HHsearch alignment for GI: 254780666 and conserved domain: pfam05175

>pfam05175 MTS Methyltransferase small domain. This domain is found in ribosomal RNA small subunit methyltransferase C as well as other methyltransferases .
Probab=99.22  E-value=2.5e-11  Score=103.75  Aligned_cols=131  Identities=21%  Similarity=0.224  Sum_probs=110.4

Q ss_pred             CCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEECCC--CCCHHHHHCCHHHHHHHHHHHHCCCCCCEEEEECCCCCCCC
Q ss_conf             4632123222356321331003556447000010256--84100010596798776544320488741772077445774
Q gi|254780666|r  226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS--GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP  303 (445)
Q Consensus       226 QD~aSql~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~--~~~i~A~D~~~~Rl~~l~~~~~R~g~~~~~~~~~D~~~~~~  303 (445)
T Consensus        16 lD~Gt~lLl~~l~~~~~g~vLDlGcG~G~i~~~la~~~p~~~v~~vDi~~~Al~~a~~N~~~n~l~~v~v~~~D~~~~~~   95 (170)
T pfam05175        16 LDIGSRLLLSHLPKPLGGKVLDLGCGYGVLGAALAKRSPDLEVTMVDINARALESARANLAANGLENGEVFWSDLYSAVE   95 (170)
T ss_pred             CCHHHHHHHHCCCCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCC
T ss_conf             79899999970897789949997764829899999978986798515449999999999998099848999744666577


Q ss_pred             CCCCCEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHC
Q ss_conf             3447668961674211001101103332886677889999999999999860898289997747883439
Q gi|254780666|r  304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS  373 (445)
Q Consensus       304 ~~~fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEn  373 (445)
T Consensus        96 ~~~fD~IvsNPP~------h---------~g~--~~~~~~~~~~i~~A~~~L~pgG~l~~V~n~~l~y~~  148 (170)
T pfam05175        96 PGKFDLIISNPPF------H---------AGK--ATDYDVAQRFIAGAARHLKPGGELWIVANRHLGYPS  148 (170)
T ss_pred             CCCEEEEEECCCC------C---------CCC--CCCHHHHHHHHHHHHHHCCCCCEEEEEEECCCCCHH
T ss_conf             8866089989772------1---------142--032899999999999961649799999989999479