>cd05776 DNA_polB_alpha_exo The 3'-5' exonuclease domain of eukaryotic DNA polymerase alpha. DNA polymerase alpha is a family-B DNA polymerase with a catalytic subunit that contains a DnaQ-like 3'-5' exonuclease domain. It is one of the three DNA-dependent type B DNA polymerases (delta and epsilon are the other two) that have been identified as essential for nuclear DNA replication in eukaryotes. DNA polymerase alpha is almost exclusively required for the initiation of DNA replication and the priming of Okazaki fragments during elongation. It associates with DNA primase and is the only enzyme able to start DNA synthesis de novo. The catalytic subunit contains both polymerase and 3'-5' exonuclease domains, but only exhibits polymerase activity. The 3'-5' exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, without the four conserved acidic residues that are crucial for metal binding and catalysis. This explains why in most organisms, that no specific repair r

Probab=97.46 E-value=0.0044 Score=38.59 Aligned_cols=110 Identities=9% Similarity=-0.085 Sum_probs=67.9 Q ss_pred CEEEEECCCCCCCCC--CCEEEEEEEEEECCCCEE-----CC---EEEEEEECCCCCCCCCHHHHHHHCCCHHHHHHCCC Q ss_conf 379997527889877--260489999998389728-----04---00226621788877857898985799889960799 Q gi|254780661|r 4 HFVIYDYETFGRDVA--LDRPAQFAGVRVDRQWEK-----IE---STEVFFCKPADDYLPDPEAVFITGITPQKALRDGV 73 (471) Q Consensus 4 ~~v~~D~ETtG~~~~--~~~iiq~~~i~~d~~~~~-----~~---~~~~~~~~~~~~~~p~p~a~~v~git~~~~~~~~~ 73 (471) T Consensus 4 tv~Sisi~T~-~n~k~~~~EI~~iS~~~~-~~~~~d~~~~~~~~~~~~~~~~r~~~~~~p~~~~~~~~~~~~~~v~~f~- 80 (234) T cd05776 4 TVMSLSIKTV-LNSKTNKNEIVMISMLVH-RNVSLDKPTPPPPFQSHTCTLTRPLGRSPPPDLFEKNAKKKKTKVRIFE- 80 (234) T ss_pred EEEEEEEEEE-ECCCCCCCEEEEEEEEEE-CCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCHHHHHHHCCCCCEEECC- T ss_conf 8999998997-168888543889885141-6847789999754566089998489987997569999862698489848- Q ss_pred CHHHHHHHHHHHHHCCCC-EEEEEECHHHHHHHHHHHHHHHCCC Q ss_conf 979999999999511796-5999505578999999999850785 Q gi|254780661|r 74 VEAEFSRRIHQFFSVPNT-CIIGYNNIRFDDYYSRNIFYRNFYD 116 (471) Q Consensus 74 ~~~e~~~~i~~~~~~~~~-~~ig~N~~~FD~~~lr~~~~r~~~~ 116 (471) T Consensus 81 sEr~LL~~f~~~i~~~DPDii~Ghni~~fdl~~L~~R~~~lki~ 124 (234) T cd05776 81 NERALLNFFLAKLQKIDPDVLVGHDLEGFDLDVLLSRIQELKVP 124 (234) T ss_pred CHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHCCC T ss_conf 89999999999998509989985063777599999999980998

HHsearch alignment for GI: 254780661 and conserved domain: cd05776