BLAST/PSIBLAST alignment of GI: 254780666 and GI: 227823840 at iteration 1
>gi|227823840|ref|YP_002827813.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234] Length = 473
>gi|227342842|gb|ACP27060.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234] Length = 473
 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 299/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ +  SL  +LD E+G+ A+R L+  D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVIDRNTSLDGMLDQEHGNPAYRELNDADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+ AQILYLD+ D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAAAQILYLDIPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK  +L+ +  +  IP WF ERL   YG+    AIS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKQAILEALQTVPAIPAWFYERLVAHYGRAEAEAISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK +   WA +L   +LPTG +RL +   +I SLPGF+EG WWVQDA+ASIP +LFG L+
Sbjct: 214 VKSEPALWAERLGGTVLPTGSVRLGDFTGTIPSLPGFSEGAWWVQDAAASIPARLFGDLS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             +V+DLCAAPGGKTAQLI++GAKVTALD S  RL +L+ NL+RL L A    E D  ++
Sbjct: 274 GKTVVDLCAAPGGKTAQLILAGAKVTALDQSSSRLRRLKANLERLGLEAR-TKETDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P +LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ V+PGGIV
Sbjct: 333 RPDELFDAALLDAPCSSTGTTRRHPDVLWTKGPGDVEKLARLQERLLRHALTVVRPGGIV 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD ++ EEVV +V+       E +P+ ++ W  ++   A++  G  R TP ML 
Sbjct: 393 VFSNCSLDPREGEEVVARVVADG--DCERLPIAASDWPGLE--AAITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                S+G+DGF+A  LRR
Sbjct: 449 LDQPFSAGLDGFYAAVLRR 467