HHsearch alignment for GI: 254780666 and conserved domain: COG2813

>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis].
Probab=98.58  E-value=2.3e-07  Score=74.39  Aligned_cols=135  Identities=19%  Similarity=0.236  Sum_probs=107.1

Q ss_pred             CCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEECCC--CCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC
Q ss_conf             4632123222356321331003556447000010256--84100010596798776544320488741772077445774
Q gi|254780666|r  226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS--GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP  303 (445)
Q Consensus       226 QD~aSql~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~--~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~  303 (445)
T Consensus       143 lD~GS~lLl~~l~~~~~~~vlDlGCG~Gvlg~~la~~~p~~~vtmvDvn~~Av~~ar~Nl~~N~~~~~~v~~s~~~~~v~  222 (300)
T COG2813         143 LDKGSRLLLETLPPDLGGKVLDLGCGYGVLGLVLAKKSPQAKLTLVDVNARAVESARKNLAANGVENTEVWASNLYEPVE  222 (300)
T ss_pred             CCHHHHHHHHHCCCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCCCCC
T ss_conf             68388999973775569968870788429999999868987289982669999998876997398763799812446654


Q ss_pred             CCCCCEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHH
Q ss_conf             34476689616742110011011033328866778899999999999998608982899977478834399989999996
Q gi|254780666|r  304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS  383 (445)
Q Consensus       304 ~~~fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~  383 (445)
T Consensus       223 -~kfd~IisNPPf------h---------~G~~v--~~~~~~~ii~~A~~~L~~gGeL~iVan~~l~y------~~~L~~  278 (300)
T COG2813         223 -GKFDLIISNPPF------H---------AGKAV--VHSLAQEIIAAAARHLKPGGELWIVANRHLPY------EKKLKE  278 (300)
T ss_pred             -CCCCEEEECCCC------C---------CCCCH--HHHHHHHHHHHHHHHHCCCCEEEEEECCCCCH------HHHHHH
T ss_conf             -400689848884------6---------77101--67889999999997604597799997588896------899998


Q ss_pred             C
Q ss_conf             8
Q gi|254780666|r  384 S  384 (445)
Q Consensus       384 ~  384 (445)
T Consensus       279 ~  279 (300)
T COG2813         279 L  279 (300)
T ss_pred             H
T ss_conf             6