HHsearch alignment for GI: 254780666 and conserved domain: PRK03612

>PRK03612 spermidine synthase; Provisional.
Probab=96.19  E-value=0.0067  Score=41.23  Aligned_cols=153  Identities=20%  Similarity=0.262  Sum_probs=96.4

Q ss_pred             HCHHHHHCCCEE--CCCC---CCC--CCCCCCCCCCCCEECCCCCCCCCEEEECCCCC--CHHHHHCCHHHHHHHHHH--
Q ss_conf             585011001013--4632---123--22235632133100355644700001025684--100010596798776544--
Q gi|254780666|r  214 SLPGFAEGVWWV--QDAS---ASI--PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA--KVTALDVSKRRLEKLRCN--  282 (445)
Q Consensus       214 ~~~~f~eG~~~V--QD~a---Sql--~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~~~--~i~A~D~~~~Rl~~l~~~--  282 (445)
T Consensus       260 ~~rLyLdG~lQ~s~~DE~~YhE~LvHp~m~~~~~-p~~VLiiGGGdG~a~revLk~~~ve~v~lVelD~~vv~lar~~~~  338 (516)
T PRK03612        260 DLRLYLNGRLQFSSRDEYRYHEALVHPALAASPR-ARRVLILGGGDGLALREVLKYPDVEQVTLVDLDPAVTELARTSPA  338 (516)
T ss_pred             CEEEEECCCCCCCCCHHHHHHHHHCCCCCCCCCC-CCEEEEECCCCCHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCC
T ss_conf             6489988923357864888776340402156999-773899837760879998648996637899518899999985721


Q ss_pred             HHCCC---CC--CEEEEECCCCCCC--CCCCCCEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHC
Q ss_conf             32048---87--4177207744577--43447668961674211001101103332886677889999999999999860
Q gi|254780666|r  283 LDRLH---LY--AEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV  355 (445)
Q Consensus       283 ~~R~g---~~--~~~~~~~D~~~~~--~~~~fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~l  355 (445)
T Consensus       339 l~~~n~~a~~DpRv~v~~~Da~~~l~~~~~~yDvIi~D~p---------dP~~~---~~~~L-----Ys~eFY~~~~~~L  401 (516)
T PRK03612        339 LRALNGGALDDPRVTVVNDDAFNWLRKLPETFDAIIVDLP---------DPSNP---ALGKL-----YSVEFYRLLKRRL  401 (516)
T ss_pred             HHHHHCCCCCCCCEEEEEHHHHHHHHHCCCCCCEEEEECC---------CCCCC---CCCCC-----CCHHHHHHHHHHC
T ss_conf             4444123234996489853789999868887888998189---------97995---22467-----5399999999844


Q ss_pred             CCCCEEEE-EECCCCHHHCHHHHHHHHHHC
Q ss_conf             89828999-774788343999899999968
Q gi|254780666|r  356 KPGGIVVF-SNCSLDKQDSEEVVQKVLRSS  384 (445)
Q Consensus       356 k~gG~lvY-sTCSi~~eEne~vV~~fL~~~  384 (445)
T Consensus       402 ~~~G~~v~qs~Sp~~~~~~f~~i~~T~~~~  431 (516)
T PRK03612        402 APDGLLVVQSTSPYFAPKAFWSIEATLEAA  431 (516)
T ss_pred             CCCCEEEEECCCCCCCCHHHHHHHHHHHHH
T ss_conf             999589993689755220346899999983