HHsearch alignment for GI: 254780666 and conserved domain: PRK06202

>PRK06202 hypothetical protein; Provisional.
Probab=95.23  E-value=0.026  Score=36.86  Aligned_cols=70  Identities=27%  Similarity=0.248  Sum_probs=54.0

Q ss_pred             CCCCCEECCCCCCCCCEEEECC---C---CCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCEEE
Q ss_conf             2133100355644700001025---6---8410001059679877654432048874177207744577434476689
Q gi|254780666|r  240 LNNLSVLDLCAAPGGKTAQLIV---S---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVL  311 (445)
Q Consensus       240 ~~g~~VLD~CAAPGGKT~~l~~---~---~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~~~fD~iL  311 (445)
T Consensus        60 ~r~~~VLDlGcG~Gdl~~~lar~a~~~g~~l~v~GiD~~~~ai~~Ar~~a~~~~~~-~~~~~~d~l~~-~~~~~DvV~  135 (233)
T PRK06202         60 DRPLTVLDLGCGGGDLAIDLARWARRDGLRLEVTAIDPDPRAIRFARANARRRGVT-FRFAVSDELVA-EGERFDVVY  135 (233)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHCCCCEEEEEECCCHHHHHHHHHHCCCCCCC-EEEEEHHHHCC-CCCCCCEEE
T ss_conf             88728998347875799999999975599638999779889999998734036983-69973432024-578875760