HHsearch alignment for GI: 254780666 and conserved domain: pfam08003

>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698). This family contains many hypothetical proteins. It also includes two putative methyltransferase proteins.
Probab=95.98  E-value=0.03  Score=36.44  Aligned_cols=120  Identities=20%  Similarity=0.244  Sum_probs=74.5

Q ss_pred             CCCCCCCCCCCCEECCCCCCCCCEEEECCCCC-CHHHHHCCHHHHHHHHHHHHCCCCCC-EEEEECCCCCCCCCCCCCEE
Q ss_conf             22235632133100355644700001025684-10001059679877654432048874-17720774457743447668
Q gi|254780666|r  233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA-KVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFDYCPKKLFDAV  310 (445)
Q Consensus       233 ~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~~~-~i~A~D~~~~Rl~~l~~~~~R~g~~~-~~~~~~D~~~~~~~~~fD~i  310 (445)
T Consensus       107 l~~~i~~L~gk~VlDVGcgNGYy~~RMlg~ga~~viGiDPs~lf~~QF~ai~~~~~~~~~~~~lPlg~E~lp~~~~FDtV  186 (315)
T pfam08003       107 VLPHLSPLKGRTILDVGCGNGYHMWRMLGEGAALVVGIDPSELFLCQFEAVRKLLGNDQRAHLLPLGIEQLPALEAFDTV  186 (315)
T ss_pred             HHHHHCCCCCCEEEECCCCCHHHHHHHHHCCCCEEEEECCHHHHHHHHHHHHHHCCCCCCEEEECCCHHHCCCCCCCCEE
T ss_conf             87342242689887517786499998622399879988981999999999999708987568853676548663421557


Q ss_pred             EECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHCH
Q ss_conf             9616742110011011033328866778899999999999998608982899977478834399
Q gi|254780666|r  311 LVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSE  374 (445)
Q Consensus       311 LlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCSi~~eEne  374 (445)
T Consensus       187 F------sMGVLYH------rrsP~~----------hL~~Lk~~L~~gGeLvLETlvi~gd~~~  228 (315)
T pfam08003       187 F------SMGVLYH------RRSPLD----------HLLQLKDQLVKGGELVLETLVIEGDENT  228 (315)
T ss_pred             E------EEEEEEC------CCCHHH----------HHHHHHHHCCCCCEEEEEEEEECCCCCE
T ss_conf             7------6544432------689899----------9999998528797899998776598872