGVGGVDGEAMIAMRYEGYGPGGVAILVDCLSDNKNRTVSEVRHAFSKH 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F   GEI+  SN  +  + ME+AI++ A +V  ED +          
Sbjct: 121 GGNLGTDGSVSYLFTNQGEILMASNQPEDKV-MEIAIDAGASDVAVEDGQIEIITPVEAY 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 L++   E +   +  +    + + N +  +S+IK+I+ LED DDVQ VYSN E 
Sbjct: 180 HTVLNALQDAGLEVEQSHLTMRAQTLVPI-NDETAESLIKLIDMLEDLDDVQEVYSNAEF 238

Query: 240 ADDII 244
           ++ I+
Sbjct: 239 SEKIL 243


>gi|291485194|dbj|BAI86269.1| hypothetical protein BSNT_04039 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 260

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 102/240 (42%), Positives = 143/240 (59%), Gaps = 7/240 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++KNI  RK  +DA + KIF KL++EI V+AK  G +P  N  LRL I+ AK  +
Sbjct: 21  MAGHSKWKNIQKRKNAQDAKRGKIFMKLAKEIYVAAKEGGADPEANSALRLVIEKAKGAN 80

Query: 61  MPKENIERAIKK-AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP ENI+RAIKK AG  D  +Y  I YEGYGP G+A+++E +TDN+NRTAS++R+ F K 
Sbjct: 81  MPNENIDRAIKKAAGGQDGSSYEEITYEGYGPSGIAVMVECVTDNKNRTASNVRTAFNKN 140

Query: 120 NGSLGSTGSTTRFFEQIGEII---YHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDF 176
            GSLG +G     FE+ G I        I +  L ++V +E+   E+  E+  Y  + + 
Sbjct: 141 GGSLGESGCVAFLFERKGFITIDRTERQIEEDELMLDV-LEAGGEELRIEENLYEVFTEP 199

Query: 177 NNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
            +       LE K     S +V   P  Y   ++   V+ +  +I+ LEDDDDVQ VY+N
Sbjct: 200 EHFEEVKTALESKY-LISSAEVTMLPNTYAE-ADDQAVEKLETLIDVLEDDDDVQEVYTN 257


>gi|241759107|ref|ZP_04757217.1| conserved hypothetical protein [Neisseria flavescens SK114]
 gi|241320634|gb|EER56898.1| conserved hypothetical protein [Neisseria flavescens SK114]
          Length = 242

 Score =  171 bits (433), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 142/238 (59%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R+DA + KIF++L +EITV+A++ G +P  NPRLRLA++ A   +
Sbjct: 1   MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G  Y  +RYEGYG  G A++++ LTDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVEYIELRYEGYGIGGAALMVDCLTDNKTRTVADVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ G     F   G +++   + D +  ME A+E+ A +V+  D   I      N 
Sbjct: 121 GGNLGTDGCVAFNFVHQGYLVFEPGV-DEDALMEAALEAGAEDVITNDDGSIEVITAPND 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
               K   E  G ++    V  +  N   LS  D VK + K+I+ LED DDVQ VY++
Sbjct: 180 WAAVKSALEAAGYKSVDGDVTMRAQNETELSGEDAVK-MQKLIDALEDLDDVQDVYTS 236


>gi|163816715|ref|ZP_02208078.1| hypothetical protein COPEUT_02905 [Coprococcus eutactus ATCC 27759]
 gi|158447972|gb|EDP24967.1| hypothetical protein COPEUT_02905 [Coprococcus eutactus ATCC 27759]
          Length = 248

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 96/254 (37%), Positives = 150/254 (59%), Gaps = 21/254 (8%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + +EI V+ K  G NP  N +LR  I  AK  +
Sbjct: 1   MSGHSKFANIKHKKEKNDAAKGKIFTIIGKEIVVAVKEGGANPENNSKLRDVIAKAKANN 60

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MP + I+R I++A  D +  NY    YEGYGP G AII++ LTDN+NRTA+++R+ FTK 
Sbjct: 61  MPNDTIKRGIERAAGDANSVNYVVNTYEGYGPSGTAIIVDTLTDNKNRTAANVRNCFTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEII-----------YHSNIGDSNLAMEVAIESDAFEVLFEDQ 168
            G++G+TG  +  F+  G+II               +     A + + E D++E++   +
Sbjct: 121 GGNVGTTGCVSYMFDHKGQIIIAKEDCDMDADDLMMMALDAGAEDFSDEDDSYEIITAPE 180

Query: 169 EYIFYCDFNNVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDD 228
                 DF+ V  + +K   K+ EA+   +   P NY+ +++ + VK   ++I+ LE+DD
Sbjct: 181 ------DFSQVRESLEKEGIKMAEAELTMI---PQNYVDITDPEVVKKFTRIIDMLEEDD 231

Query: 229 DVQSVYSNLEIADD 242
           DVQ+VY N  + D+
Sbjct: 232 DVQAVYHNANLPDE 245


>gi|237654505|ref|YP_002890819.1| hypothetical protein Tmz1t_3853 [Thauera sp. MZ1T]
 gi|237625752|gb|ACR02442.1| protein of unknown function DUF28 [Thauera sp. MZ1T]
          Length = 241

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 146/241 (60%), Gaps = 4/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK R+D  +   FSKL++EITV+AK+ G +P  NPRLRLA+  AK  +
Sbjct: 1   MAGHSKWANIQHRKGRQDEKRGAAFSKLAKEITVAAKMGGGDPGFNPRLRLAVDKAKGVN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+ I+ AIKK   +  G +Y  IRYEGYG  G A++++ LTDN+ RT + +R  F+K 
Sbjct: 61  MPKDKIDNAIKKGTGELEGVSYEEIRYEGYGIGGSAVMVDCLTDNKTRTVADVRHAFSKY 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G+ G  +  F+  G++++     +  L ME A+E+ A +V+  D   I        
Sbjct: 121 GGNMGTDGCVSFQFKHCGQLLFAPGTSEDAL-MEAALEAGAEDVVTNDDGSIEVITGPWE 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
             T K+  EK G  A+  +V  KP N I L+  D+   + K+++ LE  DDVQ VY++ E
Sbjct: 180 FTTIKEALEKAGFTAEFGEVTMKPENVIELAG-DEAARMQKLLDALEGLDDVQEVYTSAE 238

Query: 239 I 239
            
Sbjct: 239 F 239


>gi|238898056|ref|YP_002923737.1| hypothetical protein HDEF_0869 [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|259710166|sp|C4K4U6|Y869_HAMD5 RecName: Full=UPF0082 protein HDEF_0869
 gi|229465815|gb|ACQ67589.1| conserved hypothetical protein [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 254

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 143/245 (58%), Gaps = 4/245 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ N  HRK  +DA K KIF+K+ RE+  SA+L G +P  NPRLR AI  A + +
Sbjct: 1   MAGHSKWANTKHRKAAQDAKKGKIFTKIIRELVTSARLGGGDPASNPRLRTAIDKALSHN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M ++ + RAI +  G  +  +  NI YEGYGP G A+++  L+DNRNRT S +R  FTK 
Sbjct: 61  MTRDTLNRAIARGIGGGEDSHMENILYEGYGPAGTAVMVSCLSDNRNRTVSEVRHAFTKT 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ GS +  F + G   Y   + +  + ME+A+ES A +++  D   I        
Sbjct: 121 GGNLGTGGSVSYLFTKKGVFSYAPGLNEDQV-MELALESGADDIMVYDDGAIDIFSSPEF 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
             T KK  E  G  A + ++   P   I L N +  + ++++I+ LED DDVQ VY N +
Sbjct: 180 FETIKKTLETAGLMASTAEISMIPSTKIDL-NLENAQRLLRLIDMLEDSDDVQEVYHNGD 238

Query: 239 IADDI 243
            +D+I
Sbjct: 239 FSDEI 243


>gi|198282208|ref|YP_002218529.1| hypothetical protein Lferr_0060 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218666356|ref|YP_002424573.1| hypothetical protein AFE_0059 [Acidithiobacillus ferrooxidans ATCC
           23270]
 gi|226734030|sp|B7J3G0|Y059_ACIF2 RecName: Full=UPF0082 protein AFE_0059
 gi|226734031|sp|B5EJL6|Y060_ACIF5 RecName: Full=UPF0082 protein Lferr_0060
 gi|198246729|gb|ACH82322.1| protein of unknown function DUF28 [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218518569|gb|ACK79155.1| conserved hypothetical protein [Acidithiobacillus ferrooxidans ATCC
           23270]
          Length = 250

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 155/243 (63%), Gaps = 3/243 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K  KDA + KIF++L REITV+A+  G +P  N RLRLA+  A   +
Sbjct: 1   MSGHSKWSTIKFKKALKDAKRGKIFTRLIREITVAARAGGGDPASNSRLRLALDKAYGAN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           M K+ IERAIK+   +  G +Y  + YEGYGP GVAI+IE +TDN+ RT + +R IF+K 
Sbjct: 61  MTKDTIERAIKRGTGELEGVDYEEVTYEGYGPGGVAILIETMTDNKVRTVAEVRHIFSKR 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G++G+ GS    F+++G I++ ++  D +  +E A+E+ A +V+ E +    Y   +++
Sbjct: 121 GGNMGTAGSVAYQFKKLGLIVFPAD-ADEDRILEAALEAGAEDVVNEGERIAVYTAPSDL 179

Query: 180 GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLEI 239
                 LE    + +  ++   P N I +S  ++ + ++++I+ LE++DDVQ+VY+N +I
Sbjct: 180 HSVVLALEAAGLKPEESEMTMIPENTIEVSG-EEAEKLLRLIDFLEENDDVQNVYANYDI 238

Query: 240 ADD 242
           +D+
Sbjct: 239 SDE 241


>gi|294056004|ref|YP_003549662.1| protein of unknown function DUF28 [Coraliomargarita akajimensis DSM
           45221]
 gi|293615337|gb|ADE55492.1| protein of unknown function DUF28 [Coraliomargarita akajimensis DSM
           45221]
          Length = 249

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 92/246 (37%), Positives = 148/246 (60%), Gaps = 3/246 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I   K   DA + K+FS LS++IT++A+  G +P  NPRLR  I  AK  +
Sbjct: 1   MSGHSKWATIKRAKGAADAKRGKLFSVLSKDITLAARSGGGDPGFNPRLRTCILKAKAAN 60

Query: 61  MPKENIERAIKKAGSDDLGN--YTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           MP +NI+RAIKK G+ +L    Y  + YEGYG  GV +I+E  TDN+NR+AS +RS   K
Sbjct: 61  MPADNIDRAIKK-GTGELPGVVYEEVLYEGYGAGGVGVIVEITTDNKNRSASEVRSTMGK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNN 178
             G+L   G+    F++ G+ I  ++  D    M+VA+E+ A +++  D  +   C    
Sbjct: 120 NGGNLAGVGAVAFQFDRKGQFIIEASQTDEESLMDVALEAGAEDIVTADDHFEVICPMTE 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
               S+ LEEK  E  S ++ + P   + +S+ D  + ++ ++E L+D +DV++V+ N+E
Sbjct: 180 YDSVSQALEEKGIETLSSELAYIPNIEVPVSDKDTARKVLHLVEKLDDLEDVKAVHHNME 239

Query: 239 IADDII 244
           IAD ++
Sbjct: 240 IADGLL 245


>gi|225077141|ref|ZP_03720340.1| hypothetical protein NEIFLAOT_02196 [Neisseria flavescens
           NRL30031/H210]
 gi|224951489|gb|EEG32698.1| hypothetical protein NEIFLAOT_02196 [Neisseria flavescens
           NRL30031/H210]
          Length = 242

 Score =  171 bits (433), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 142/238 (59%), Gaps = 4/238 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K R+DA + KIF++L +EITV+A++ G +P  NPRLRLA++ A   +
Sbjct: 1   MAGHSKWANIQHKKARQDAKRGKIFTRLIKEITVAARMGGGDPGANPRLRLALEKAAENN 60

Query: 61  MPKENIERAIKKAGSDDLG-NYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI K   +  G  Y  +RYEGYG  G A++++ LTDN+ RT + +R  FTK 
Sbjct: 61  MPKDNVQRAIDKGTGNLEGVEYIELRYEGYGIGGAALMVDCLTDNKTRTVADVRHAFTKN 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYCDFNNV 179
            G+LG+ G     F   G +++   + D +  ME A+E+ A +V+  D   I      N 
Sbjct: 121 GGNLGTDGCVAFNFVHQGYLVFEPGV-DEDALMEAALEAGAEDVITNDDGSIEVVTAPND 179

Query: 180 GLTSKKLEEKIG-EAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSN 236
               K   E  G ++    V  +  N   LS  D VK + K+I+ LED DDVQ VY++
Sbjct: 180 WAGVKSALEAAGYKSVDGDVTMRTQNETELSGEDAVK-MQKLIDALEDLDDVQDVYTS 236


>gi|167855801|ref|ZP_02478554.1| hypothetical protein HPS_03174 [Haemophilus parasuis 29755]
 gi|167853080|gb|EDS24341.1| hypothetical protein HPS_03174 [Haemophilus parasuis 29755]
          Length = 246

 Score =  171 bits (432), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 145/246 (58%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AKL G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKLGGGDTSSNPRLRAAVDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI +   G DD    T + YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIDRGVGGGDDTNMETKV-YEGYGPGGTAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFN 177
             G+LG+ GS    F + G I+  S   D +   E AIE+ A ++   ED  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILIAS--ADEDALTEAAIEAGADDIQPQEDSSFEIYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++G     +E    + ++ +V   P   ++L +A+    ++ +I  LED DDVQ+VY N 
Sbjct: 178 DLGAVRDGIEAAGFKVENAEVTMIPSTTVQL-DAETAPKLLDLINRLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D++
Sbjct: 237 EISDEV 242


>gi|134296478|ref|YP_001120213.1| hypothetical protein Bcep1808_2379 [Burkholderia vietnamiensis G4]
 gi|166228573|sp|A4JGH5|Y2379_BURVG RecName: Full=UPF0082 protein Bcep1808_2379
 gi|134139635|gb|ABO55378.1| protein of unknown function DUF28 [Burkholderia vietnamiensis G4]
          Length = 242

 Score =  171 bits (432), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 146/244 (59%), Gaps = 4/244 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI H+K   DA + KI+++L +EI V+A+L G +   NPRLRLA+  A + +
Sbjct: 1   MAGHSKWANIKHKKAAADAKRGKIWTRLIKEIQVAARLGGGDASSNPRLRLAVDKAADAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+N++RAI +  G  D  NY  IRYEGYG  G AII++ LTDNR RT + +R  F+K 
Sbjct: 61  MPKDNVKRAIDRGVGGADGANYEEIRYEGYGINGAAIIVDTLTDNRTRTVAEVRHAFSKF 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYI-FYCDFNN 178
            G++G+ GS    F+ +G+ ++     +  L ME A+E+ A +V   D   I   CD+  
Sbjct: 121 GGNMGTDGSVAFMFDHVGQFLFAPGTSEDAL-MEAALEAGADDVSTNDDGSIEVLCDWQA 179

Query: 179 VGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNLE 238
                  LE    +A+  +V  KP N +  +  D  K + K+++ LE+ DDVQ VY+N  
Sbjct: 180 FSAVKDALEAAGFKAELAEVTMKPQNEVEFTGDDAAK-MQKLLDALENLDDVQEVYTNAV 238

Query: 239 IADD 242
           I ++
Sbjct: 239 IVEE 242


>gi|32033872|ref|ZP_00134143.1| COG0217: Uncharacterized conserved protein [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126208621|ref|YP_001053846.1| hypothetical protein APL_1151 [Actinobacillus pleuropneumoniae L20]
 gi|190150479|ref|YP_001969004.1| hypothetical protein APP7_1210 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|303250099|ref|ZP_07336301.1| hypothetical protein APP6_1511 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|303253273|ref|ZP_07339422.1| hypothetical protein APP2_0580 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|307248174|ref|ZP_07530202.1| hypothetical protein appser2_11550 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|307250407|ref|ZP_07532354.1| hypothetical protein appser4_11880 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|307252789|ref|ZP_07534680.1| hypothetical protein appser6_13030 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|307257205|ref|ZP_07538977.1| hypothetical protein appser10_12050 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307261633|ref|ZP_07543301.1| hypothetical protein appser12_11940 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|307263823|ref|ZP_07545428.1| hypothetical protein appser13_12330 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|166228895|sp|A3N1F5|Y1151_ACTP2 RecName: Full=UPF0082 protein APL_1151
 gi|226696275|sp|B3GY39|Y1210_ACTP7 RecName: Full=UPF0082 protein APP7_1210
 gi|126097413|gb|ABN74241.1| hypothetical protein APL_1151 [Actinobacillus pleuropneumoniae
           serovar 5b str. L20]
 gi|189915610|gb|ACE61862.1| hypothetical protein APP7_1210 [Actinobacillus pleuropneumoniae
           serovar 7 str. AP76]
 gi|302647955|gb|EFL78162.1| hypothetical protein APP2_0580 [Actinobacillus pleuropneumoniae
           serovar 2 str. 4226]
 gi|302651162|gb|EFL81316.1| hypothetical protein APP6_1511 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306855351|gb|EFM87526.1| hypothetical protein appser2_11550 [Actinobacillus pleuropneumoniae
           serovar 2 str. S1536]
 gi|306857536|gb|EFM89645.1| hypothetical protein appser4_11880 [Actinobacillus pleuropneumoniae
           serovar 4 str. M62]
 gi|306859821|gb|EFM91843.1| hypothetical protein appser6_13030 [Actinobacillus pleuropneumoniae
           serovar 6 str. Femo]
 gi|306864367|gb|EFM96278.1| hypothetical protein appser10_12050 [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306868756|gb|EFN00565.1| hypothetical protein appser12_11940 [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306870812|gb|EFN02551.1| hypothetical protein appser13_12330 [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 246

 Score =  171 bits (432), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 145/246 (58%), Gaps = 7/246 (2%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           MAGHS++ NI HRK  +DA + KIF+KL RE+  +AK+ G +   NPRLR A+  A + +
Sbjct: 1   MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSANPRLRSAVDKALSNN 60

Query: 61  MPKENIERAIKK--AGSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTK 118
           M ++ I RAI++   G DD    T I YEGYGP G A+++E L+DN NRT S +R  FTK
Sbjct: 61  MTRDTINRAIERGVGGGDDTNMETKI-YEGYGPGGTAVMVECLSDNANRTISQVRPSFTK 119

Query: 119 ANGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLF-EDQEYIFYCDFN 177
             G+LG+ GS    F + G I+  S  GD +   E AIE+ A ++   ED  +  Y  + 
Sbjct: 120 CGGNLGTEGSVGYLFSKKGLILIAS--GDEDALTEAAIEAGADDIQPQEDGSFEIYTAWE 177

Query: 178 NVGLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYSNL 237
           ++G     +E    + Q  +V   P   + L +A+    ++ +I  LED DDVQ+VY N 
Sbjct: 178 DLGSVRDGIEAAGFKIQEAEVTMIPSTTVEL-DAETAPKLLDLINRLEDCDDVQNVYHNG 236

Query: 238 EIADDI 243
           EI+D++
Sbjct: 237 EISDEV 242


>gi|224532315|ref|ZP_03672947.1| conserved hypothetical protein [Borrelia valaisiana VS116]
 gi|224511780|gb|EEF82186.1| conserved hypothetical protein [Borrelia valaisiana VS116]
          Length = 243

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 151/248 (60%), Gaps = 11/248 (4%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS++  I  +K   DA ++K+F+KL REIT++AK+ G +   NPRLR+A+  AK  +
Sbjct: 1   MSGHSKWSTIKRKKGALDAKRNKLFTKLIREITIAAKIGGGDIESNPRLRVAVNKAKVAN 60

Query: 61  MPKENIERAIKKA-GSDDLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           MPK+NIE+AIKK  G ++   Y  I YE Y P GVA++I  LTDN+NRT+S ++S+ TK 
Sbjct: 61  MPKDNIEKAIKKGIGGNEGVEYFEITYEAYAPYGVALMINCLTDNKNRTSSDVKSVLTKG 120

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSNIGDSNLAMEVAIESDAFEVLFEDQEYIFYC---DF 176
            GSLG+ GS +  F + G I+Y+      +  ME A+E  A ++L  + E        DF
Sbjct: 121 GGSLGTPGSVSYMFYRKGLIVYNLEKYLEDEIMEFALEVGAEDILVSNNEAEVITSPDDF 180

Query: 177 NNV-GLTSKKLEEKIGEAQSIKVIWKPLNYIRLSNADKVKSIIKMIENLEDDDDVQSVYS 235
           + V      K +E++ E   I     P N I L N ++ + II ++E LED DDVQ V  
Sbjct: 181 DKVLSFLKTKFKEEMAEIALI-----PENKIFL-NKEQAEKIILLVEKLEDFDDVQEVIH 234

Query: 236 NLEIADDI 243
           NLEI +++
Sbjct: 235 NLEIPEEL 242


>gi|315651757|ref|ZP_07904762.1| glucose-1-phosphate adenylyltransferase [Eubacterium saburreum DSM
           3986]
 gi|315486012|gb|EFU76389.1| glucose-1-phosphate adenylyltransferase [Eubacterium saburreum DSM
           3986]
          Length = 253

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 146/241 (60%), Gaps = 3/241 (1%)

Query: 1   MAGHSQFKNIMHRKERKDALKSKIFSKLSREITVSAKLSGQNPLENPRLRLAIQNAKNQS 60
           M+GHS+F NI H+KE+ DA K KIF+ + REI V+ K  G +P  N +LR  I  AK  +
Sbjct: 12  MSGHSKFANIKHKKEKNDAAKGKIFTVIGREIAVAVKEGGPDPNNNSKLRDVIAKAKANN 71

Query: 61  MPKENIERAIKKAGSD-DLGNYTNIRYEGYGPEGVAIIIEALTDNRNRTASSIRSIFTKA 119
           +P + IER IKKA  D +  NY    YEGYGP GVAII+E LTDN+NRTA+++R+ FTK 
Sbjct: 72  VPNDTIERGIKKAAGDINSVNYEQNTYEGYGPNGVAIIVETLTDNKNRTAANVRAAFTKG 131

Query: 120 NGSLGSTGSTTRFFEQIGEIIYHSN