HHsearch alignment for GI: 254780666 and conserved domain: KOG3115

>KOG3115 consensus.
Probab=91.44  E-value=1.2  Score=24.45  Aligned_cols=175  Identities=18%  Similarity=0.233  Sum_probs=92.6

Q ss_pred             CCCEECCCCCCCCCEEEECC---------CCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCC----CCCC
Q ss_conf             33100355644700001025---------6841000105967987765443204887417720774457743----4476
Q gi|254780666|r  242 NLSVLDLCAAPGGKTAQLIV---------SGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK----KLFD  308 (445)
Q Consensus       242 g~~VLD~CAAPGGKT~~l~~---------~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~----~~fD  308 (445)
T Consensus        61 kvefaDIGCGyGGLlv~Lsp~fPdtLiLGmEIR~KVsdYVk~RI~ALR~~~a~~~~~ni~vlr~namk~lpn~f~kgqLs  140 (249)
T KOG3115          61 KVEFADIGCGYGGLLMKLAPKFPDTLILGMEIRDKVSDYVKERIQALRRTSAEGQYPNISVLRTNAMKFLPNFFEKGQLS  140 (249)
T ss_pred             CCEEEEECCCCCCHHHHCCCCCCCCEEEEEHHHHHHHHHHHHHHHHHHCCCCCCCCCCCEEEECCCHHHCCCHHHHCCCC
T ss_conf             64278604676501012054686301220012688889999999997526543345653034212022051034312334


Q ss_pred             EEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHCCCCE
Q ss_conf             68961674211001101103332886677889999999999999860898289997747883439998999999688741
Q gi|254780666|r  309 AVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPV  388 (445)
Q Consensus       309 ~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~~~~~  388 (445)
T Consensus       141 kmff~fp---------dpH-fk~----~khk~rii~~~l~~eyay~l~~gg~~ytitDv---~elh~wm~~~~e~hplfe  203 (249)
T KOG3115         141 KMFFLFP---------DPH-FKA----RKHKWRIITSTLLSEYAYVLREGGILYTITDV---KELHEWMVKHLEEHPLFE  203 (249)
T ss_pred             CCEEECC---------CHH-HHH----HHCCCEEECHHHHHHHHHHHHCCCEEEEEEEH---HHHHHHHHHHHHHCCHHH
T ss_conf             4403258---------805-766----52121012034798777422138448997008---888999999887274765


Q ss_pred             EECCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCEEEEEEEEECCCCC
Q ss_conf             781376323355664345586880898876323557778886314667654127889
Q gi|254780666|r  389 ELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK  445 (445)
Q Consensus       389 ~~~~~~~~~~~~~~~~~~~~~~g~~r~~P~~~~~~~~~~~g~DGFF~A~l~k~~~~~  445 (445)
T Consensus       204 ~lt~ee~~~d~~v~~~~~~teeg~k-v----------~r~~-g~~f~a~f~r~~~~~  248 (249)
T KOG3115         204 RLTEEEEENDPCVELLSNATEEGKK-V----------ARNG-GKKFVAVFRRIPNPA  248 (249)
T ss_pred             HCCHHHHCCCCCHHHHHHHHHHCCC-C----------CCCC-CCEEEEEEEECCCCC
T ss_conf             2134552378302233333554013-3----------3567-762100245246787