HHsearch alignment for GI: 254780666 and conserved domain: TIGR02072

>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology.; GO: 0009102 biotin biosynthetic process.
Probab=97.53  E-value=4.9e-05  Score=57.06  Aligned_cols=136  Identities=24%  Similarity=0.295  Sum_probs=94.6

Q ss_pred             CCEECCCCCCCCCCCCCC-----CCCCCEECCCCCCCCCEEEECC--CCCCHHHHHCCHHHHHHHHHHHH----CCCCCC
Q ss_conf             101346321232223563-----2133100355644700001025--68410001059679877654432----048874
Q gi|254780666|r  222 VWWVQDASASIPVQLFGT-----LNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLD----RLHLYA  290 (445)
Q Consensus       222 ~~~VQD~aSql~~~~l~~-----~~g~~VLD~CAAPGGKT~~l~~--~~~~i~A~D~~~~Rl~~l~~~~~----R~g~~~  290 (445)
T Consensus        12 ~A~~Qr~~~~~Ll~~L~~~~~~~~~~~~vLd~GcGTG~~t~~l~~~~~~~~~~a~D~~~~ml~~a~~~~~~GWW~~~~~~   91 (272)
T TIGR02072        12 HAKIQREMAKRLLALLKEKRPSHFEPASVLDIGCGTGYLTRALLKRFPQAELIALDISEEMLAQAKEKLSEGWWQKNLKA   91 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCCCCCCEEEECCCCHHHHHHHHHHCCCCEEHHHHCCHHHHHHHHHHCCCCCCCCCCHH
T ss_conf             67999999999999887407654455435651268548999999868800123333256789999974467886576045


Q ss_pred             EEEEECCCCCCCC-CCC--CCEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             1772077445774-344--7668961674211001101103332886677889999999999999860898289997747
Q gi|254780666|r  291 EDIIEMDAFDYCP-KKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS  367 (445)
Q Consensus       291 ~~~~~~D~~~~~~-~~~--fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCS  367 (445)
T Consensus        92 ~~f~~gD~E~l~~~~~~~~~DLI~Sn------------~a~QW~~~~----------~~~l~~l~~~lk~gG~l~FStf-  148 (272)
T TIGR02072        92 VQFICGDIEKLPLEDSSFKFDLIVSN------------LALQWCDDL----------SQALSELARVLKPGGLLAFSTF-  148 (272)
T ss_pred             HHHHHHHHHHCCCCCCCCEEEHHHHH------------HHHHHCCCH----------HHHHHHHHHHCCCCCEEEEEEC-
T ss_conf             66666377717887663034127563------------588710478----------8999999975287968998613-


Q ss_pred             CCHHHCHHHHHHHHH
Q ss_conf             883439998999999
Q gi|254780666|r  368 LDKQDSEEVVQKVLR  382 (445)
Q Consensus       368 i~~eEne~vV~~fL~  382 (445)
T Consensus       149 --~~~~l~El~~~~~  161 (272)
T TIGR02072       149 --GPGTLKELRQSFG  161 (272)
T ss_pred             --CCHHHHHHHHHHH
T ss_conf             --5413499999999