HHsearch alignment for GI: 254780666 and conserved domain: pfam10672

>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase. Members of this family are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species. The diversity in the roles of methylation is matched by the almost bewildering number of methyltransferase enzymes that catalyse the methylation reaction. Although several classes of methyltransferase enzymes are known, the great majority of methylation reactions are catalysed by the S-adenosylmethionine-dependent methyltransferases.
Probab=99.08  E-value=1.1e-09  Score=91.46  Aligned_cols=151  Identities=19%  Similarity=0.184  Sum_probs=111.5

Q ss_pred             CHHHHHCCCEECCCCCCCCCCCCCCCCCCCEECCCCCCCCCEEEECCCCC-CHHHHHCCHHHHHHHHHHHHCCCCC--CE
Q ss_conf             85011001013463212322235632133100355644700001025684-1000105967987765443204887--41
Q gi|254780666|r  215 LPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA-KVTALDVSKRRLEKLRCNLDRLHLY--AE  291 (445)
Q Consensus       215 ~~~f~eG~~~VQD~aSql~~~~l~~~~g~~VLD~CAAPGGKT~~l~~~~~-~i~A~D~~~~Rl~~l~~~~~R~g~~--~~  291 (445)
T Consensus       100 ~~gqktG~flDqR~nR~~~~~~---~~g~rvLn~Fsytg~fsv~A~~~GA~~v~~vD~S~~al~~a~~N~~lN~~~~~~~  176 (286)
T pfam10672       100 GRNQNFGLFLDMRLGRRWVQEN---AKGKNVLNLFAYTCGFSVAAIAGGASQVVNVDMARGSLSKGRDNHRLNGHDLGRV  176 (286)
T ss_pred             CCCCCCEEEHHHHHHHHHHHHH---CCCCCEEEECCCCCHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHCCCCCCCE
T ss_conf             4586667834238889999987---2898325311478699999876798779999198899999999999769995436


Q ss_pred             EEEECCCCCCC----CCCCCCEEEECCCCCCCCHHHCCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEECC
Q ss_conf             77207744577----43447668961674211001101103332886677889999999999999860898289997747
Q gi|254780666|r  292 DIIEMDAFDYC----PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS  367 (445)
Q Consensus       292 ~~~~~D~~~~~----~~~~fD~iLlDaPCSg~Gt~rr~Pd~~w~~~~~~l~~l~~~Q~~iL~~a~~~lk~gG~lvYsTCS  367 (445)
T Consensus       177 ~~~~~D~f~~l~~~~~~~~fD~VilDPPsf~k~-------------~~~~~---~~Y~~l~~~a~~ll~~gG~L~~~s~s  240 (286)
T pfam10672       177 SFLGHDIFKSWGKIKKLGPYDLVIIDPPSFQKG-------------SFALT---KDYKKILRRLPELLVEGGTVLACVNS  240 (286)
T ss_pred             EEEEEHHHHHHHHHHCCCCCCEEEECCCCCCCC-------------HHHHH---HHHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             999830999999986179998799879998887-------------24788---78999999999860899689998188


Q ss_pred             CCHHHCHHHHHHHHHHCC
Q ss_conf             883439998999999688
Q gi|254780666|r  368 LDKQDSEEVVQKVLRSSP  385 (445)
Q Consensus       368 i~~eEne~vV~~fL~~~~  385 (445)
T Consensus       241 ~~l~~-~~~~~~~~~~~~  257 (286)
T pfam10672       241 PAVGP-DFLIEEMAEEAP  257 (286)
T ss_pred             CCCCH-HHHHHHHHHHCC
T ss_conf             65899-999999998587