HHsearch alignment for GI: 254780666 and conserved domain: KOG1122

>KOG1122 consensus.
Probab=100.00  E-value=0  Score=481.71  Aligned_cols=384  Identities=26%  Similarity=0.340  Sum_probs=289.0

Q ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HC-CCCCCCCHHHHHHHHHHHHHHHHCC-CCCCCCCCCHHHHHHHCCCC
Q ss_conf             898899999999999996089999999998-42-8810048899999999999999868-99733256225877522587
Q gi|254780666|r   41 LSQRDQILVRAIVNVTLRFLPRIDAVLDFV-LI-SSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKEN  117 (445)
Q Consensus        41 L~~~Dr~~~~~Lv~gvlR~~~~ld~il~~~-~~-~~~~~~~~~~~~iLr~a~~ell~~~-~p~~a~vneaVelak~~~~~  117 (445)
T Consensus        35 ~~~~~~~~-~e~~~~~l~~~~~~~~~~~~~e~~~~~~~~~~~l~lp~~~----~~~~~~~~P----~L~~v~~~~~~-~~  104 (460)
T KOG1122          35 LDDIDLKL-IERKSRKLRKRESLEASEAEEELNTNTFEEGDPLLLPTLE----EEEEKDSVP----DLQNVDLRIVE-LV  104 (460)
T ss_pred             HHHHHHHH-HHHHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCCCCC----CCCCCCCCC----CCCHHHHHHHH-HH
T ss_conf             55664322-4667777877640451256788752234345422375322----222234687----63103577655-01


Q ss_pred             CCCCCCCCCHHHHHHH--CCCCCCHHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHCCCCCEEEEECC---CHHHHHHH
Q ss_conf             5544444310221100--111100000123129978999988412679999999961469836676159---98999986
Q gi|254780666|r  118 RHFAKLVNSILRRVSR--EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF---DIETWAHK  192 (445)
Q Consensus       118 ~~~~~~vNAVLR~~~r--~~~~~~~~l~~~~s~P~Wl~~~~~~~~G~~~~~~l~~~~~~p~~l~i~~k~---~~~~~~~~  192 (445)
T Consensus       105 ~~l~dfk~l~~~~~~~~~~~~~l~~~~~~~y~y~~~l~~~~~e~~~~~ev~~~~e~~~~~rp~tir~ntlk~~rrd~~~~  184 (460)
T KOG1122         105 PVLGDFKNLKEPGRLRSEYCGQLKKDGAHYYAYGVFLAEKLMELFPLVEVYEFLEANEKPRPVTIRTNTLKTRRRDLAVE  184 (460)
T ss_pred             HHHCCHHCCCCCCCCHHHHHHHHHHCCCCEECHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHH
T ss_conf             21033001465443056679998744150004088999875454569999999871057898168724551013447999


Q ss_pred             HHHHHC--------CCCCCEECCCCCCHHHCHHHHHCCCEECCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEE---CC
Q ss_conf             432102--------3566111045678555850110010134632123222356321331003556447000010---25
Q gi|254780666|r  193 LNAVML--------PTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IV  261 (445)
Q Consensus       193 L~~~~~--------~~~~~~~~~~~~~i~~~~~f~eG~~~VQD~aSql~~~~l~~~~g~~VLD~CAAPGGKT~~l---~~  261 (445)
T Consensus       185 L~nrgv~~~pl~~ws~vgl~v~~s~vpigat~e~lag~~~LQ~~sS~Lpv~aL~Pq~gERIlDmcAAPGGKTt~IAalMk  264 (460)
T KOG1122         185 LSNRGVNLDPLGKWSKVGLVVFDSVVPIGATPEYLAGHYMLQNASSFLPVMALDPQPGERILDMCAAPGGKTTHIAALMK  264 (460)
T ss_pred             HHHCCCCCCCCCCCCCCEEEEECCCCCCCCCHHHCCCCEEECCCCCCCEEEECCCCCCCEECCHHCCCCCHHHHHHHHHC
T ss_conf             97456676654400042089953731157753323551242267623524520799887112121079950778999872


Q ss_pred             CCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC---CCCCEEEECCCCCCCCHHHCCCHHHHCCCHHHHH
Q ss_conf             6841000105967987765443204887417720774457743---4476689616742110011011033328866778
Q gi|254780666|r  262 SGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK---KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV  338 (445)
Q Consensus       262 ~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~---~~fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~  338 (445)
T Consensus       265 n~G~I~AnD~n~~r~~~l~~n~~rlGv~ntiv~n~D~~ef~~~~~~~~fDRVLLDAPCSGtgvi~K~~~vkt~k~~~di~  344 (460)
T KOG1122         265 NTGVIFANDSNENRLKSLKANLHRLGVTNTIVSNYDGREFPEKEFPGSFDRVLLDAPCSGTGVISKDQSVKTNKTVKDIL  344 (460)
T ss_pred             CCCEEEECCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCHHHHHHH
T ss_conf             77469961354377999998899748774489736763255333676423145348777775554551013301299998


Q ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHCCCCEEECCCCCCCCCCCCCCCCCCCCCEEEECCC
Q ss_conf             89999999999999860898289997747883439998999999688741781376323355664345586880898876
Q gi|254780666|r  339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD  418 (445)
Q Consensus       339 ~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~r~~P~  418 (445)
T Consensus       345 ~~~~LQr~LllsAi~lv~~GGvLVYSTCSI~~~ENE~vV~yaL~K~p-~~kL~p~~~~iG~~G~~~-----~~--~~~ps  416 (460)
T KOG1122         345 RYAHLQRELLLSAIDLVKAGGVLVYSTCSITVEENEAVVDYALKKRP-EVKLVPTGLDIGGEGRFR-----GG--RFHPS  416 (460)
T ss_pred             HHHHHHHHHHHHHHHHCCCCCEEEEEEEECCHHHHHHHHHHHHHHCC-CEEECCCCCCCCCCCCCC-----CC--CCCCC
T ss_conf             72799999999987311577089998532260122899999997098-627525656678887646-----75--45753


Q ss_pred             --CCCCCCCCCCCCCEEEEEEEEECC
Q ss_conf             --323557778886314667654127
Q gi|254780666|r  419 --MLEKIDGVSSGMDGFFAVALRRLI  442 (445)
Q Consensus       419 --~~~~~~~~~~g~DGFF~A~l~k~~  442 (445)
T Consensus       417 l~~~~r~yPh~hnmdgffvaKl~k~s  442 (460)
T KOG1122         417 LKLTRRFYPHVHNMDGFFVAKLKKAS  442 (460)
T ss_pred             HHHEEEECCCCCCCCHHHHHHHHHHC
T ss_conf             33403306755577517999988650