HHsearch alignment for GI: 254780666 and conserved domain: KOG0820

>KOG0820 consensus.
Probab=90.36  E-value=0.25  Score=29.56  Aligned_cols=124  Identities=20%  Similarity=0.257  Sum_probs=87.9

Q ss_pred             CCCCCCCCEECCCCCCCCCEEEECCCCCCHHHHHCCHHHHHHHHHHHHCCCCCC-EEEEECCCCCCCCCCCCCEEEECCC
Q ss_conf             563213310035564470000102568410001059679877654432048874-1772077445774344766896167
Q gi|254780666|r  237 FGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFDYCPKKLFDAVLVDAP  315 (445)
Q Consensus       237 l~~~~g~~VLD~CAAPGGKT~~l~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~-~~~~~~D~~~~~~~~~fD~iLlDaP  315 (445)
T Consensus        54 a~~k~tD~VLEvGPGTGnLT~~lLe~~kkVvA~E~Dprmvael~krv~gtp~~~kLqV~~gD~lK~d-~P~fd~cVsNlP  132 (315)
T KOG0820          54 ADLKPTDVVLEVGPGTGNLTVKLLEAGKKVVAVEIDPRMVAELEKRVQGTPKSGKLQVLHGDFLKTD-LPRFDGCVSNLP  132 (315)
T ss_pred             CCCCCCCEEEEECCCCCHHHHHHHHHCCEEEEEECCCHHHHHHHHHHCCCCCCCEEEEEECCCCCCC-CCCCCEEECCCC
T ss_conf             4789987799957987789999997208489994080789999998669986560468850312578-851031122698


Q ss_pred             C--CCCCHHHCCCHHHHCCCHHHHHHHH--HHHHHHHHHHHHHCCCCCEEEEEECCCCHH
Q ss_conf             4--2110011011033328866778899--999999999998608982899977478834
Q gi|254780666|r  316 C--SSTGTIRRHPDVLWTRDTDDIVKSA--CFQRKLLLQGISFVKPGGIVVFSNCSLDKQ  371 (445)
Q Consensus       316 C--Sg~Gt~rr~Pd~~w~~~~~~l~~l~--~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~e  371 (445)
T Consensus       133 yqISSp~vfK-------LL~~~~~fr~AvlmfQ~E---fa~RLva~pgd~~Ycrlsin~q  182 (315)
T KOG0820         133 YQISSPLVFK-------LLLHRPVFRCAVLMFQRE---FALRLVARPGDSLYCRLSINVQ  182 (315)
T ss_pred             CCCCCHHHHH-------HCCCCCCCCEEEEEHHHH---HHHHHCCCCCCCHHCEEEHHHH
T ss_conf             5336788998-------627887760234402566---6555135889841100111137