HHsearch alignment for GI: 254780666 and conserved domain: KOG1270

>KOG1270 consensus.
Probab=97.51  E-value=0.00032  Score=51.02  Aligned_cols=105  Identities=21%  Similarity=0.239  Sum_probs=77.9

Q ss_pred             CCCCCCCEECCCCCCCCCEEEECCCCCCHHHHHCCHHHHHHHHHHHHCCCCCC------EEEEECCCCCCCCCCCCCEEE
Q ss_conf             63213310035564470000102568410001059679877654432048874------177207744577434476689
Q gi|254780666|r  238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA------EDIIEMDAFDYCPKKLFDAVL  311 (445)
Q Consensus       238 ~~~~g~~VLD~CAAPGGKT~~l~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~------~~~~~~D~~~~~~~~~fD~iL  311 (445)
T Consensus        86 k~~~g~~ilDvGCGgGLLSepLArlga~V~GID~s~~~V~vA~~h~~~dP~~~~~~~y~l~~~~~~~E~~--~~~fDaVv  163 (282)
T KOG1270          86 KPLLGMKILDVGCGGGLLSEPLARLGAQVTGIDASDDMVEVANEHKKMDPVLEGAIAYRLEYEDTDVEGL--TGKFDAVV  163 (282)
T ss_pred             CCCCCCEEEEECCCCCCCCHHHHHHCCEEEEECCHHHHHHHHHHHHHCCCHHCCCCCEEEEHHHCCHHHC--CCCCCEEE
T ss_conf             4557864787236755023235750885685265599999998751049033056414630201533214--56564544


Q ss_pred             ECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             6167421100110110333288667788999999999999986089828999774
Q gi|254780666|r  312 VDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC  366 (445)
Q Consensus       312 lDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTC  366 (445)
T Consensus       164 c----s------------------evleHV~dp~~~l~~l~~~lkP~G~lfitti  196 (282)
T KOG1270         164 C----S------------------EVLEHVKDPQEFLNCLSALLKPNGRLFITTI  196 (282)
T ss_pred             E----H------------------HHHHHHHCHHHHHHHHHHHHCCCCCEEEEEH
T ss_conf             1----9------------------8999874789999999998488982586411