HHsearch alignment for GI: 254780666 and conserved domain: PRK07580

>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated.
Probab=97.75  E-value=1.6e-05  Score=60.63  Aligned_cols=108  Identities=27%  Similarity=0.289  Sum_probs=81.3

Q ss_pred             CCCCCCEECCCCCCCCCEEEECCCCCCHHHHHCCHHHHHHHHHHHHCCCCC-CEEEEECCCCCCCCCCCCCEEEECCCCC
Q ss_conf             321331003556447000010256841000105967987765443204887-4177207744577434476689616742
Q gi|254780666|r  239 TLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLY-AEDIIEMDAFDYCPKKLFDAVLVDAPCS  317 (445)
Q Consensus       239 ~~~g~~VLD~CAAPGGKT~~l~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~-~~~~~~~D~~~~~~~~~fD~iLlDaPCS  317 (445)
T Consensus        61 dl~G~rVLDaGCGtG~la~~LA~~Ga~V~avDiS~~mi~~A~~Ra~~~g~~~~v~F~~gDle~--~~G~FD~Vv~-----  133 (230)
T PRK07580         61 DLTGLSILDAGCGTGSLSIPLARRGAKVVASDISPQMVEEARERAPEAGLDGNITFEVGDLES--LLGSFDTVVC-----  133 (230)
T ss_pred             CCCCCEEEECCCCCCHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEECCCCC--CCCCCCCHHH-----
T ss_conf             978998988187867879999977998999838999999999755862787675389667654--5798660233-----


Q ss_pred             CCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCH
Q ss_conf             11001101103332886677889999999999999860898289997747883
Q gi|254780666|r  318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDK  370 (445)
Q Consensus       318 g~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~  370 (445)
T Consensus       134 --------mdvLiHYp~~d~~-------~~l~~la~~~~--~~~ifTfAP~T~  169 (230)
T PRK07580        134 --------LDVLIHYPQEDAE-------RMLAHLASLTR--GSLIFTFAPYTP  169 (230)
T ss_pred             --------CCCEEECCHHHHH-------HHHHHHHHCCC--CEEEEEECCCCH
T ss_conf             --------3715545788999-------99999972558--859999689869