HHsearch alignment for GI: 254780666 and conserved domain: COG1041

>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair].
Probab=98.67  E-value=1e-07  Score=76.91  Aligned_cols=121  Identities=23%  Similarity=0.272  Sum_probs=97.5

Q ss_pred             CCCCCCCCCCCCEECCCCCCCCCEEEECCCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEEC-CCCCCCCCC-CCCEE
Q ss_conf             2223563213310035564470000102568410001059679877654432048874177207-744577434-47668
Q gi|254780666|r  233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEM-DAFDYCPKK-LFDAV  310 (445)
Q Consensus       233 ~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~-D~~~~~~~~-~fD~i  310 (445)
T Consensus       189 mVNLa~v~~G~~vlDPFcGTGgiLiEagl~G~~viG~Did~~mv~gak~Nl~~y~i~~~~~~~~~Da~~lpl~~~~vdaI  268 (347)
T COG1041         189 MVNLARVKRGELVLDPFCGTGGILIEAGLMGARVIGSDIDERMVRGAKINLEYYGIEDYPVLKVLDATNLPLRDNSVDAI  268 (347)
T ss_pred             HHHHHCCCCCCEEECCCCCCCHHHHHHHHCCCEEEECCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEE
T ss_conf             87774164698764576783488883664275676032379998556641566276761688730221277887742358


Q ss_pred             EECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             96167421100110110333288667788999999999999986089828999774
Q gi|254780666|r  311 LVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC  366 (445)
Q Consensus       311 LlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTC  366 (445)
T Consensus       269 atDPPY------Grst-------~~~~~~l~~Ly~~~le~~~evLk~gG~~vf~~p  311 (347)
T COG1041         269 ATDPPY------GRST-------KIKGEGLDELYEEALESASEVLKPGGRIVFAAP  311 (347)
T ss_pred             EECCCC------CCCC-------CCCCCCHHHHHHHHHHHHHHHHHCCCEEEEECC
T ss_conf             846998------7100-------245552899999999999987304848999617