HHsearch alignment for GI: 254780666 and conserved domain: pfam04816

>pfam04816 DUF633 Family of unknown function (DUF633). This family of proteins are uncharacterized have no known function.
Probab=95.56  E-value=0.081  Score=33.20  Aligned_cols=115  Identities=17%  Similarity=0.175  Sum_probs=81.3

Q ss_pred             CCCCCCCCCEEEECCCC--CCHHHHHCCHHHHHHHHHHHHCCCCCC-EEEEECCCCCCCC-CCCCCEEEECCCCCCCCHH
Q ss_conf             35564470000102568--410001059679877654432048874-1772077445774-3447668961674211001
Q gi|254780666|r  247 DLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTI  322 (445)
Q Consensus       247 D~CAAPGGKT~~l~~~~--~~i~A~D~~~~Rl~~l~~~~~R~g~~~-~~~~~~D~~~~~~-~~~fD~iLlDaPCSg~Gt~  322 (445)
T Consensus         3 DIGtDHayLpi~L~~~g~~~~aiA~Dv~~gPl~~A~~~i~~~gl~~~I~~rlgdGL~~l~~~e~vd~ivI----AGMGG-   77 (204)
T pfam04816         3 DIGSDHAYLPIYLVKNNLASFAIAGEVNKGPLQSAVKNVKKSGLTERIDVRLGDGLAVIEELDLIDVIVI----AGMGG-   77 (204)
T ss_pred             EECCCCHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCCHHCCCCCCCCCEEEE----ECCCH-
T ss_conf             1054508999999977998779996166749999999999759975389997784220586776577999----48689-


Q ss_pred             HCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCHHHHHHHHHHCCCCEEE
Q ss_conf             10110333288667788999999999999986089828999774788343999899999968874178
Q gi|254780666|r  323 RRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVEL  390 (445)
Q Consensus       323 rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne~vV~~fL~~~~~~~~~  390 (445)
T Consensus        78 -------------------~lI~~IL~~~~~~~~~~~~lI-----LQP~~~~~~lR~~L~~~g~~I~~  121 (204)
T pfam04816        78 -------------------TLIADILEQGKNKLAGVKRLI-----LQPNINEEELREWLSQNSWQIKA  121 (204)
T ss_pred             -------------------HHHHHHHHHCHHHHCCCCEEE-----EECCCCHHHHHHHHHHCCCEEEE
T ss_conf             -------------------999999981845535757799-----95797859999999988997888