HHsearch alignment for GI: 254780666 and conserved domain: pfam02384

>pfam02384 N6_Mtase N-6 DNA Methylase. Restriction-modification (R-M) systems protect a bacterial cell against invasion of foreign DNA by endonucleolytic cleavage of DNA that lacks a site specific modification. The R-M system is a complex containing three polypeptides: M (this family), S (pfam01420), and R. This family consists of N-6 adenine-specific DNA methylase EC:2.1.1.72 from Type I and Type IC restriction systems. These methylases have the same sequence specificity as their corresponding restriction enzymes.
Probab=98.30  E-value=2.3e-06  Score=67.01  Aligned_cols=164  Identities=16%  Similarity=0.143  Sum_probs=105.3

Q ss_pred             HHCCCEECCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEEC----C-----CCCCHHHHHCCHHHHHHHHHHHHCCCCC
Q ss_conf             100101346321232223563213310035564470000102----5-----6841000105967987765443204887
Q gi|254780666|r  219 AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI----V-----SGAKVTALDVSKRRLEKLRCNLDRLHLY  289 (445)
Q Consensus       219 ~eG~~~VQD~aSql~~~~l~~~~g~~VLD~CAAPGGKT~~l~----~-----~~~~i~A~D~~~~Rl~~l~~~~~R~g~~  289 (445)
T Consensus        24 ~~GeffTPr~Vv~lmv~ll~p~~~~~V~DPacGtGgfLi~a~~~i~~~~~~~~~~~i~G~E~~~~~~~la~mNm~lhgi~  103 (312)
T pfam02384        24 SGGEFYTPREVSKLIVELLEPKPGESIYDPACGSGGFLIQADKFVKSHDGDTNDISIYGQELNPTTYRLARMNMILHGIE  103 (312)
T ss_pred             CCCEECCCHHHHHHHHHHHCCCCCCEEECCCCCCCHHHHHHHHHHHHHCCCCCCCEEECCCCCHHHHHHHHHHHHHHCCC
T ss_conf             58635887899999999828999998821687733789999999998437855655636889989999999999984798


Q ss_pred             --CEEEEECCCCCCC---CCCCCCEEEECCCCCCCCHHHCCC--HHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEE
Q ss_conf             --4177207744577---434476689616742110011011--033328866778899999999999998608982899
Q gi|254780666|r  290 --AEDIIEMDAFDYC---PKKLFDAVLVDAPCSSTGTIRRHP--DVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV  362 (445)
Q Consensus       290 --~~~~~~~D~~~~~---~~~~fD~iLlDaPCSg~Gt~rr~P--d~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lv  362 (445)
T Consensus       104 ~~~~~i~~gdsl~~~~~~~~~kfD~IlsNPPFg~k~~~~~~~~~~~~~~~--~~~~~~~~~e~~Fiqh~l~~Lk~~Graa  181 (312)
T pfam02384       104 YNDFGIRHGDTLLSPKFEEDKKFDVVVANPPFNQKWDANDNLENDPRFRA--YGVPPKSNADFAFLQHIIYHLSPNGRAA  181 (312)
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCHHC--CCCCCCCCHHHHHHHHHHHHCCCCCEEE
T ss_conf             87455214776557676654551189837864667665432102721103--6878887442999999998569997699


Q ss_pred             EEE--CCCCHHHCHHHHHHHHHHC
Q ss_conf             977--4788343999899999968
Q gi|254780666|r  363 FSN--CSLDKQDSEEVVQKVLRSS  384 (445)
Q Consensus       363 YsT--CSi~~eEne~vV~~fL~~~  384 (445)
T Consensus       182 iVlp~g~Lf~~~~e~~iR~~lle~  205 (312)
T pfam02384       182 VVLPNGVLFRGGAEGDIRKALVEK  205 (312)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHC
T ss_conf             995582310465088999999975