HHsearch alignment for GI: 254780666 and conserved domain: COG4106

>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only].
Probab=96.74  E-value=0.002  Score=45.11  Aligned_cols=122  Identities=24%  Similarity=0.317  Sum_probs=86.1

Q ss_pred             CCCCCCCEECCCCCCCCCEEEECC--CCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCEEEECCC
Q ss_conf             632133100355644700001025--684100010596798776544320488741772077445774344766896167
Q gi|254780666|r  238 GTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAP  315 (445)
Q Consensus       238 ~~~~g~~VLD~CAAPGGKT~~l~~--~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~~~fD~iLlDaP  315 (445)
T Consensus        27 p~~~~~~v~DLGCGpGnsTelL~~RwP~A~i~GiDsS~~Mla~Aa~rl-----p~~~f~~aDl~~w~p~~~~dllfaNAv  101 (257)
T COG4106          27 PLERPRRVVDLGCGPGNSTELLARRWPDAVITGIDSSPAMLAKAAQRL-----PDATFEEADLRTWKPEQPTDLLFANAV  101 (257)
T ss_pred             CCCCCCEEEECCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHC-----CCCCEECCCHHHCCCCCCCCHHHHHHH
T ss_conf             866641034557788778899998688886760469999999999748-----997321052754499876330334436


Q ss_pred             CCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHCCC
Q ss_conf             42110011011033328866778899999999999998608982899977478834399989999996887
Q gi|254780666|r  316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPI  386 (445)
Q Consensus       316 CSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~~~  386 (445)
T Consensus       102 ------------lqWlpd----------H~~ll~rL~~~L~Pgg~LAVQmPdN~depsH~~mr~~A~~~p~  150 (257)
T COG4106         102 ------------LQWLPD----------HPELLPRLVSQLAPGGVLAVQMPDNLDEPSHRLMRETADEAPF  150 (257)
T ss_pred             ------------HHHCCC----------CHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCH
T ss_conf             ------------644364----------0899999998508885699978876476457999998742836