HHsearch alignment for GI: 254780666 and conserved domain: PRK01544

>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed.
Probab=98.59  E-value=1.7e-07  Score=75.30  Aligned_cols=154  Identities=21%  Similarity=0.286  Sum_probs=103.4

Q ss_pred             CCCCCEECCCCCCCCCEEEEC--CCCCCHHHHHCCHHHHHHHHHHHHCCCCCC-EEEEECCCCCCCCCCCCCEEEECCCC
Q ss_conf             213310035564470000102--568410001059679877654432048874-17720774457743447668961674
Q gi|254780666|r  240 LNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFDYCPKKLFDAVLVDAPC  316 (445)
Q Consensus       240 ~~g~~VLD~CAAPGGKT~~l~--~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~-~~~~~~D~~~~~~~~~fD~iLlDaPC  316 (445)
T Consensus       134 ~~~~~ILDLGTGSGcIaISLa~e~p~a~v~avDIS~~AL~vAk~Na~~~~v~~ri~fi~sdwfe~l~~~kFDlIVSNPPY  213 (503)
T PRK01544        134 DKFLNILELGTGSGCIAISLLCELPNANVIATDISLDAIEVAKSNAIKYEVTDRIQIIHSNWFENIGKQKFDFIVSNPPY  213 (503)
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCHHCCCCCCCCEEEECCCC
T ss_conf             55772788466679999999986789989999898999999999999808820179996553101588872479838998


Q ss_pred             CCCCHHH--------CCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEE--------ECCCCHHHC--HHHHH
Q ss_conf             2110011--------01103332886677889999999999999860898289997--------747883439--99899
Q gi|254780666|r  317 SSTGTIR--------RHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFS--------NCSLDKQDS--EEVVQ  378 (445)
Q Consensus       317 Sg~Gt~r--------r~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYs--------TCSi~~eEn--e~vV~  378 (445)
T Consensus       214 I~~~e~~~L~~eV~~yEP~lAL~ggeDGL~----~Yr~Ia~~a~~~Lkp~G~l~lEIGy~Q~e~V~~IF~~~gy~~~~~~  289 (503)
T PRK01544        214 ISHSEKSEMAIETINYEPSIALFAEEDGLQ----AYFIIAENAKQFLKPNGKIILEIGFKQAEAVTQIFLDHGYNIDSIY  289 (503)
T ss_pred             CCHHHHHHCCHHHHCCCCHHHHCCCCCCHH----HHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHHHCCCCHHHHH
T ss_conf             875666652766531693788648876289----9999999889852889889999787868999999996594377776


Q ss_pred             HHHHHCCCCEEECCCCCCC
Q ss_conf             9999688741781376323
Q gi|254780666|r  379 KVLRSSPIPVELVPLNSAY  397 (445)
Q Consensus       379 ~fL~~~~~~~~~~~~~~~~  397 (445)
T Consensus       290 kdl~~~~rvi~~~~~~~~~  308 (503)
T PRK01544        290 KDLQSHNRVIEISPINLNR  308 (503)
T ss_pred             HHHCCCCEEEEECCCCCCH
T ss_conf             6650576289962421156