RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780661|ref|YP_003065074.1| exonuclease I [Candidatus Liberibacter asiaticus str. psy62] (471 letters) >gnl|CDD|32749 COG2925, SbcB, Exonuclease I [DNA replication, recombination, and repair]. Length = 475 Score = 591 bits (1526), Expect = e-169 Identities = 254/465 (54%), Positives = 329/465 (70%), Gaps = 3/465 (0%) Query: 1 MTNHFVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFI 60 F+ YDYETFG ALDRPAQFAG+R D ++ I VF+CKPADDYLP P AV I Sbjct: 7 KQPTFLFYDYETFGVHPALDRPAQFAGIRTDIEFNIIGEPIVFYCKPADDYLPQPGAVLI 66 Query: 61 TGITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRW 120 TGITPQ+A G+ EA F+ RIH + PNTC++GYNNIRFDD +R IFYRNFYD Y W Sbjct: 67 TGITPQEAREKGINEAAFAARIHAELTQPNTCVLGYNNIRFDDEVTRYIFYRNFYDPYAW 126 Query: 121 SWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKAD 180 SW NGNSRWDLLDV+RA YA P+GI WP DDG SFKL+ L ANGIEH NAHDA +D Sbjct: 127 SWQNGNSRWDLLDVVRACYALRPEGINWPENDDGLPSFKLEHLTKANGIEHSNAHDAMSD 186 Query: 181 VYATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMFGASRSNTALI 240 VYAT+A+ L++ +P+LF+YL+ R K++L LIDI NM PLVHVSGMFGA R NT+ + Sbjct: 187 VYATIAMAKLVKTAQPRLFDYLFQLRKKHKLLALIDIPNMQPLVHVSGMFGAERGNTSWV 246 Query: 241 APVAWHPRYKDSVIGCNLSGDMRVFQDLDSVQLAKRLFTSHDEL-KGLVPVPIKEVHLNK 299 P+AWHP +++VI C+L+GD+ +LD+ L +RL+T +L +G + VP+K VH+NK Sbjct: 247 LPLAWHPTNRNAVIVCDLAGDISPLLELDADTLRERLYTRKADLGEGELAVPVKLVHINK 306 Query: 300 CPILMPIDYCKKEHFERWGIDHKRCLENLTLLRQQTNLRDRFKAIYNK-PYTSSSQDVDS 358 CPIL P + E +R GID + CL+NL LLR+ ++R++ AI+ + + S DVD+ Sbjct: 307 CPILAPAKTLRPEDADRLGIDRQHCLDNLELLRENPDVREKVVAIFAEEEPFNPSDDVDA 366 Query: 359 QLYDGFFADVDRQIMDRILRTAPEQLSTLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQ 418 QLY+GFF+D DR M + T PE L+ L++ F D+RL EL FRYRARNFP TL++ E+Q Sbjct: 367 QLYNGFFSDADRAAMKILRETEPENLAALDITFVDKRLEELLFRYRARNFPETLTDAEQQ 426 Query: 419 DWLEHRKKMLTRSRIEEYKNKLQSLSGEYKGDEGKEGLINALYEY 463 WLEHR++ LT + Y+ LQ+L E+ D+ K L+ ALYEY Sbjct: 427 RWLEHRRQRLTPEL-QGYELTLQALVQEHSDDKEKLALLKALYEY 470 >gnl|CDD|99841 cd06138, ExoI_N, N-terminal DEDDh 3'-5' exonuclease domain of Escherichia coli exonuclease I and similar proteins. This subfamily is composed of the N-terminal domain of Escherichia coli exonuclease I (ExoI) and similar proteins. ExoI is a monomeric enzyme that hydrolyzes single stranded DNA in the 3' to 5' direction. It plays a role in DNA recombination and repair. It primarily functions in repairing frameshift mutations. The N-terminal domain of ExoI is a DEDDh-type DnaQ-like 3'-5 exonuclease containing three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The ExoI structure is unique among DnaQ family enzymes in that there is a large distance between the two metal ions required for catalysis and the catalytic histidine is oriented away from the active site. Length = 183 Score = 293 bits (752), Expect = 7e-80 Identities = 108/182 (59%), Positives = 131/182 (71%), Gaps = 1/182 (0%) Query: 6 VIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITP 65 + YDYETFG + + D+ QFA +R D + +IE FC+ D LP PEA+ +TGITP Sbjct: 1 LFYDYETFGLNPSFDQILQFAAIRTDENFNEIE-PFNIFCRLPPDVLPSPEALIVTGITP 59 Query: 66 QKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNG 125 Q+ L++G+ E EF +IH+ F+ P TCI+GYNNIRFDD + R FYRN YD Y W W NG Sbjct: 60 QQLLKEGLSEYEFIAKIHRLFNTPGTCIVGYNNIRFDDEFLRFAFYRNLYDPYTWEWKNG 119 Query: 126 NSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATL 185 NSRWDLLDV+RA YA PDGI WP DDG SFKL+DLA ANGIEH NAHDA +DV AT+ Sbjct: 120 NSRWDLLDVVRAYYALRPDGIVWPKNDDGKPSFKLEDLAQANGIEHSNAHDALSDVEATI 179 Query: 186 AL 187 AL Sbjct: 180 AL 181 >gnl|CDD|144506 pfam00929, Exonuc_X-T, Exonuclease. This family includes a variety of exonuclease proteins, such as ribonuclease T and the epsilon subunit of DNA polymerase III.;. Length = 162 Score = 78.2 bits (193), Expect = 5e-15 Identities = 46/185 (24%), Positives = 62/185 (33%), Gaps = 24/185 (12%) Query: 5 FVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGIT 64 V+ D ET G D DR + A V + E I + KP EA GIT Sbjct: 1 LVVIDCETTGLDPEKDRIIEIAAVSIVGG-ENIGPVFDTYVKPERL--ITDEATKFHGIT 57 Query: 65 PQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDN 124 P+ LR+ E +F ++G+N FD + R + Sbjct: 58 PEM-LRNAPSFEEVLEAFLEFLK-KLKILVGHNA-SFDVGFLLYDDLRFLKLPH----PK 110 Query: 125 GNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHV-NAHDAKADVYA 183 N D L + +A Y L LA G+E + AH A D A Sbjct: 111 LNDVIDTLILDKATYKGFK-------------RRSLDALAEKLGLEKIQRAHRALDDARA 157 Query: 184 TLALV 188 T L Sbjct: 158 TAELF 162 >gnl|CDD|176648 cd06127, DEDDh, DEDDh 3'-5' exonuclease domain family. DEDDh exonucleases, part of the DnaQ-like (or DEDD) exonuclease superfamily, catalyze the excision of nucleoside monophosphates at the DNA or RNA termini in the 3'-5' direction. These proteins contain four invariant acidic residues in three conserved sequence motifs termed ExoI, ExoII and ExoIII. DEDDh exonucleases are classified as such because of the presence of specific Hx(4)D conserved pattern at the ExoIII motif. The four conserved acidic residues are clustered around the active site and serve as ligands for the two metal ions required for catalysis. Most DEDDh exonucleases are the proofreading subunits (epsilon) or domains of bacterial DNA polymerase III, the main replicating enzyme in bacteria, which functions as the chromosomal replicase. Other members include other DNA and RNA exonucleases such as RNase T, Oligoribonuclease, and RNA exonuclease (REX), among others. Length = 159 Score = 74.6 bits (184), Expect = 5e-14 Identities = 49/182 (26%), Positives = 61/182 (33%), Gaps = 25/182 (13%) Query: 6 VIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGITP 65 V++D ET G D DR + V+VD E +E E P PEA I GIT Sbjct: 1 VVFDTETTGLDPKKDRIIEIGAVKVDGGIEIVERFE-TLVNP--GRPIPPEATAIHGITD 57 Query: 66 QKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDNG 125 + L D E +F ++ +N FD R N Sbjct: 58 E-MLADAPPFEEVLPEFLEFLG--GRVLVAHN-ASFD----LRFLNRELRRLGGPPLPN- 108 Query: 126 NSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADVYATL 185 W +D +R P S G LA GI AH A AD AT Sbjct: 109 --PW--IDTLRLARRLLPG---LRSHRLGL------LLAERYGIPLEGAHRALADALATA 155 Query: 186 AL 187 L Sbjct: 156 EL 157 >gnl|CDD|32359 COG2176, PolC, DNA polymerase III, alpha subunit (gram-positive type) [DNA replication, recombination, and repair]. Length = 1444 Score = 40.6 bits (95), Expect = 9e-04 Identities = 42/193 (21%), Positives = 71/193 (36%), Gaps = 33/193 (17%) Query: 5 FVIYDYETFGRDVALDRPAQFAGVRV--DRQWEKIESTEVFFCKPADDYLPDPEAVF-IT 61 +V++D ET G D + A V++ R +K + FF KP P + +T Sbjct: 423 YVVFDIETTGLSPVYDEIIEIAAVKIKNGRIIDKFQ----FFIKPGR---PLSATITELT 475 Query: 62 GITPQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWS 121 GIT + L + E + +F I+ +N FD + + + Y + Sbjct: 476 GIT-DEMLENAPEIEEVLEKFREFI---GDSILVAHNASFDMGFLNTNYEK--YGLEPLT 529 Query: 122 WDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVNAHDAKADV 181 N D L++ RA+ S +L L G+E H A D Sbjct: 530 ----NPVIDTLELARALNP-------------EFKSHRLGTLCKKLGVELERHHRADYDA 572 Query: 182 YATLALVWLIREK 194 AT + ++ + Sbjct: 573 EATAKVFFVFLKD 585 >gnl|CDD|31188 COG0847, DnaQ, DNA polymerase III, epsilon subunit and related 3'-5' exonucleases [DNA replication, recombination, and repair]. Length = 243 Score = 39.8 bits (92), Expect = 0.002 Identities = 48/228 (21%), Positives = 70/228 (30%), Gaps = 31/228 (13%) Query: 5 FVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGIT 64 FV+ D ET G + DR + V ++ +E + P PE I GIT Sbjct: 15 FVVIDLETTGLNPKKDRIIEIGAVTLEDG-RIVERSFHTLVNPERPI--PPEIFKIHGIT 71 Query: 65 PQKALRDGVVEAEFSRRIHQFFSVPNTCIIGYNNIRFDDYYSRNIFYRNFYDSYRWSWDN 124 + L D AE F ++ + N FD + R R + Sbjct: 72 DEM-LADAPKFAEVLPEFLDFIG-GLRLLVAH-NAAFDVGFLRVESERLGIE------IP 122 Query: 125 GNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHV--NAHDAKADVY 182 G+ D L + R + G L LA GI+ + H A D Sbjct: 123 GDPVLDTLALARRHFP-------------GFDRSSLDALAERLGIDRNPFHPHRALFDAL 169 Query: 183 ATLALVWLIREKKPKLFEYLYDYRNKNQLRKLIDIQNMTPLVHVSGMF 230 A L L++ L KL L + +F Sbjct: 170 ALAELFLLLQTGLLL----KAPLTAILDLDKLAHKALYDTLKTAARLF 213 >gnl|CDD|31618 COG1429, CobN, Cobalamin biosynthesis protein CobN and related Mg-chelatases [Coenzyme metabolism]. Length = 1388 Score = 31.1 bits (70), Expect = 0.66 Identities = 19/96 (19%), Positives = 29/96 (30%), Gaps = 11/96 (11%) Query: 114 FYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHVN 173 +YR W+ +S DV + DG P K + +V Sbjct: 299 SSGTYREQWEESDSGLGPADVAYQVALPELDGRIEP----IPIGGKEKRDDGTEVEAYV- 353 Query: 174 AHDAKADVYATLALVWL------IREKKPKLFEYLY 203 + + A A+ W EKK + Y Y Sbjct: 354 PIPERIEWLADRAIRWARLRRKPNAEKKVAIIYYNY 389 >gnl|CDD|35991 KOG0772, KOG0772, KOG0772, Uncharacterized conserved protein, contains WD40 repeat [Function unknown]. Length = 641 Score = 28.9 bits (64), Expect = 3.1 Identities = 8/38 (21%), Positives = 20/38 (52%) Query: 233 SRSNTALIAPVAWHPRYKDSVIGCNLSGDMRVFQDLDS 270 ++ + A + WHP K+ + C+ G +R++ ++ Sbjct: 264 TKGHIAELTCGCWHPDNKEEFLTCSYDGTLRIWDVNNT 301 >gnl|CDD|35383 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain [Cytoskeleton]. Length = 1930 Score = 28.7 bits (64), Expect = 4.0 Identities = 32/147 (21%), Positives = 58/147 (39%), Gaps = 13/147 (8%) Query: 322 KRCLENLTLLRQQTNLRDRFKAIYNKPYTSSSQDVDSQLYDGFFADVDRQIMDRILRTAP 381 K+ ++L L++Q + KA K + +++ + +++ +++ + Sbjct: 1185 KKHADSLAELQEQLEQLQKDKAKLEKEKSDLQREIADLAAELEQLSSEKKDLEKKDKKLE 1244 Query: 382 EQLSTLNLPFSD-RRLPELFFRYRAR------NFPHTLSEKEKQDWLEHRKKMLTRSRIE 434 QLS L L + RL R+R L E E + R K S++E Sbjct: 1245 AQLSELQLKLDEQERLRNDLTAKRSRLQNENEELSRQLEEAEAKLSALSRDKQALESQLE 1304 Query: 435 EYKNKLQSLSGEYKGDEGKEGLINALY 461 E K +L+ + E K L NAL Sbjct: 1305 ELKRQLEEETRE------KSALENALR 1325 >gnl|CDD|37245 KOG2034, KOG2034, KOG2034, Vacuolar sorting protein PEP3/VPS18 [Intracellular trafficking, secretion, and vesicular transport]. Length = 911 Score = 28.4 bits (63), Expect = 4.3 Identities = 15/70 (21%), Positives = 22/70 (31%), Gaps = 2/70 (2%) Query: 386 TLNLPFSDRRLPELFFRYRARNFPHTLSEKEKQDWLEHRKKMLTRSRIEEYKNKLQSLSG 445 L P + E F R P ++E + W + + Y N+ Q L Sbjct: 215 ELEHPIRSFKSDEGFSNLRFSTMPKNIAEPKTWAWKSP--DGINFGNVNIYANRDQDLLE 272 Query: 446 EYKGDEGKEG 455 E E G Sbjct: 273 EEFNIELPLG 282 >gnl|CDD|144201 pfam00521, DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A. Length = 428 Score = 28.3 bits (64), Expect = 4.4 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 4/46 (8%) Query: 407 NFPHTLSEKE-KQDWLEHRKKMLTRS---RIEEYKNKLQSLSGEYK 448 P L+ KE +++LEHR ++ R +E+ + +L L G K Sbjct: 300 GGPKYLNLKEILKEFLEHRLEVYKRRKEYLLEKLEERLHILEGLLK 345 >gnl|CDD|185714 cd07905, Adenylation_DNA_ligase_LigC, Adenylation domain of Mycobacterium tuberculosis LigC-like ATP-dependent DNA ligases. Bacterial DNA ligases are divided into two broad classes: NAD-dependent and ATP-dependent. All bacterial species have a NAD-dependent DNA ligase (LigA). Some bacterial genomes contain multiple genes for DNA ligases that are predicted to use ATP as their cofactor, including Mycobacterium tuberculosis LigB, LigC, and LigD. This group is composed of ATP-dependent DNA ligases similar to Mycobacterium tuberculosis LigC. ATP-dependent polynucleotide ligases catalyze phosphodiester bond formation using nicked nucleic acid substrates with the high energy nucleotide of ATP as a cofactor in a three step reaction mechanism. DNA ligases play a vital role in the diverse processes of DNA replication, recombination and repair. Members of this group contain adenylation and C-terminal oligonucleotide/oligosaccharide binding (OB)-fold domains, comprising a catalytic core unit that is common to all members of the ATP-dependent DNA ligase family. The adenylation domain binds ATP and contains many of the active-site residues. The common catalytic core unit comprises six conserved sequence motifs (I, III, IIIa, IV, V and VI) that define this family of related nucleotidyltransferases. Length = 194 Score = 28.0 bits (63), Expect = 5.7 Identities = 11/42 (26%), Positives = 15/42 (35%), Gaps = 4/42 (9%) Query: 385 STLNLPFSDRR--LPELFFRYRA--RNFPHTLSEKEKQDWLE 422 P +RR L L + P T E ++WLE Sbjct: 120 DLRGRPLRERRAALEALLAGWGPPLHLSPATTDRAEAREWLE 161 >gnl|CDD|185735 cd08994, GH43_like_2, Glycosyl hydrolase 43-like family consists of hypothetical proteins. This subfamily mostly contains uncharacterized proteins similar to glycosyl hydrolase family 43 (GH43) which includes enzymes with beta-xylosidase (EC 3.2.1.37) and alpha-L-arabinofuranosidase (EC 3.2.1.55) and possibly bifunctional xylosidase/arabinofuranosidase activities. GH43 are inverting enzymes (i.e. they invert the stereochemistry of the anomeric carbon atom of the substrate) that have an aspartate as the catalytic general base, a glutamate as the catalytic general acid and another aspartate that is responsible for pKa modulation and orienting the catalytic acid. Many of the enzymes in this family display both alpha-L-arabinofuranosidase and beta-D-xylosidase activity using aryl-glycosides as substrates. A common structural feature of GH43 enzymes is a 5-bladed beta-propeller domain that contains the catalytic acid and catalytic base. A long V-shaped groove, partially enclosed at one end, forms a single extended substrate-binding surface across the face of the propeller. Length = 291 Score = 28.1 bits (63), Expect = 6.3 Identities = 12/59 (20%), Positives = 18/59 (30%), Gaps = 12/59 (20%) Query: 93 IIGYNNIRFDD---YYSRNIFYRNFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQW 148 I +N +D +Y + F+ D + Y S DGI W Sbjct: 198 IEPGDNGNTEDPFVWYDKGQFHMIVKDMLGYVTGE---------KGGGAYFRSKDGIHW 247 >gnl|CDD|176462 cd01357, Aspartase, Aspartase. This subgroup contains Escherichia coli aspartase (L-aspartate ammonia-lyase), Bacillus aspartase and related proteins. It is a member of the Lyase class I family, which includes both aspartase (L-aspartate ammonia-lyase) and fumarase class II enzymes. Members of this family for the most part catalyze similar beta-elimination reactions in which a C-N or C-O bond is cleaved with the release of fumarate as one of the products. These proteins are active as tetramers. The four active sites of the homotetrameric enzyme are each formed by residues from three different subunits. Aspartase catalyzes the reversible deamination of aspartic acid. Length = 450 Score = 27.9 bits (63), Expect = 7.1 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 3/33 (9%) Query: 169 IEHVNAHDAKADVYAT---LALVWLIREKKPKL 198 +HVN + DVY T LAL+ L+R+ L Sbjct: 127 NDHVNMSQSTNDVYPTALRLALILLLRKLLDAL 159 >gnl|CDD|80331 cd04448, DEP_PIKfyve, DEP (Dishevelled, Egl-10, and Pleckstrin) domain found in fungal RhoGEF (GDP/GTP exchange factor) PIKfyve-like proteins. PIKfyve contains N-terminal Fyve finger and DEP domains, a central chaperonin-like domain and a C-terminal PIPK (phosphatidylinositol phosphate kinase) domain. PIKfyve-like proteins are important phosphatidylinositol (3)-monophosphate (PtdIns(3)P)-5-kinases, producing PtdIns(3,5)P2, which plays a major role in multivesicular body (MVB) sorting and control of retrograde traffic from the vacuole back to the endosome and/or Golgi. PIKfyve itself has been shown to be play a role in regulating early-endosome-to-trans-Golgi network (TGN) retrograde trafficking.. Length = 81 Score = 27.5 bits (61), Expect = 8.9 Identities = 11/29 (37%), Positives = 16/29 (55%) Query: 402 RYRARNFPHTLSEKEKQDWLEHRKKMLTR 430 RYR R + + + KE +WL + K TR Sbjct: 19 RYRLRTYTNCILGKELVNWLIRQGKAATR 47 >gnl|CDD|99834 cd06130, DNA_pol_III_epsilon_like, an uncharacterized bacterial subgroup of the DEDDh 3'-5' exonuclease domain family with similarity to the epsilon subunit of DNA polymerase III. This subfamily is composed of uncharacterized bacterial proteins with similarity to the epsilon subunit of DNA polymerase III (Pol III), a multisubunit polymerase which is the main DNA replicating enzyme in bacteria, functioning as the chromosomal replicase. The Pol III holoenzyme is a complex of ten different subunits, three of which (alpha, epsilon, and theta) compose the catalytic core. The Pol III epsilon subunit, encoded by the dnaQ gene, is a DEDDh-type 3'-5' exonuclease which is responsible for the proofreading activity of the polymerase, increasing the fidelity of DNA synthesis. It contains three conserved sequence motifs termed ExoI, ExoII and ExoIII, with a specific Hx(4)D conserved pattern at ExoIII. These motifs are clustered around the active site and contain four conserved acidic residues that serve as ligands for the two metal ions required for catalysis. The epsilon subunit of Pol III also functions as a stabilizer of the holoenzyme complex. Length = 156 Score = 27.5 bits (62), Expect = 9.1 Identities = 44/191 (23%), Positives = 63/191 (32%), Gaps = 54/191 (28%) Query: 5 FVIYDYETFGRDVALDRPAQFAGVRVDRQWEKIESTEVFFCKPADDYLPDPEAVFITGIT 64 FV D+ET D A V+V +I T +P + DP + I GIT Sbjct: 1 FVAIDFETANADRA--SACSIGLVKVRDG--QIVDTFYTLIRPPTRF--DPFNIAIHGIT 54 Query: 65 PQKALRDGVVEA----EFSRRIHQFFSVPNTCIIGYNNIRFD--------DYYSRNIFYR 112 P+ V +A E I F + ++ + N FD + Y Sbjct: 55 PED-----VADAPTFPEVWPEIKPFLG--GSLVVAH-NASFDRSVLRAALEAYGLPPPPY 106 Query: 113 NFYDSYRWSWDNGNSRWDLLDVMRAIYAFSPDGIQWPSRDDGATSFKLQDLALANGIEHV 172 + + R + R WP + KL +A GIE + Sbjct: 107 QYLCTVR--------------LARR---------VWP----LLPNHKLNTVAEHLGIE-L 138 Query: 173 NAHDAKADVYA 183 N HDA D A Sbjct: 139 NHHDALEDARA 149 >gnl|CDD|33001 COG3188, FimD, P pilus assembly protein, porin PapC [Cell motility and secretion / Intracellular trafficking and secretion]. Length = 835 Score = 27.2 bits (60), Expect = 9.9 Identities = 29/121 (23%), Positives = 40/121 (33%), Gaps = 27/121 (22%) Query: 45 CKPADDYLPDPEAVFITG------ITPQKAL----RDGVVEAEFSRRIHQFFSVPNTCII 94 C D LP F PQ AL R V + + I+ N + Sbjct: 119 CLDLADALPGASVTFDVAQQRLDISIPQAALEPSARGYVPPSLWDEGINAALL--NYNLN 176 Query: 95 GYNNIRFDDYYSRNIFYRNF-------------YDSYRWSWDNGNSRWDLLD--VMRAIY 139 + + SRN +Y N SY +S NG S+W + + RAI Sbjct: 177 ASRSEYRNGGSSRNSYYANLNSGLNLGAWRLRNDSSYSYSDGNGQSKWQSIRTYLQRAIP 236 Query: 140 A 140 A Sbjct: 237 A 237 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.322 0.139 0.431 Gapped Lambda K H 0.267 0.0776 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 6,239,152 Number of extensions: 347837 Number of successful extensions: 876 Number of sequences better than 10.0: 1 Number of HSP's gapped: 870 Number of HSP's successfully gapped: 25 Length of query: 471 Length of database: 6,263,737 Length adjustment: 97 Effective length of query: 374 Effective length of database: 4,167,664 Effective search space: 1558706336 Effective search space used: 1558706336 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 59 (26.4 bits)