HHsearch alignment for GI: 254780666 and conserved domain: TIGR02752

>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species..
Probab=97.62  E-value=0.00013  Score=53.86  Aligned_cols=124  Identities=21%  Similarity=0.244  Sum_probs=97.6

Q ss_pred             CCCCCCCCCCEECCCCCCCCCEEEEC---CCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC-CCCCCEE
Q ss_conf             23563213310035564470000102---5684100010596798776544320488741772077445774-3447668
Q gi|254780666|r  235 QLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAV  310 (445)
Q Consensus       235 ~~l~~~~g~~VLD~CAAPGGKT~~l~---~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~-~~~fD~i  310 (445)
T Consensus        39 ~~m~v~~G~~~ldvCCGt~dW~~~l~~~~G~~G~v~Gldfs~nml~~~~~k~~~~~~~~~~l~hGnam~lP~~~~~fdyv  118 (231)
T TIGR02752        39 KRMNVQKGKKALDVCCGTADWAIALAEAVGKEGEVKGLDFSENMLSVGKQKVKDAKLSNVELVHGNAMELPYDDNSFDYV  118 (231)
T ss_pred             HHHHHHHCCHHHHHCCCCHHHHHHHHHHHCCCCCEEEEHHHHHHHHHHHHHHHHHHHHHEEEECCCHHCCCCCCCCCCEE
T ss_conf             77656404121121037337888988861777716740035889999998887543200222305200178776661257


Q ss_pred             EECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHH
Q ss_conf             9616742110011011033328866778899999999999998608982899977478834399989999
Q gi|254780666|r  311 LVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKV  380 (445)
Q Consensus       311 LlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~f  380 (445)
T Consensus       119 tiGfG------lrnvPdy----------------~~vl~em~rv~kPGG~~~C~~tsqP~~~~~~q~y~~  166 (231)
T TIGR02752       119 TIGFG------LRNVPDY----------------MTVLKEMARVVKPGGKVVCLETSQPTLPGFKQLYFF  166 (231)
T ss_pred             EECCC------CCCHHHH----------------HHHHHHHHHHHCCCCCEEEEECCCCCHHHHHHHHHH
T ss_conf             75255------1230269----------------999999888627997179862577625799999999