HHsearch alignment for GI: 254780666 and conserved domain: PTZ00146

>PTZ00146 fibrillarin; Provisional.
Probab=97.18  E-value=0.0031  Score=43.77  Aligned_cols=117  Identities=26%  Similarity=0.240  Sum_probs=86.1

Q ss_pred             CCCCCCCCEECCCCCCCCCEEEEC---CCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC----CCCCCE
Q ss_conf             563213310035564470000102---5684100010596798776544320488741772077445774----344766
Q gi|254780666|r  237 FGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP----KKLFDA  309 (445)
Q Consensus       237 l~~~~g~~VLD~CAAPGGKT~~l~---~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~----~~~fD~  309 (445)
T Consensus       131 i~Ik~GskVLYLGAasGTTVSHVSDIVG~~G~VYAVEfSpr~~RdLl~lA~~R--~NIvPIleDAr~P~kYr~lV~~VDv  208 (296)
T PTZ00146        131 IPIKPGSKVLYLGAASGTTVSHVSDLVGPEGVVYAVEFSHRSGRDLVEMAKRR--TNIVPIIEDARYPQKYRMLVPMVDC  208 (296)
T ss_pred             CCCCCCCEEEEECCCCCCCHHHHHHHCCCCCEEEEEEECCHHHHHHHHHHHCC--CCCEEEECCCCCHHHHHHHCCCCCE
T ss_conf             44379998998514679865566650178861999970646688999997227--9833577778974675542455558


Q ss_pred             EEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHH-HHHHHHCCCCCEEEEE---ECCCCHHHCHHHHHHH
Q ss_conf             896167421100110110333288667788999999999-9999860898289997---7478834399989999
Q gi|254780666|r  310 VLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL-LQGISFVKPGGIVVFS---NCSLDKQDSEEVVQKV  380 (445)
Q Consensus       310 iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL-~~a~~~lk~gG~lvYs---TCSi~~eEne~vV~~f  380 (445)
T Consensus       209 If~DVA---------Qp----------------dQarI~~~Na~~FLK~gG~~~i~IKArsIDst~~p~~VF~~E  258 (296)
T PTZ00146        209 IFADVA---------QP----------------DQARIVALNAQHFLKNGGHFVISIKANCIDSTADPEVVFASE  258 (296)
T ss_pred             EEECCC---------CH----------------HHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCCCHHHHHHHH
T ss_conf             996178---------76----------------589999999998531698899999726632567989999999