HHsearch alignment for GI: 254780666 and conserved domain: COG0293

>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis].
Probab=97.99  E-value=2.2e-05  Score=59.74  Aligned_cols=120  Identities=26%  Similarity=0.305  Sum_probs=84.2

Q ss_pred             CCCCCEECCCCCCCCCEE---EECCCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC---------CCCC
Q ss_conf             213310035564470000---1025684100010596798776544320488741772077445774---------3447
Q gi|254780666|r  240 LNNLSVLDLCAAPGGKTA---QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP---------KKLF  307 (445)
Q Consensus       240 ~~g~~VLD~CAAPGGKT~---~l~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~---------~~~f  307 (445)
T Consensus        44 ~~~~~ViDLGAAPGgWsQva~~~~~~~~~vvavDi~p~~~-----------~~~V~~iq~d~~~~~~~~~l~~~l~~~~~  112 (205)
T COG0293          44 KPGMVVVDLGAAPGGWSQVAAKKLGAGGKIVAVDILPMKP-----------IPGVIFLQGDITDEDTLEKLLEALGGAPV  112 (205)
T ss_pred             CCCCEEEECCCCCCCHHHHHHHHHCCCCCEEEEECCCCCC-----------CCCCEEEEEECCCCCHHHHHHHHCCCCCC
T ss_conf             5898799838799849999999738888489997754556-----------78946884132484379999987077876


Q ss_pred             CEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHC
Q ss_conf             66896167421100110110333288667788999999999999986089828999774788343999899999968
Q gi|254780666|r  308 DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS  384 (445)
Q Consensus       308 D~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~  384 (445)
T Consensus       113 DvV~sD~ap~~~g~~~~-----------Dh~r~~~L~~~a~~~a~~vL~~~G~fv---~K~fqg~~~~~~l~~~~~~  175 (205)
T COG0293         113 DVVLSDMAPNTSGNRSV-----------DHARSMYLCELALEFALEVLKPGGSFV---AKVFQGEDFEDLLKALRRL  175 (205)
T ss_pred             CEEEECCCCCCCCCCCC-----------CHHHHHHHHHHHHHHHHHEECCCCEEE---EEEEECCCHHHHHHHHHHH
T ss_conf             66872588776787220-----------088999999999999987257898399---9997579879999999986