HHsearch alignment for GI: 254780666 and conserved domain: PRK08287

>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated.
Probab=98.87  E-value=2.8e-08  Score=81.11  Aligned_cols=132  Identities=17%  Similarity=0.203  Sum_probs=103.6

Q ss_pred             CCCCCCCCCEECCCCCCCCCEEEE--CCCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCEEEEC
Q ss_conf             356321331003556447000010--256841000105967987765443204887417720774457743447668961
Q gi|254780666|r  236 LFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVD  313 (445)
Q Consensus       236 ~l~~~~g~~VLD~CAAPGGKT~~l--~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~~~fD~iLlD  313 (445)
T Consensus        25 kL~l~~~~vvwDIGaGsGsvsiEaa~~~p~~~V~AvE~~~~~~~~i~~N~~~fg~~nv~~i~g~Ap~~l-~~~pD~vFIG  103 (186)
T PRK08287         25 KLELHRAKHLIDVGAGTGSVSIEAALQFPSLQVTAIERNPAALRLIKENRQRFGCGNIDIIPGEAPITL-TGKADAIFMG  103 (186)
T ss_pred             HCCCCCCCEEEEECCCCCHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCHHC-CCCCCEEEEE
T ss_conf             719999999999578877899999997899889999379899999999899729998799937781103-5789849997


Q ss_pred             CCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHCCC-CEEECC
Q ss_conf             6742110011011033328866778899999999999998608982899977478834399989999996887-417813
Q gi|254780666|r  314 APCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPI-PVELVP  392 (445)
Q Consensus       314 aPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~~~-~~~~~~  392 (445)
T Consensus       104 G----sg--------------g~l-------~~il~~~~~~L~~gGriVinavtl---et~~~a~~~~~~~~~~~~e~~q  155 (186)
T PRK08287        104 G----SG--------------GHL-------TAIIDWALGHLHPGGRLVLNFILQ---ENLHSALAHLEKIGACELDCVQ  155 (186)
T ss_pred             C----CC--------------CCH-------HHHHHHHHHHCCCCCEEEEEEEEH---HHHHHHHHHHHHCCCCCEEEEE
T ss_conf             4----78--------------988-------999999997579998999982608---7799999999976997615999


Q ss_pred             CCCC
Q ss_conf             7632
Q gi|254780666|r  393 LNSA  396 (445)
Q Consensus       393 ~~~~  396 (445)
T Consensus       156 v~vs  159 (186)
T PRK08287        156 LQVS  159 (186)
T ss_pred             EEEE
T ss_conf             9901