HHsearch alignment for GI: 254780666 and conserved domain: KOG1975

>KOG1975 consensus.
Probab=93.75  E-value=0.057  Score=34.36  Aligned_cols=129  Identities=21%  Similarity=0.266  Sum_probs=70.4

Q ss_pred             CCCCCCCCCCCCCCCEECCCCCCCCCEEEE-CCCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCC
Q ss_conf             123222356321331003556447000010-2568410001059679877654432048874177207744577434476
Q gi|254780666|r  230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQL-IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFD  308 (445)
Q Consensus       230 Sql~~~~l~~~~g~~VLD~CAAPGGKT~~l-~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~~~fD  308 (445)
T Consensus       108 s~LI~~y--~~~~~~~~~LgCGKGGDLlKw~kAgI~~~igiDIAevSI~qa~~RYrdm~~r------------~~~~~f~  173 (389)
T KOG1975         108 SVLINLY--TKRGDDVLDLGCGKGGDLLKWDKAGIGEYIGIDIAEVSINQARKRYRDMKNR------------FKKFIFT  173 (389)
T ss_pred             HHHHHHH--HCCCCCCCEECCCCCCCHHHHHHHCCCCEEEEEHHHCCHHHHHHHHHHHHHH------------HHCCCCE
T ss_conf             9999998--6122300000567762076765514563576534340099999999999866------------6413651


Q ss_pred             EEEECCCCCCCCHHHCC--CHH-----------HHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHH
Q ss_conf             68961674211001101--103-----------33288667788999999999999986089828999774788343999
Q gi|254780666|r  309 AVLVDAPCSSTGTIRRH--PDV-----------LWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE  375 (445)
Q Consensus       309 ~iLlDaPCSg~Gt~rr~--Pd~-----------~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~  375 (445)
T Consensus       174 a~f~~~Dc~~~~l~d~~e~~dp~fDivScQF~~HYaFete------e~ar~~l~Nva~~LkpGG~FIgTi------Pdsd  241 (389)
T KOG1975         174 AVFIAADCFKERLMDLLEFKDPRFDIVSCQFAFHYAFETE------ESARIALRNVAKCLKPGGVFIGTI------PDSD  241 (389)
T ss_pred             EEEEEECCCHHHHHHHCCCCCCCCCEEEEEEEEEEEECCH------HHHHHHHHHHHHHCCCCCEEEEEC------CCHH
T ss_conf             6999714416689874257898855565545675431338------889999998996358885799846------9689


Q ss_pred             HHHHHHHHC
Q ss_conf             899999968
Q gi|254780666|r  376 VVQKVLRSS  384 (445)
Q Consensus       376 vV~~fL~~~  384 (445)
T Consensus       242 ~Ii~rlr~~  250 (389)
T KOG1975         242 VIIKRLRAG  250 (389)
T ss_pred             HHHHHHHHC
T ss_conf             999999851