HHsearch alignment for GI: 254780666 and conserved domain: PRK13942

>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional.
Probab=98.41  E-value=4.6e-07  Score=72.16  Aligned_cols=105  Identities=23%  Similarity=0.260  Sum_probs=85.4

Q ss_pred             CCCCCCCCCCCEECCCCCCCCCEEEEC---CCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC-CCCCCE
Q ss_conf             223563213310035564470000102---5684100010596798776544320488741772077445774-344766
Q gi|254780666|r  234 VQLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDA  309 (445)
Q Consensus       234 ~~~l~~~~g~~VLD~CAAPGGKT~~l~---~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~-~~~fD~  309 (445)
T Consensus        69 l~~L~l~~~~~VLeIGtGsGY~tAlla~lvg~~g~V~siE~~~~l~~~A~~~l~~~~~~nv~~~~gdg~~G~~~~apfD~  148 (214)
T PRK13942         69 CELLDLDEGQKVLEIGTGSGYHAAVVAEIVGKSGKVTTIERIPELAEKAKKNLKKLGYENVEVILGDGTKGYEENAPYDR  148 (214)
T ss_pred             HHHHCCCCCCEEEEECCCCCHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCE
T ss_conf             99727999997999679952999999997476785799971799999999999863768758985675667844598127


Q ss_pred             EEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             896167421100110110333288667788999999999999986089828999774
Q gi|254780666|r  310 VLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC  366 (445)
Q Consensus       310 iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTC  366 (445)
T Consensus       149 Iiv~aa~~~------iP~~----------------------l~~qL~~gGrLV~Pvg  177 (214)
T PRK13942        149 IYVTAAGPD------IPKP----------------------LLEQLKDGGIMVIPVG  177 (214)
T ss_pred             EEEEECCCC------CCHH----------------------HHHHCCCCCEEEEEEC
T ss_conf             999851765------7899----------------------9996288958999988