>cd05783 DNA_polB_B1_exo The 3'-5' exonuclease domain of Sulfolobus solfataricus DNA polymerase B1 and similar archaeal proteins. B1 is a family-B DNA polymerase. Family-B DNA polymerases contain an N-terminal DEDDy DnaQ-like exonuclease domain in the same polypeptide chain as the polymerase domain, similar to family-A DNA polymerases. B1displays thermostable polymerase and 3'-5' exonuclease activities. This exonuclease domain contains three sequence motifs termed ExoI, ExoII and ExoIII, with a specific YX(3)D pattern at ExoIII. These motifs are clustered around the active site and are involved in metal binding and catalysis. The exonuclease domain of family-B polymerases also contains a beta hairpin structure that plays an important role in active site switching in the event of nucleotide misincorporation. Family-B DNA polymerases from thermophilic archaea are unique in that they are able to recognize the presence of uracil in the template strand, leading to the stalling of DNA synthes

Probab=97.77 E-value=0.00017 Score=47.57 Aligned_cols=103 Identities=17% Similarity=0.020 Sum_probs=58.9 Q ss_pred CCEEEEECCCC-C----C-CCCC--CEEEEEEEEEECCCCEECCEEEEEEECCCCCCCCCHHHHHHHCCCHHHHHHCCCC Q ss_conf 83799975278-8----9-8772--6048999999838972804002266217888778578989857998899607999 Q gi|254780661|r 3 NHFVIYDYETF-G----R-DVAL--DRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITPQKALRDGVV 74 (471) Q Consensus 3 ~~~v~~D~ETt-G----~-~~~~--~~iiq~~~i~~d~~~~~~~~~~~~~~~~~~~~~p~p~a~~v~git~~~~~~~~~~ 74 (471) T Consensus 5 lrvlsfDIEv~s~~~~~FP~p~~~~~~iisI~~~--~~~~~~--~~~~~-~~~~~~~--~-~~~~~~~~~---v~~f-~~ 72 (204) T cd05783 5 LKRIAIDIEVYTPIKGRIPDPKTAEYPVISVALA--GSDGLK--RVLVL-KREGVEG--L-EGLLPEGAE---VEFF-DS 72 (204) T ss_pred CEEEEEEEEECCCCCCCCCCCCCCCCEEEEEEEE--CCCCCE--EEEEE-EECCCCC--C-CCCCCCCCE---EEEE-CC T ss_conf 7499999887889999797955588619999999--279988--99999-5087125--7-655789989---9995-99 Q ss_pred HHHHHHHHHHHHHCCCCEEEEEECHHHHHHHHHHHHHHHCCCCC Q ss_conf 79999999999511796599950557899999999985078532 Q gi|254780661|r 75 EAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSY 118 (471) Q Consensus 75 ~~e~~~~i~~~~~~~~~~~ig~N~~~FD~~~lr~~~~r~~~~~y 118 (471) T Consensus 73 E~~LL~~F~~~i~~~-p~Ii~wN~~~FDiPYL~~R~~~Lg~~~~ 115 (204) T cd05783 73 EKELIREAFKIISEY-PIVLTFNGDNFDLPYLYNRALKLGIPKE 115 (204) T ss_pred HHHHHHHHHHHHHCC-CEEEECCCCCCCHHHHHHHHHHHCCCCE T ss_conf 999999999997439-9799817867788999999998599820

HHsearch alignment for GI: 254780661 and conserved domain: cd05783