HHsearch alignment for GI: 254780666 and conserved domain: pfam01135

>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT).
Probab=98.21  E-value=1.4e-06  Score=68.47  Aligned_cols=105  Identities=23%  Similarity=0.258  Sum_probs=84.8

Q ss_pred             CCCCCCCCCCCEECCCCCCCCCEEEE---CCCCCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCC-CCCCCCE
Q ss_conf             22356321331003556447000010---2568410001059679877654432048874177207744577-4344766
Q gi|254780666|r  234 VQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC-PKKLFDA  309 (445)
Q Consensus       234 ~~~l~~~~g~~VLD~CAAPGGKT~~l---~~~~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~-~~~~fD~  309 (445)
T Consensus        66 l~~L~l~~g~~VLeIGtGsGY~tAlLa~l~~~~g~V~~iE~~~~l~~~A~~~l~~~~~~nV~~~~gdg~~g~~~~apfD~  145 (205)
T pfam01135        66 LELLELKPGMRVLEIGSGSGYLTACFARMVGEVGRVVSIEHIPELVEIARRNLEKLGLENVIVVVGDGRQGWPEFAPYDA  145 (205)
T ss_pred             HHHCCCCCCCEEEEECCCCCHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCE
T ss_conf             99707899998999669965999999998387876999835899999999999984888658984564558833398058


Q ss_pred             EEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEC
Q ss_conf             896167421100110110333288667788999999999999986089828999774
Q gi|254780666|r  310 VLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC  366 (445)
Q Consensus       310 iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTC  366 (445)
T Consensus       146 Iiv~aa~~~------iP~----------------------~l~~qL~~gGrLv~pvg  174 (205)
T pfam01135       146 IHVGAAAPE------IPE----------------------ALIDQLKEGGRLVIPVG  174 (205)
T ss_pred             EEEEEECCC------CCH----------------------HHHHHCCCCCEEEEEEC
T ss_conf             999750676------889----------------------99996287978999987