HHsearch alignment for GI: 254780666 and conserved domain: PRK10909

>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional.
Probab=98.48  E-value=1.5e-07  Score=75.73  Aligned_cols=105  Identities=16%  Similarity=0.209  Sum_probs=80.8

Q ss_pred             CCCCCEECCCCCCCCCEEEECCCCCC-HHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC--CCCCCEEEECCCC
Q ss_conf             21331003556447000010256841-00010596798776544320488741772077445774--3447668961674
Q gi|254780666|r  240 LNNLSVLDLCAAPGGKTAQLIVSGAK-VTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPC  316 (445)
Q Consensus       240 ~~g~~VLD~CAAPGGKT~~l~~~~~~-i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~--~~~fD~iLlDaPC  316 (445)
T Consensus        51 i~~~~vLDLFAGSGalGlEALSRGA~~v~fVE~~~~~~~~i~~N~~~l~~~~~~ii~~da~~~L~~~~~~fDlIF~DPPY  130 (198)
T PRK10909         51 IVDARCLDCFAGSGALGLEALSRYAAGATLLEMDRAVSQQLIKNLATLKAGNARVVNTNALSFLAQPGTPHNVVFVDPPF  130 (198)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEHHHHHHHHCCCCCEEEEEECCCC
T ss_conf             29987998277746889999987997899997899999999999998488867999556999862559952189989997


Q ss_pred             CCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEE
Q ss_conf             2110011011033328866778899999999999998608982899977
Q gi|254780666|r  317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN  365 (445)
Q Consensus       317 Sg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsT  365 (445)
T Consensus       131 ~----------------~~~~---~~~l~~l~~--~~~L~~~gliiiE~  158 (198)
T PRK10909        131 R----------------KGLL---EETINLLEQ--NGWLADDALIYVES  158 (198)
T ss_pred             C----------------CCHH---HHHHHHHHH--CCCCCCCCEEEEEE
T ss_conf             6----------------5559---999999998--88918996999995