HHsearch alignment for GI: 254780666 and conserved domain: PRK11705

>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional.
Probab=97.47  E-value=0.00017  Score=53.17  Aligned_cols=127  Identities=17%  Similarity=0.182  Sum_probs=89.8

Q ss_pred             CCCCCCCCCCCCCCEECCCCCCCCCEEEECCC-CCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCE
Q ss_conf             23222356321331003556447000010256-84100010596798776544320488741772077445774344766
Q gi|254780666|r  231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS-GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDA  309 (445)
Q Consensus       231 ql~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~-~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~~~~fD~  309 (445)
T Consensus       157 ~~i~~kl~l~~G~~VLeIGcGWGgla~~aA~~~g~~VtgiTlS~eQ~~~a~~r~~--gl~-v~v~l~DYRd~--~g~fD~  231 (383)
T PRK11705        157 DLICRKLQLKPGMRVLDIGCGWGGLARYAAEHYGVSVVGVTISAEQQKLAQERCA--GLP-VEIRLQDYRDL--NGQFDR  231 (383)
T ss_pred             HHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHC--CCC-CEEEECCHHHC--CCCCCE
T ss_conf             9999864899999798857874999999999749759998588999999999973--898-78997152443--677355


Q ss_pred             EEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHC
Q ss_conf             896167421100110110333288667788999999999999986089828999774788343999899999968
Q gi|254780666|r  310 VLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS  384 (445)
Q Consensus       310 iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~  384 (445)
T Consensus       232 Iv------SIeM~Eh-------VG~-------~~~~~yF~~i~~lLkp~G~~~lqtI~~~--~~~~~~d~fI~kY  284 (383)
T PRK11705        232 IV------SVGMFEH-------VGP-------KNYRTYFEVVDRCLKPDGLFLLHTIGSN--KTDTNVDPWINKY  284 (383)
T ss_pred             EE------EEEHHHH-------CCH-------HHHHHHHHHHHHHCCCCCEEEEEEECCC--CCCCCCCHHHHHH
T ss_conf             99------9714865-------287-------7799999999985699973999993366--7777655128884