HHsearch alignment for GI: 254780666 and conserved domain: COG0116

>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair].
Probab=97.23  E-value=0.00081  Score=48.07  Aligned_cols=190  Identities=16%  Similarity=0.170  Sum_probs=113.1

Q ss_pred             CCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEECCCHHHH--HHHHHHHHCCCCCCEECCCCCCHHHCHHHHHCCCEE
Q ss_conf             997899998841267999999996146983667615998999--986432102356611104567855585011001013
Q gi|254780666|r  148 IPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW--AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV  225 (445)
Q Consensus       148 ~P~Wl~~~~~~~~G~~~~~~l~~~~~~p~~l~i~~k~~~~~~--~~~L~~~~~~~~~~~~~~~~~~i~~~~~f~eG~~~V  225 (445)
T Consensus       114 vkdAIvd~~~~~~~~r~-----~v~~~~Pdv~i~v~l~~~~~~l~iDttG~sLhkRGyR~~~g~ApLketLA--------  180 (381)
T COG0116         114 VKDAIVDRFRRKYGRRP-----SVDLDGPDVRINVELDKDTATLGIDTTGDSLHKRGYRVYDGPAPLKETLA--------  180 (381)
T ss_pred             HHHHHHHHHHHCCCCCC-----CCCCCCCCEEEEEEEECCEEEEEEECCCCCHHHCCCCCCCCCCCCHHHHH--------
T ss_conf             99999999755028898-----74445898699999975778999967886321065614688878569999--------


Q ss_pred             CCCCCCCCCCCCCCCCCCCEECCCCCCCCCEE--EECC-C-------------------------------CC-------
Q ss_conf             46321232223563213310035564470000--1025-6-------------------------------84-------
Q gi|254780666|r  226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTA--QLIV-S-------------------------------GA-------  264 (445)
Q Consensus       226 QD~aSql~~~~l~~~~g~~VLD~CAAPGGKT~--~l~~-~-------------------------------~~-------  264 (445)
T Consensus       181 -----aAil~lagw~~~~pl~DPmCGSGTi~IEAAl~~~niAPg~~R~~~f~~w~~~~~~lw~~~~~ea~~~a~~~~~~~  255 (381)
T COG0116         181 -----AAILLLAGWKPDEPLLDPMCGSGTILIEAALIAANIAPGLNRRFGFEFWDWFDKDLWDKLREEAEERARRGKELP  255 (381)
T ss_pred             -----HHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             -----999997399999834168877347999999734456876332200455432138889999999999865147666


Q ss_pred             CHHHHHCCHHHHHHHHHHHHCCCCCC-EEEEECCCCCCCCC-CCCCEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHH
Q ss_conf             10001059679877654432048874-17720774457743-44766896167421100110110333288667788999
Q gi|254780666|r  265 KVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFDYCPK-KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC  342 (445)
Q Consensus       265 ~i~A~D~~~~Rl~~l~~~~~R~g~~~-~~~~~~D~~~~~~~-~~fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~  342 (445)
T Consensus       256 ~~~G~Did~r~i~~Ak~NA~~AGv~d~I~f~~~d~~~l~~~~~~~gvvI~NPPYG----------e--Rlg~~--~~v~~  321 (381)
T COG0116         256 IIYGSDIDPRHIEGAKANARAAGVGDLIEFKQADATDLKEPLEEYGVVISNPPYG----------E--RLGSE--ALVAK  321 (381)
T ss_pred             EEEEECCCHHHHHHHHHHHHHCCCCCEEEEEECCHHHCCCCCCCCCEEEECCCCH----------H--HCCCH--HHHHH
T ss_conf             5898748989999999989976988328999744321668766699899589830----------1--11770--46999


Q ss_pred             HHHHHHHHHHHHCCCCCEEEEEECCCC
Q ss_conf             999999999986089828999774788
Q gi|254780666|r  343 FQRKLLLQGISFVKPGGIVVFSNCSLD  369 (445)
Q Consensus       343 ~Q~~iL~~a~~~lk~gG~lvYsTCSi~  369 (445)
T Consensus       322 LY~~fg~~lk~~~~~ws~~v~tt~e~~  348 (381)
T COG0116         322 LYREFGRTLKRLLAGWSRYVFTTSEDL  348 (381)
T ss_pred             HHHHHHHHHHHHHCCCCEEEEECCHHH
T ss_conf             999999999987257736999766778