BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein
[Candidatus Liberibacter asiaticus str. psy62]
         (445 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040343|gb|ACT57139.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 445

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/445 (100%), Positives = 445/445 (100%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL
Sbjct: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF
Sbjct: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL
Sbjct: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL
Sbjct: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD
Sbjct: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI
Sbjct: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML
Sbjct: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420

Query: 421 EKIDGVSSGMDGFFAVALRRLIQPK 445
           EKIDGVSSGMDGFFAVALRRLIQPK
Sbjct: 421 EKIDGVSSGMDGFFAVALRRLIQPK 445


>gi|315122151|ref|YP_004062640.1| Fmu (Sun) domain protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495553|gb|ADR52152.1| Fmu (Sun) domain protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 443

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/442 (78%), Positives = 393/442 (88%), Gaps = 2/442 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKSGMNARLV++HLLSCV RKRISLTCLLD E GD AFR LS +DQ LVRAI++ TLRFL
Sbjct: 1   MKSGMNARLVAAHLLSCVTRKRISLTCLLDPERGDIAFRKLSHKDQALVRAILSTTLRFL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDAVLD +L+SSL +KK SL+QL R+S+AQILYLDVADYAVVDLAVEQAKRD+ENRHF
Sbjct: 61  PRIDAVLDLLLVSSLSKKKQSLRQLFRISIAQILYLDVADYAVVDLAVEQAKRDQENRHF 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           + LVNSILRRVSREK ELLQR + IS+IP+WFK+RLE+FYGKE    IS AC++P Y+DL
Sbjct: 121 SNLVNSILRRVSREKTELLQRFSSISVIPQWFKKRLEDFYGKESTYCISQACLTPSYVDL 180

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK DIE WA+KLNAV+LPTGGIRL+E   S+ SLPGFAEGVWWVQDASASIPVQLFG L
Sbjct: 181 TVKSDIEIWANKLNAVVLPTGGIRLREFRGSVSSLPGFAEGVWWVQDASASIPVQLFGPL 240

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           N LSVLDLCAAPGGKTAQLI+SGAKVTALD+S  RLEKL+ NL+RL L A++IIE DAFD
Sbjct: 241 NGLSVLDLCAAPGGKTAQLILSGAKVTALDISNNRLEKLQHNLNRLRLCADNIIEGDAFD 300

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           Y PKKLFDAVLVDAPCSSTGT+RRHPDVLWTRD +DIV+SACFQ +LLL G++ VKPGGI
Sbjct: 301 YRPKKLFDAVLVDAPCSSTGTMRRHPDVLWTRDAEDIVRSACFQERLLLHGLALVKPGGI 360

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VVFSNCSLDKQDSE+VV+KVLRSS IPVE++ LN+A W   +MAMA++PEGW+RITPDML
Sbjct: 361 VVFSNCSLDKQDSEDVVRKVLRSSLIPVEIMSLNNASWN--NMAMAITPEGWLRITPDML 418

Query: 421 EKIDGVSSGMDGFFAVALRRLI 442
            +I+GV SGMDGFFAVALRRLI
Sbjct: 419 GEIEGVPSGMDGFFAVALRRLI 440


>gi|209551488|ref|YP_002283405.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537244|gb|ACI57179.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 462

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 227/441 (51%), Positives = 303/441 (68%), Gaps = 4/441 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ +L  V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR L
Sbjct: 25  VKPGLQARAAAAKILGAVVERKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHL 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDA +  +L S LP    +LQ +L + VAQILYLDV D++ VDLAVEQA +D  NR F
Sbjct: 85  PRIDAAISSLLESPLPEGARALQHVLAIGVAQILYLDVPDHSAVDLAVEQANQDPRNRRF 144

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVN++LRR+ REK E+L  I  ++ +P WF  RLE  YG++  LAIS++ + P  IDL
Sbjct: 145 AKLVNAVLRRLGREKDEVLGEIDKVAPMPAWFIARLEKAYGRDAALAISESQLQPAAIDL 204

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +LN V+LPTGG+RL      I SL GF +G WWVQDA+ASIP +LFG L
Sbjct: 205 TVKSDAEGWAKRLNGVVLPTGGVRLAAFDGGIPSLEGFDDGAWWVQDAAASIPAKLFGDL 264

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +     DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  I  D   
Sbjct: 265 SGKRAADLCAAPGGKTAQLILAGGAVTALDQSESRLRRLRSNLDRLSLKAE-TIAADLTT 323

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP G 
Sbjct: 324 FEPAERFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIGRLAALQERLLRHALTLLKPDGT 383

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSLD  + EEVV +VL  +   +E V +++  W  ++   A++P G  R  P ML
Sbjct: 384 LVFSNCSLDPTEGEEVVARVLADTD-GIERVRIDAGDWPGLE--AAITPLGEFRTLPTML 440

Query: 421 EKIDGVSSGMDGFFAVALRRL 441
           +  DG++SG+DGF+A  LRR+
Sbjct: 441 KMPDGIASGLDGFYAAMLRRV 461


>gi|86359687|ref|YP_471579.1| RNA methyltransferase - sun protein [Rhizobium etli CFN 42]
 gi|86283789|gb|ABC92852.1| probable RNA methyltransferase - sun protein [Rhizobium etli CFN
           42]
          Length = 464

 Score =  450 bits (1157), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/440 (52%), Positives = 300/440 (68%), Gaps = 4/440 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR L
Sbjct: 27  LKPGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHL 86

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR F
Sbjct: 87  PRIDAAIASLLESPLPEGARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRF 146

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVN++LRR+ REK E+L RI  ++ +P WF  RLE  YG++  LAIS + + P  IDL
Sbjct: 147 AKLVNAVLRRLGREKDEVLARIGKVAPMPSWFLARLEKAYGRDAALAISQSQLEPAAIDL 206

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +LN V LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG L
Sbjct: 207 TVKSDAEGWAKRLNGVALPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDL 266

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +     DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  +  D   
Sbjct: 267 SGKRAADLCAAPGGKTAQLILAGGAVTALDQSESRLRRLRSNLDRLALKAE-TVAADLMT 325

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P + FDA+L+DAPCSSTGT RRHPDVLWT+  DDI + A  Q +LL   ++ +KP G 
Sbjct: 326 FKPSEGFDAILLDAPCSSTGTTRRHPDVLWTKGPDDIARLAALQERLLRHALTLLKPLGT 385

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSLD  + EEVV +VL S    +E V +N+  W  ++   A++P G  R  P ML
Sbjct: 386 LVFSNCSLDPAEGEEVVARVL-SDTNAIERVAINAGDWPGLE--AAITPLGEFRTLPTML 442

Query: 421 EKIDGVSSGMDGFFAVALRR 440
           +  DG++SG+DGF+A  LRR
Sbjct: 443 KMPDGIASGLDGFYAAVLRR 462


>gi|116254448|ref|YP_770286.1| ribosomal RNA small subunit methyltransferase B [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259096|emb|CAK10207.1| putative ribosomal RNA small subunit methyltransferase B [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 460

 Score =  449 bits (1154), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 232/440 (52%), Positives = 300/440 (68%), Gaps = 4/440 (0%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A+R L + D+ LVRAI+N TLR LP
Sbjct: 24  KLGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYRALGESDRALVRAILNTTLRHLP 83

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR FA
Sbjct: 84  RIDAAIAGLLDSPLPEGARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRFA 143

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN+ILRR+ REK ++L  I  ++ +P WF  RLE  YG++  LAIS++ + P  IDLT
Sbjct: 144 KLVNAILRRLGREKEQVLADIGKVAPMPAWFIARLEKAYGRDAALAISESQLEPAAIDLT 203

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +LN V+LPTGGIRL      I SL GF EG WWVQDA+ASIP +LFG L 
Sbjct: 204 VKSDPEGWAKRLNGVVLPTGGIRLAAFDGGIPSLEGFDEGAWWVQDAAASIPAKLFGDLA 263

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
                DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  I  D   +
Sbjct: 264 GKRTADLCAAPGGKTAQLILAGGAVTALDQSENRLRRLRSNLDRLGLKAE-TIAADLTTF 322

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KPGG +
Sbjct: 323 GPTERFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPGGTL 382

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + E+VV +VL S    VE VP+ +  W  ++   A++P G  R  P ML+
Sbjct: 383 VFSNCSLDPVEGEDVVARVL-SDTDAVERVPIGAGDWPGLE--AAITPLGEFRTLPTMLK 439

Query: 422 KIDGVSSGMDGFFAVALRRL 441
             DG+ SG+DGF+A  LRRL
Sbjct: 440 MPDGIGSGLDGFYAAVLRRL 459


>gi|218460752|ref|ZP_03500843.1| RNA methyltransferase - sun protein [Rhizobium etli Kim 5]
          Length = 466

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/440 (51%), Positives = 299/440 (67%), Gaps = 4/440 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR L
Sbjct: 29  VKPGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHL 88

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR F
Sbjct: 89  PRIDAAIASLLESPLPEGARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRF 148

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVN++LRR+ REK E+L  I  ++ +P WF  RLE  YG+E  LAIS + + P  IDL
Sbjct: 149 AKLVNAVLRRLGREKEEVLAEIGKVAPMPSWFLARLEKAYGREAALAISQSQLEPAAIDL 208

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +LN V LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG L
Sbjct: 209 TVKSDAEGWAKRLNGVALPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDL 268

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
                 DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  +  D   
Sbjct: 269 AGKRAADLCAAPGGKTAQLILAGGAVTALDQSESRLRRLRSNLDRLGLTAE-TVAADLTT 327

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P + FDA+L+DAPCSSTGT RRHPDVLWT+  DDI + A  Q +LL   ++ + P G+
Sbjct: 328 FKPPEGFDAILLDAPCSSTGTTRRHPDVLWTKGPDDIARLAALQERLLRHALTLLTPFGM 387

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSLD  + EEVV +VL S    +E VP+N+  W  ++   A++P G  R  P ML
Sbjct: 388 LVFSNCSLDPAEGEEVVARVL-SDTDAIERVPINAGDWPGLE--AAITPLGEFRTLPTML 444

Query: 421 EKIDGVSSGMDGFFAVALRR 440
           +  +G++SG+DGF+A  LRR
Sbjct: 445 KMPEGIASGLDGFYAAVLRR 464


>gi|222087916|ref|YP_002546454.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein
           [Agrobacterium radiobacter K84]
 gi|221725364|gb|ACM28520.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein
           [Agrobacterium radiobacter K84]
          Length = 469

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 229/439 (52%), Positives = 298/439 (67%), Gaps = 4/439 (0%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR  ++ +LS V+ ++  L  +LD E G+ A++ L   D+ LVRAI+N  LR LP
Sbjct: 33  KPGFAARAAAAKILSAVIDRKTPLDGMLDAEGGNPAYKALGDSDRALVRAILNSALRHLP 92

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+A +  +L S LP    +L  +L V  AQ+LYLDV D++ VD+AVEQA +D  NR FA
Sbjct: 93  RIEAAIASLLDSPLPEGARALHHVLVVGAAQMLYLDVPDHSAVDIAVEQANQDPRNRRFA 152

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN+ILRR+ REK ++L + A +  +P+WF  RLE  YG++  L ISD  + P  ID+T
Sbjct: 153 KLVNAILRRIGREKQDILSQGADVPAMPKWFLTRLEAAYGRQAALKISDTQLEPAAIDVT 212

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +LN V+LPTGG+RL     SI SL GFA+G WWVQDA+ASIP +LFG+L 
Sbjct: 213 VKSDAEGWAKRLNGVVLPTGGVRLAAFEGSIPSLDGFADGEWWVQDAAASIPAKLFGSLA 272

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQLI++G KVTALD S  RL++L  NL RL L AE ++  D   +
Sbjct: 273 GQRVVDLCAAPGGKTAQLILAGGKVTALDQSANRLKRLSGNLARLGLEAETVV-ADMAKF 331

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P  LFDA L+DAPCSSTGT RRHPDVLWT+  +DI K    Q +LL   ++ VKPGG+V
Sbjct: 332 QPDDLFDAALLDAPCSSTGTTRRHPDVLWTKGPEDIAKLTALQERLLRHALTLVKPGGLV 391

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD ++ E++V +VL  + +  E V +    W  ++   A+SP G  R TPDML 
Sbjct: 392 VFSNCSLDPEEGEDLVARVLSETDM-AERVAIKPEDWPGLE--AAISPLGAFRTTPDMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
              G +SG+DGFFAV LRR
Sbjct: 449 LSGGFASGLDGFFAVVLRR 467


>gi|241206925|ref|YP_002978021.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860815|gb|ACS58482.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 460

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 228/440 (51%), Positives = 302/440 (68%), Gaps = 4/440 (0%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A+R L + D+ LVRAI+N TLR LP
Sbjct: 24  KPGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYRALGESDRALVRAILNTTLRHLP 83

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA  D  NR FA
Sbjct: 84  RIDAAIAGLLDSPLPEGARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANLDPRNRRFA 143

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN+ILRR+ REK ++L +I  ++ +P WF  RLE  YG++  LAIS++ + P  IDLT
Sbjct: 144 KLVNAILRRLGREKEQVLDQIGKVAPMPAWFIARLEKAYGRDAALAISESQLEPAAIDLT 203

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +LN V+LPTG +RL     SI S+ GF EG WWVQDA+ASIP +LFG L 
Sbjct: 204 VKSDPEDWAKRLNGVVLPTGSVRLAAFDGSIPSVEGFDEGAWWVQDAAASIPAKLFGDLL 263

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
                DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  I  D   +
Sbjct: 264 GKRTADLCAAPGGKTAQLILAGGAVTALDQSESRLRRLRSNLDRLGLKAE-TIAADLTTF 322

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KPGG +
Sbjct: 323 EPAERFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPGGTL 382

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + E+VV +VL S    VE VP+ ++ W  ++   A++P G  R  P ML+
Sbjct: 383 VFSNCSLDPVEGEDVVARVL-SDTDAVERVPIGASDWPGLE--AAITPLGEFRTLPTMLK 439

Query: 422 KIDGVSSGMDGFFAVALRRL 441
             +G++SG+DGF+A  LRR+
Sbjct: 440 MPEGIASGLDGFYAAVLRRV 459


>gi|150398383|ref|YP_001328850.1| Fmu (Sun) domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150029898|gb|ABR62015.1| Fmu (Sun) domain protein [Sinorhizobium medicae WSM419]
          Length = 470

 Score =  439 bits (1129), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 220/439 (50%), Positives = 303/439 (69%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ ++  L  +LD E G+  +R L+  D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVVDRKTPLDGMLDPERGNPVYRELNDADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+ AQILYLDV D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAAAQILYLDVPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK  +L+R+  +  +P WF +RL   YG+++   ISDA + P  ID+T
Sbjct: 154 SLVNAVLRRLSREKEAILERLQQVPAMPGWFFDRLVTCYGRDQAERISDAQLVPAAIDVT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D  +WA +LN  +LPTG +RL++   SI SLPGF+EG WWVQDA+ASIP +LFG ++
Sbjct: 214 VKSDAASWADRLNGTVLPTGSVRLQDFDGSIPSLPGFSEGGWWVQDAAASIPARLFGDIS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQL+++GAKV ALD S  RL +L+ NL+RL L +    E D  D+
Sbjct: 274 GRKVVDLCAAPGGKTAQLVLAGAKVIALDQSSSRLRRLKANLERLGLESA-TKEADMADF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDA L+DAPCSSTGT RRHPDVLWT+  DD+ K A  Q +LL   ++ VKPGG++
Sbjct: 333 RPEELFDAALLDAPCSSTGTTRRHPDVLWTKGPDDVEKLAGLQERLLRHALTLVKPGGLL 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD ++ EEVV +V+       E VP+++A W  ++   A++  G  R TP ML 
Sbjct: 393 VFSNCSLDPREGEEVVARVVADG--GCERVPIDAAAWPGLE--QAITALGEFRTTPAMLS 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                +SG+DGF+A  LRR
Sbjct: 449 LGPPFASGLDGFYAAVLRR 467


>gi|227823840|ref|YP_002827813.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234]
 gi|227342842|gb|ACP27060.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234]
          Length = 473

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 299/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ +  SL  +LD E+G+ A+R L+  D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVIDRNTSLDGMLDQEHGNPAYRELNDADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+ AQILYLD+ D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAAAQILYLDIPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK  +L+ +  +  IP WF ERL   YG+    AIS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKQAILEALQTVPAIPAWFYERLVAHYGRAEAEAISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK +   WA +L   +LPTG +RL +   +I SLPGF+EG WWVQDA+ASIP +LFG L+
Sbjct: 214 VKSEPALWAERLGGTVLPTGSVRLGDFTGTIPSLPGFSEGAWWVQDAAASIPARLFGDLS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             +V+DLCAAPGGKTAQLI++GAKVTALD S  RL +L+ NL+RL L A    E D  ++
Sbjct: 274 GKTVVDLCAAPGGKTAQLILAGAKVTALDQSSSRLRRLKANLERLGLEAR-TKETDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P +LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ V+PGGIV
Sbjct: 333 RPDELFDAALLDAPCSSTGTTRRHPDVLWTKGPGDVEKLARLQERLLRHALTVVRPGGIV 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD ++ EEVV +V+       E +P+ ++ W  ++   A++  G  R TP ML 
Sbjct: 393 VFSNCSLDPREGEEVVARVVADG--DCERLPIAASDWPGLE--AAITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                S+G+DGF+A  LRR
Sbjct: 449 LDQPFSAGLDGFYAAVLRR 467


>gi|325294195|ref|YP_004280059.1| SUN protein [Agrobacterium sp. H13-3]
 gi|325062048|gb|ADY65739.1| SUN protein [Agrobacterium sp. H13-3]
          Length = 461

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 224/439 (51%), Positives = 293/439 (66%), Gaps = 11/439 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR+ ++ +L+ V+ K+ SL  +LD E G+  +R LS  D+ LVRAIVN  LR LP
Sbjct: 33  KPGLAARVAATRILAAVLEKKTSLDGMLDSENGNPVYRALSLADRALVRAIVNSALRHLP 92

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+A L  +L   LP+   SL  +L V  AQ+L+LDV D++ VDLAVEQA RD  NR FA
Sbjct: 93  RIEAALSMLLDGPLPQGARSLHHVLVVGAAQVLHLDVPDHSAVDLAVEQAHRDPRNRRFA 152

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK E+ + IA + ++P+WF  RL + YG E    IS+A ++P  IDLT
Sbjct: 153 KLVNAVLRRLGREKAEIEKAIADVPVLPDWFYARLVSAYGDEVAKRISEAQLTPSSIDLT 212

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KL   +LP G +RL E    I SL GFAEG WWVQD +AS+PV+L G ++
Sbjct: 213 VKKDQAVWAEKLGGTVLPNGSVRLGEFEGQIPSLEGFAEGAWWVQDLAASMPVKLMGDIS 272

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQL ++GAKVTALD S  RL +LR NLDRL L+AE  +E +   Y
Sbjct: 273 GKRVADLCAAPGGKTAQLALAGAKVTALDQSGNRLRRLRENLDRLGLHAE-TVEANMLKY 331

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDAVL+DAPCSSTGT+R+HPDV WT+D +DI K A  Q ++L   ++ V  GGIV
Sbjct: 332 QPEQLFDAVLLDAPCSSTGTLRKHPDVCWTKDENDIAKLAALQGQMLRHALTLVGAGGIV 391

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + E ++ +VL  +P   E V +    W    M  A++ EG +R TPDM  
Sbjct: 392 VFSNCSLDPSEGEAMIAQVLAENP-DFERVAVRKDDWPG--MEAAVTAEGDLRTTPDMF- 447

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G+DGFF+  LR+
Sbjct: 448 ------GGIDGFFSSVLRK 460


>gi|159185402|ref|NP_355752.2| Sun protein [Agrobacterium tumefaciens str. C58]
 gi|159140651|gb|AAK88537.2| Sun protein [Agrobacterium tumefaciens str. C58]
          Length = 461

 Score =  435 bits (1118), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 293/439 (66%), Gaps = 11/439 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR+ ++ +L+ V+ K+ S+  +LD E G+  +R LS  D+ LVRA+VN  LR LP
Sbjct: 33  KPGLAARIAATRILAAVLEKKTSMDGMLDSENGNPVYRALSLADRALVRAVVNSALRHLP 92

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+  L  +L   LP+   SL  +L V  AQ+LYLDV D++ VDLAVEQA RD  NR F 
Sbjct: 93  RIETALSMLLDGPLPQGARSLHHVLVVGAAQMLYLDVPDHSAVDLAVEQAHRDPRNRRFV 152

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK E+ + IA + ++PEWF  RL + YG E    IS A ++P  IDLT
Sbjct: 153 KLVNAVLRRLGREKAEIEKAIADVPVLPEWFYARLVSAYGDEVAQRISQAQLTPSCIDLT 212

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L   ++P G +RL E    I SL GFAEG WWVQD +AS+PV+L G ++
Sbjct: 213 VKADPALWAERLGGTLMPNGSVRLGEFEGQIPSLDGFAEGAWWVQDLAASMPVRLLGDIS 272

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQL ++GA+VTALD S  RL +LR NLDRL L+AE  +E +   Y
Sbjct: 273 GKRVADLCAAPGGKTAQLALAGARVTALDQSGNRLRRLRENLDRLGLHAE-TVEANMLKY 331

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDAVL+DAPCSSTGT+R+HPDV WT+D +DI K A  Q ++L   ++ V PGG+V
Sbjct: 332 QPEQLFDAVLLDAPCSSTGTLRKHPDVCWTKDENDIAKLAALQGQMLRHALTLVGPGGLV 391

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EE++ +VL  +P  VE V ++   W    M  A+S  G +R TPDM  
Sbjct: 392 VFSNCSLDPSEGEEMIAEVLAENP-DVERVAVHREDWPG--MEAAISAAGDLRTTPDMF- 447

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G+DGFF+  LR+
Sbjct: 448 ------GGVDGFFSSVLRK 460


>gi|190893964|ref|YP_001980506.1| RNA methyltransferase - sun protein [Rhizobium etli CIAT 652]
 gi|190699243|gb|ACE93328.1| probable RNA methyltransferase - sun protein [Rhizobium etli CIAT
           652]
          Length = 464

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 223/440 (50%), Positives = 297/440 (67%), Gaps = 4/440 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR L
Sbjct: 27  VKPGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHL 86

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR F
Sbjct: 87  PRIDAAIASLLESPLPEGARALHHVLSIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRF 146

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVN++LRR+ REK  +L  I  ++ +P WF  RLE  YG++  LAIS + + P  IDL
Sbjct: 147 AKLVNAVLRRLGREKDPVLAEIDKVAPMPSWFLARLEKAYGRDAALAISQSQLEPAAIDL 206

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +LN V LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG L
Sbjct: 207 TVKSDAEGWAKRLNGVALPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDL 266

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +     DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  +  D   
Sbjct: 267 SGKRAADLCAAPGGKTAQLILAGGTVTALDQSESRLRRLRSNLDRLGLKAE-TVAADLTT 325

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP G 
Sbjct: 326 FKPAEGFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPLGT 385

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSLD  + EEVV +VL S    +E V +++  W  ++   A++  G  R  P ML
Sbjct: 386 LVFSNCSLDPAEGEEVVARVL-SDTDAIERVAISAGDWPGLE--AAITSLGEFRTLPTML 442

Query: 421 EKIDGVSSGMDGFFAVALRR 440
           +  +G++SG+DGF+A  LRR
Sbjct: 443 KMPEGIASGLDGFYAAVLRR 462


>gi|195970119|ref|NP_387430.2| putative sun protein [Sinorhizobium meliloti 1021]
 gi|307302539|ref|ZP_07582296.1| Fmu (Sun) domain protein [Sinorhizobium meliloti BL225C]
 gi|187904238|emb|CAC47903.2| Hypothetical Sun protein [Sinorhizobium meliloti 1021]
 gi|306903209|gb|EFN33799.1| Fmu (Sun) domain protein [Sinorhizobium meliloti BL225C]
          Length = 470

 Score =  431 bits (1109), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 300/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ ++  L  +LD E G+ A+R LS+ D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVVDRKTPLDGMLDPERGNPAYRELSEADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+  QILYLDV D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAATQILYLDVPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK E+L+++  +  +P WF +RL   YG ++   IS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKEEILEKLRQVPAMPGWFFDRLVACYGPDQAERISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D  +WA +L   +LPTG +RL+E   SI SL GF+EG WWVQDA+ASIP +LFG ++
Sbjct: 214 VKSDAASWAERLAGTVLPTGSVRLQEFSGSIPSLSGFSEGAWWVQDAAASIPARLFGDIS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQL+++GA+VTALD S  RL +L+ NL+RL   A    E D  ++
Sbjct: 274 GKKVVDLCAAPGGKTAQLVLAGAEVTALDQSSSRLRRLKANLERLGFEAR-TKESDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ VKPGG++
Sbjct: 333 RPEELFDAALLDAPCSSTGTTRRHPDVLWTKGPQDVEKLARLQERLLRHALTLVKPGGLI 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EEVV +V+  S    E VP+++A W  ++   A++  G  R TP ML 
Sbjct: 393 VFSNCSLDPLEGEEVVARVVADS--GCERVPIDAADWPGLE--KAITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                + G+DGF+A  LRR
Sbjct: 449 LEPPFAGGLDGFYAAVLRR 467


>gi|307316130|ref|ZP_07595574.1| Fmu (Sun) domain protein [Sinorhizobium meliloti AK83]
 gi|306897970|gb|EFN28712.1| Fmu (Sun) domain protein [Sinorhizobium meliloti AK83]
          Length = 470

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 218/439 (49%), Positives = 300/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ ++  L  +LD E G+ A+R LS+ D+ LVRAI+N  LR LP
Sbjct: 34  KLGLKSRQAAAKILAAVVDRKTPLDGMLDPERGNPAYRELSEADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+  QILYLDV D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAATQILYLDVPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK E+L+++  +  +P WF +RL   YG ++   IS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKEEILEKLRQVPAMPGWFFDRLVACYGPDQAERISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D  +WA +L   +LPTG +RL+E   SI SL GF+EG WWVQDA+ASIP +LFG ++
Sbjct: 214 VKSDAASWAERLAGTVLPTGSVRLQEFSGSIPSLSGFSEGAWWVQDAAASIPARLFGDIS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQL+++GA+VTALD S  RL +L+ NL+RL   A    E D  ++
Sbjct: 274 GKKVVDLCAAPGGKTAQLVLAGAEVTALDQSSSRLRRLKANLERLGFEAR-TKESDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ VKPGG++
Sbjct: 333 RPEELFDAALLDAPCSSTGTTRRHPDVLWTKGPQDVEKLARLQERLLRHALTLVKPGGLI 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EEVV +V+  S    E VP+++A W  ++   A++  G  R TP ML 
Sbjct: 393 VFSNCSLDPLEGEEVVARVVADS--GCERVPIDAADWPGLE--KAITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                + G+DGF+A  LRR
Sbjct: 449 LEPPFAGGLDGFYAAVLRR 467


>gi|327191218|gb|EGE58261.1| putative RNA methyltransferase - sun protein [Rhizobium etli
           CNPAF512]
          Length = 464

 Score =  429 bits (1103), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/440 (50%), Positives = 296/440 (67%), Gaps = 4/440 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR L
Sbjct: 27  VKPGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHL 86

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR F
Sbjct: 87  PRIDAAIASLLESPLPEGARALHHVLSIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRF 146

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVN++LRR+ REK  +L  I  ++ +P WF  RLE  YG++  LAIS + + P  IDL
Sbjct: 147 AKLVNAVLRRLGREKDAVLAEIGKVAPMPSWFLARLEKAYGRDAALAISQSQLEPGAIDL 206

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +LN V L TGG+RL      I SL GF EG WWVQDA+ASIP +LFG L
Sbjct: 207 TVKSDAEGWAKRLNGVALLTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDL 266

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +     DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  +  D   
Sbjct: 267 SGKRAADLCAAPGGKTAQLILAGGTVTALDQSESRLRRLRSNLDRLGLKAE-TVAADLTT 325

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP G 
Sbjct: 326 FKPAEGFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPLGT 385

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSLD  + EEVV +VL S    +E V +++  W  ++   A++  G  R  P ML
Sbjct: 386 LVFSNCSLDPAEGEEVVARVL-SDTDAIERVAISAGDWPGLE--AAITSLGEFRTLPTML 442

Query: 421 EKIDGVSSGMDGFFAVALRR 440
           +  +G++SG+DGF+A  LRR
Sbjct: 443 KMPEGIASGLDGFYAAVLRR 462


>gi|222150167|ref|YP_002551124.1| Sun protein [Agrobacterium vitis S4]
 gi|221737149|gb|ACM38112.1| Sun protein [Agrobacterium vitis S4]
          Length = 493

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 217/450 (48%), Positives = 298/450 (66%), Gaps = 15/450 (3%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR+ +S LL+ V+ ++ SL  ++D ++G+ A+  LS+ D+ LVRAI+N +LRFLP
Sbjct: 49  KPGLEARMAASRLLAAVIDRKTSLDGMMDGDHGNPAYAALSEADRGLVRAILNTSLRFLP 108

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+A+L  +L + LP    +L   L V+ AQ++YLDV D++ VDLAVEQA RD  +R FA
Sbjct: 109 RIEAMLARLLDAPLPDGARALYHSLIVAAAQMVYLDVPDHSAVDLAVEQANRDPRSRRFA 168

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK  LL  +  +  +P+WF ERL   YG+E    I+ A ++P  IDLT
Sbjct: 169 KLVNAVLRRLGREKQALLADVEDVICMPDWFFERLIAVYGEEEARRIAQAQLTPAAIDLT 228

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KLN V+LPTG IRL     ++ +LPGF EG WWVQDA+A++PV++FG+L 
Sbjct: 229 VKADPAVWAEKLNGVVLPTGSIRLASFAGAVSALPGFEEGAWWVQDAAAALPVRMFGSLE 288

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA----EDIIEMD 297
               +DLCAAPGGKTAQL  +GA VTA++ S  RL++L  NL RL   A    +D++E +
Sbjct: 289 GKRAVDLCAAPGGKTAQLAAAGAVVTAVEQSANRLKRLNGNLQRLGFSAQLVHQDLMEFN 348

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
             +  P   FDAVL+DAPCSSTGT RRHPDV +T+   DIVK A  Q +LL   ++ + P
Sbjct: 349 LGEDHPG--FDAVLLDAPCSSTGTTRRHPDVFYTKGPQDIVKLAGVQERLLRHAVTLLAP 406

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG +VFSNCSLD Q+ E+VV +VL   P  +E V +  A W  ++   A++P G  R TP
Sbjct: 407 GGSIVFSNCSLDPQEGEDVVARVLADHP-ELERVAMQVADWPGLE--DAITPLGEFRTTP 463

Query: 418 DMLEKI------DGVSSGMDGFFAVALRRL 441
            ML         D  + G+DGF+A  LRR+
Sbjct: 464 AMLPGPAMLPGGDSHAGGLDGFYACRLRRV 493


>gi|218514046|ref|ZP_03510886.1| probable RNA methyltransferase - sun protein [Rhizobium etli 8C-3]
          Length = 380

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 200/382 (52%), Positives = 257/382 (67%), Gaps = 4/382 (1%)

Query: 59  FLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENR 118
            LPRIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR
Sbjct: 1   HLPRIDAAIASLLESPLPEGARALHHVLSIGAAQILYLDVPDHSAVDLAVEQANQDPRNR 60

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
            FAKLVN++LRR+ REK  +L  I  ++ +P WF  RLE  YG++  LAIS + + P  I
Sbjct: 61  RFAKLVNAVLRRLGREKDPVLAEIGKVAPMPSWFLARLEKAYGRDAALAISQSQLEPAAI 120

Query: 179 DLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFG 238
           DLTVK D E WA +LN V LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG
Sbjct: 121 DLTVKSDAEGWAKRLNGVALPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFG 180

Query: 239 TLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA 298
            L+     DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE  +  D 
Sbjct: 181 DLSGKRAADLCAAPGGKTAQLILAGGTVTALDQSESRLRRLRSNLDRLGLKAE-TVAADL 239

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
             + P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP 
Sbjct: 240 TTFKPAEGFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPL 299

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G +VFSNCSLD  + EEVV +VL S    +E V +++  W  ++   A++  G  R  P 
Sbjct: 300 GTLVFSNCSLDPAEGEEVVARVL-SDTDAIERVAISAGDWPGLE--AAITSLGEFRTLPT 356

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
           ML+  +G++SG+DGF+A  LRR
Sbjct: 357 MLKMPEGIASGLDGFYAAVLRR 378


>gi|13473485|ref|NP_105052.1| hypothetical protein mlr4098 [Mesorhizobium loti MAFF303099]
 gi|14024234|dbj|BAB50838.1| mlr4098 [Mesorhizobium loti MAFF303099]
          Length = 462

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 201/426 (47%), Positives = 268/426 (62%), Gaps = 5/426 (1%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+  R  L  L D E G   ++ L  RD+ LVRAI+   LRF   I  +L   L   LP 
Sbjct: 41  VIDARTPLDGLTDHENGHPQYKALDLRDRGLVRAILVTALRFRMTITGLLARRLEKPLPP 100

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREK-I 136
              +L  +L V+ AQIL+LD+ D A VDLAV  AK D   + F+ LVN +LR ++R K  
Sbjct: 101 NATALSHILHVAAAQILFLDIPDSAAVDLAVTHAKSDPRTQRFSGLVNGVLRTLARAKET 160

Query: 137 ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
           EL   +A     P+WF +RL+  YG+++   I  A      +D +V+ D E WA KL  +
Sbjct: 161 ELPAALAATDEAPKWFSDRLKAAYGEDKAKQILAAHRYEAPVDFSVRADPELWAEKLGGI 220

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +R++ L  ++  LPGFAEG WWVQDA+AS+P +LFG +  L V DLCAAPGGKT
Sbjct: 221 VLPTGTVRVENLAGAVTDLPGFAEGAWWVQDAAASLPARLFGDVGGLRVADLCAAPGGKT 280

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQLI++GAKVTA+D SK RL +L  NLDRL L AE I++ D   Y P +LFDAVL+DAPC
Sbjct: 281 AQLILAGAKVTAVDTSKNRLARLAQNLDRLGLSAE-IVQADLLKYEPAELFDAVLLDAPC 339

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+   D+ K A  QR+LL + ++ V+PGG +VFSNCSLD  + EE+
Sbjct: 340 SSTGTVRRHPDVPWTKTAADVEKLADLQRRLLARAVTLVRPGGRIVFSNCSLDPLEGEEL 399

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
               L+ +P+ V+  PL       ID    L+ +G +R TP  L+      SG+DGFFA 
Sbjct: 400 HLAFLKETPVVVD-DPLRQGEIAGID--PFLTAQGTLRTTPADLDLGAPERSGLDGFFAA 456

Query: 437 ALRRLI 442
            +RR +
Sbjct: 457 RMRRAL 462


>gi|110635746|ref|YP_675954.1| Fmu (Sun) [Mesorhizobium sp. BNC1]
 gi|110286730|gb|ABG64789.1| Fmu (Sun) [Chelativorans sp. BNC1]
          Length = 460

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/445 (45%), Positives = 269/445 (60%), Gaps = 17/445 (3%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G++AR  ++ LL+ V+  R  L  L D E+G   +  L QRD+ LVRAI+   LR   
Sbjct: 26  KPGLDARRTAAKLLAAVIDARTPLDALTDNEHGHPQYLSLEQRDRALVRAILISALRHRC 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+ ++   L   LP   +SL  +L V  AQIL+LDV D A VDLAV QAK D     F+
Sbjct: 86  TIEKLVGRRLDRPLPPNAHSLSHILHVGAAQILFLDVPDSAAVDLAVTQAKADPRAARFS 145

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LR ++R K EL + +      P WF ERLE  YG ++  AI  A       D T
Sbjct: 146 GLVNAVLRNLARRKHELPKALENTRDAPAWFAERLEAVYGHDQTDAILKAHRLEAPTDFT 205

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           V+ D   WA +L   +LP G +RL  LP  I  LPGFAEG WWVQDA+AS+P +L G + 
Sbjct: 206 VRSDPALWAERLGGRVLPNGSVRLDRLPSPIPELPGFAEGAWWVQDAAASLPARLLGDVE 265

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
            L V DLCAAPGGKTA L + GA V+A+D+S  RL++L+ NLDRL L AE I++ D   +
Sbjct: 266 GLFVADLCAAPGGKTAALALEGAWVSAVDISASRLKRLKANLDRLGLSAE-IVQADVLSW 324

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++ FDAVL+DAPCSSTGT+RRHPDV WT+  +DI K A  QR+LL + ++ + P GIV
Sbjct: 325 EPERKFDAVLLDAPCSSTGTVRRHPDVPWTKTPEDIAKLADLQRRLLERALTLIHPSGIV 384

Query: 362 VFSNCSLDKQDSEEVVQKVLRSS------PIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           VFSNCSLD  + EE+V+ VL         PI  E +P    +         ++ EG++R 
Sbjct: 385 VFSNCSLDPSEGEELVRDVLGKQAGIALDPILPEELPGAEHF---------VTAEGFLRT 435

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRR 440
           TP      +    G+DGFFA  LRR
Sbjct: 436 TPAHF-GTESQLDGIDGFFAARLRR 459


>gi|240851336|ref|YP_002972739.1| SUN-family protein [Bartonella grahamii as4aup]
 gi|240268459|gb|ACS52047.1| SUN-family protein [Bartonella grahamii as4aup]
          Length = 454

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 204/446 (45%), Positives = 286/446 (64%), Gaps = 16/446 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ K   L+ L D E+G   +  LSQRD++L RAI+  +LR   +I
Sbjct: 16  GLAVRQVCVRLLGAVVDKHTPLSGLTDNEHGHPQYLKLSQRDRLLCRAILTASLRHRGQI 75

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A L  +L   LP +  SLQ LL +SVAQILYLD+ D+A +DLAV  AK D   R F+ +
Sbjct: 76  TAALSRLLARPLPSQALSLQHLLHISVAQILYLDIPDHAAIDLAVRVAKLDPRMRRFSGV 135

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKER---VLAISDACISPLYIDL 180
           VN++LR ++RE + L Q+I  I  +P WF + L + YG E+   ++AI    + P + DL
Sbjct: 136 VNALLRNIAREAVSLRQQIPSIEGVPAWFGQLLMSAYGTEKAHQIIAIQS--VEPPF-DL 192

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  ++LP G +RL  L  S+  LPG++EG WWVQD +A++P  L GTL
Sbjct: 193 TVKSDSVGWAERLGGLVLPNGSVRLNRLECSVSDLPGYSEGTWWVQDFAAALPACLLGTL 252

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCA+PGGKTAQL + GA+VTA+++S  R+++L+ N++RLH ++  I + D  +
Sbjct: 253 RGKRVADLCASPGGKTAQLALQGAQVTAIELSANRVKRLKENMERLH-FSVHIWQGDVRN 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGTIRRHPD+LWT+  DDIVK A  Q  LL+  IS VK GG 
Sbjct: 312 FHPTQLFDAVLLDAPCSSTGTIRRHPDILWTKSRDDIVKLAALQHDLLVAAISLVKVGGR 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP-DM 419
           +VFSNCSL +++ E++++K+L S+   + L P+   Y + +     L   G +R TP D 
Sbjct: 372 IVFSNCSLAREEGEDLIEKIL-STRNDIVLEPI---YPEEMGALAHLLCGGMLRTTPADF 427

Query: 420 LEK-IDGVSS---GMDGFFAVALRRL 441
             K  D   +   GMDGFFA  LR++
Sbjct: 428 CHKNFDAEKTAFLGMDGFFAARLRKI 453


>gi|319780892|ref|YP_004140368.1| Fmu (Sun) domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166780|gb|ADV10318.1| Fmu (Sun) domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 475

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 202/424 (47%), Positives = 265/424 (62%), Gaps = 5/424 (1%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+  R  L  L D E G   ++ L  RD+ LVRAI+   LR+   I  +L   L   LP 
Sbjct: 54  VIDARTPLDGLTDHENGHPQYKALDLRDRGLVRAILVTALRYRMTISGLLARRLEKPLPP 113

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREK-I 136
              +L  +L V+ AQIL+LD+ D A VD+AV  AK D     F+ LVN +LR ++R K  
Sbjct: 114 NATALSHILHVAAAQILFLDIPDSAAVDIAVTHAKSDPRTVRFSGLVNGVLRTLARAKET 173

Query: 137 ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
           EL   +A     P+WF ERL+  YG E+   I +A      +D +VK D   WA KL  +
Sbjct: 174 ELPAALAATDEAPKWFSERLKTTYGNEKARQILEAHRVEAPVDFSVKADPGLWAEKLGGI 233

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +R++ L   +  LPGFAEG WWVQDA+AS+P +LFG +  L V DLCAAPGGKT
Sbjct: 234 VLPTGTVRVENLVGPVTELPGFAEGAWWVQDAAASLPARLFGDVTGLRVADLCAAPGGKT 293

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQLIV+GAKVTA+D SK RL +L  NL+RL L AE I++ D   Y PK+LFDAVL+DAPC
Sbjct: 294 AQLIVAGAKVTAVDTSKNRLVRLTQNLERLGLSAE-IVQADLLKYEPKELFDAVLLDAPC 352

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+ + D+ K A  QR+LL + ++ VKPGG +VFSNCSLD  + E++
Sbjct: 353 SSTGTVRRHPDVPWTKTSADVEKLADLQRRLLARTVTLVKPGGRIVFSNCSLDPLEGEDL 412

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
            +  L  +P  +   PL       ID    L+P+G +R TP  L+      SG+DGFFA 
Sbjct: 413 CRAFLAGTP-EITNDPLLQGEIAGID--PFLTPQGTLRTTPADLDLGAPERSGLDGFFAA 469

Query: 437 ALRR 440
            +RR
Sbjct: 470 RMRR 473


>gi|90421014|ref|ZP_01228918.1| putative ribosomal RNA methyltransferase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334792|gb|EAS48568.1| putative ribosomal RNA methyltransferase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 472

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 207/447 (46%), Positives = 276/447 (61%), Gaps = 16/447 (3%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARLV++ LLS ++  R S   LLD   G   FR L  RDQ LV+AI+   LRF  
Sbjct: 35  RPGLGARLVATKLLSAIVDARTSADGLLDAAGGHPGFRALEGRDQGLVKAIILSALRFRG 94

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I   LD  L   LP    +L+ +L V   QIL+LDV D A VDLAV  A  D  +R FA
Sbjct: 95  TISRALDACLDRPLPPNAAALKHILHVGATQILFLDVPDSAAVDLAVAAANVDSRSRRFA 154

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            ++N++LRR+SREK  L +       +P+W   R+   YG ER  AI+ A ++P  +DLT
Sbjct: 155 GMINAVLRRLSREKDALREVATATENMPDWLAARMVAAYGPERTEAIARAHLTPAPLDLT 214

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KL  V LP G +RL      + +L GFAEG WWVQDA+A++P QLFG L 
Sbjct: 215 VKRDPAGWAGKLGGVALPNGTVRLGSFDGPVTALEGFAEGEWWVQDAAAALPAQLFGDLT 274

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII-EMDAFD 300
              V DLCAAPGGKTAQLI +G  VTALD++  R+++L+ NL RL L AE ++ ++ AF+
Sbjct: 275 GKRVADLCAAPGGKTAQLIAAGGAVTALDINANRMKRLKANLARLSLEAETVVGDIAAFE 334

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
             P + FDA+L+DAPCSSTGTIRRHPDV +T+D ++I K A  Q +LL + +  + PGG 
Sbjct: 335 --PAEPFDAILLDAPCSSTGTIRRHPDVPYTKDAEEIAKLAGVQARLLGEAVRLLAPGGR 392

Query: 361 VVFSNCSLDKQDSEEVVQKVL--RSSPI--PVELVPLNSAYWKSIDMAMALSPEGWIRIT 416
           +VFSNCSLD  + E +V  +L  RS  +  PV+   L         M  AL+PEG +R T
Sbjct: 393 LVFSNCSLDPAEGEAIVAALLTDRSDIVRDPVQPGELPG-------MEFALTPEGDLRTT 445

Query: 417 PDMLEKIDG--VSSGMDGFFAVALRRL 441
           PDM+        + G+DGF+A  L+R+
Sbjct: 446 PDMMGGAADAPATGGLDGFYAARLKRI 472


>gi|260466787|ref|ZP_05812972.1| Fmu (Sun) domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259029399|gb|EEW30690.1| Fmu (Sun) domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 475

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/426 (46%), Positives = 265/426 (62%), Gaps = 5/426 (1%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+  R  L  L D E G   ++ L  RD+ LVRAI+   LR+   I  +L   L   LP 
Sbjct: 54  VIDARTPLDGLTDHENGHPQYKALDPRDRGLVRAILVTALRYRMTITGLLARRLEKPLPP 113

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREK-I 136
              +L  +L V+ AQIL+LD+ D A VDLAV  AK D   + F+ LVN +LR ++R K  
Sbjct: 114 NASALSHILHVAAAQILFLDIPDSAAVDLAVTHAKSDPRTQRFSGLVNGVLRTLARAKDT 173

Query: 137 ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
           EL   +A     P+WF +RL+  YG ++   I  A      +D TVK D E WA KL  +
Sbjct: 174 ELPAALAATDEAPKWFSDRLKAAYGADKAKQILAAHRHEAPVDFTVKADPELWAEKLGGI 233

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +R++ L   ++ LPGFAEG WWVQDA+AS P +LFG +  L V DLCAAPGGKT
Sbjct: 234 VLPTGTVRVENLAGPVIELPGFAEGAWWVQDAAASFPARLFGDVRGLRVADLCAAPGGKT 293

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQLI++GA+VTA+D SK RL +L  NLDRL L A DI++ D   Y P +LFDAVL+DAPC
Sbjct: 294 AQLILAGARVTAVDTSKNRLARLAQNLDRLGL-AADIVQADLIKYEPAELFDAVLLDAPC 352

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+   D+ K A  Q +LL + ++ V+PGG +VFSNCSLD  + E +
Sbjct: 353 SSTGTVRRHPDVPWTKTAADVEKLADLQGRLLARAVTLVRPGGRIVFSNCSLDPIEGENL 412

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
            +  L+++P  V   PL+      ID    L+ +G +R TP  L+      SG+DGFFA 
Sbjct: 413 HRAFLKATPT-VADDPLHQGEIAGID--SFLTAQGTLRTTPADLDLGAPERSGLDGFFAA 469

Query: 437 ALRRLI 442
            +RR +
Sbjct: 470 RMRRAV 475


>gi|163757448|ref|ZP_02164537.1| putative ribosomal RNA small subunit methyltransferase B [Hoeflea
           phototrophica DFL-43]
 gi|162284950|gb|EDQ35232.1| putative ribosomal RNA small subunit methyltransferase B [Hoeflea
           phototrophica DFL-43]
          Length = 446

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 203/439 (46%), Positives = 269/439 (61%), Gaps = 6/439 (1%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ LL+ V   R SL  LLD   G+ AF  L  +D++LVRAI+   LR L
Sbjct: 10  LKPGLAARQAATRLLAAVTESRASLDGLLDPAGGNPAFTGLGPQDRLLVRAILLSALRHL 69

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             IDA +D ++ S LP    +L+QLLRV  AQIL+LDV D A VDLAV QA  D  NR F
Sbjct: 70  RVIDAYIDELVTSPLPEGAKALRQLLRVGAAQILFLDVPDRAAVDLAVSQANGDPRNRRF 129

Query: 121 AKLVNSILRRVSREKIELLQRI-AGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR+ REK   L  + A +   P+WF  R++N Y +E    +S   + P  ID
Sbjct: 130 AGLVNALLRRMGREKESRLSELTATVPPFPDWFVSRIQNAYSQEADSILSMLSVPP-AID 188

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           LTVK D   WA +L   +LPTG +R+      +  L G+  G WWVQDA+ASIP Q+F  
Sbjct: 189 LTVKTDPAGWAERLGGTVLPTGSVRIARPAGPVTDLEGYDGGDWWVQDAAASIPAQMFSR 248

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           L+ L V DLCAAPGGKTAQL ++GA+VTA D S  RLE+L+ NL RL L     +   A 
Sbjct: 249 LDGLEVADLCAAPGGKTAQLALAGARVTACDQSANRLERLKGNLSRLGLEVSTHLSR-AQ 307

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+   + FD VLVDAPCSSTGT+RRHPD+ +T+  +DI +    QR LL      V+P G
Sbjct: 308 DFKAPEGFDGVLVDAPCSSTGTVRRHPDIPYTKGPEDITRLTQVQRALLDHAAGLVRPKG 367

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +VFSNCSLD ++ E +VQ  L   P    + P++++ W    M  A++  G +R  P M
Sbjct: 368 ELVFSNCSLDPEEGELMVQGFLADHPS-WRIKPVDASRWPG--MEAAITELGEVRTHPAM 424

Query: 420 LEKIDGVSSGMDGFFAVAL 438
           L   D   +G+DGF+AV L
Sbjct: 425 LSDDDPAQAGLDGFYAVVL 443


>gi|218671732|ref|ZP_03521401.1| RNA methyltransferase - sun protein [Rhizobium etli GR56]
          Length = 342

 Score =  368 bits (945), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 182/344 (52%), Positives = 235/344 (68%), Gaps = 4/344 (1%)

Query: 97  DVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERL 156
           DV D++ VDL   +A +D  NR FAKLVN++LRR+ REK E+L  I  ++ +P WF  RL
Sbjct: 1   DVPDHSAVDLPSNRANQDPRNRRFAKLVNAVLRRLGREKDEVLAEIGKVAPMPSWFLARL 60

Query: 157 ENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLP 216
           E  YG++  LAIS + + P  IDLTVK D E WA KLN V LPTGG+RL      I SL 
Sbjct: 61  EKAYGRDTALAISQSQLEPAAIDLTVKSDAEGWAKKLNGVALPTGGVRLAAFDGGIPSLE 120

Query: 217 GFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRL 276
           GF EG WWVQDA+ASIP +LFG L+     DLCAAPGGKTAQLI++G  VTALD S+ RL
Sbjct: 121 GFDEGAWWVQDAAASIPARLFGDLSGKRAADLCAAPGGKTAQLILAGGAVTALDQSESRL 180

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
            +LR NLDRL L AE  +  D   + P + FDA+L+DAPCSSTGT RRHPDVLWT+  +D
Sbjct: 181 RRLRSNLDRLGLTAE-TVAADLTTFKPPEGFDAILLDAPCSSTGTTRRHPDVLWTKGPED 239

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           I + A  Q +LL   ++ + PGG++VFSNCSLD  + EEVV +VL S    +E VP+++ 
Sbjct: 240 IARLAALQERLLRHALTLLTPGGMLVFSNCSLDPAEGEEVVARVL-SDTGAIERVPISAG 298

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            W  ++   A++P G  R  P ML+  +G++SG+DGF+A  LRR
Sbjct: 299 DWPGLE--AAITPLGEFRTLPTMLKMPEGIASGLDGFYAAVLRR 340


>gi|49476251|ref|YP_034292.1| SUN protein (Fmu protein) [Bartonella henselae str. Houston-1]
 gi|49239059|emb|CAF28362.1| SUN protein (FMU protein) [Bartonella henselae str. Houston-1]
          Length = 447

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 203/443 (45%), Positives = 278/443 (62%), Gaps = 9/443 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R VS  LL  V+ K+ SL+ L D EYG   +  LSQRD++L RAI+   LR   +I
Sbjct: 8   GLAVRQVSVRLLGVVLDKKTSLSGLTDNEYGHPQYLGLSQRDRLLCRAILAAALRHRGQI 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L   L   LP +  SLQ LL +S AQILYLD+ D+A +DLAV  AK D     F+  
Sbjct: 68  TDALRRFLKRPLPSQALSLQHLLHISAAQILYLDIPDHAAIDLAVRVAKLDPRMCRFSGG 127

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN++LR V+RE + L Q+   I  IP WF + L + YGKE+   I +   +P  +DLTVK
Sbjct: 128 VNALLRNVAREAVFLRQKAPHIEGIPVWFGQLLVSTYGKEKTEQILEIQSAPPPLDLTVK 187

Query: 184 FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
            D   WA +L  V+LP G +RL  L  S+  LPG+ EG WW+QD +AS+P  L G ++  
Sbjct: 188 SDSRGWAERLGGVVLPNGSVRLSRLEGSVSELPGYMEGAWWIQDFAASLPACLLGNIHGK 247

Query: 244 SVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP 303
            V DLCA+PGGKTAQL + GA VTA+++S  RL++L+ N++RLH ++    E D  ++ P
Sbjct: 248 QVADLCASPGGKTAQLALQGADVTAIELSANRLKRLKENMERLH-FSVRCCEGDVKNFHP 306

Query: 304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVF 363
           K+LFDAVL+DAPCSSTGTIRRHPD+LWT+  +D++K A  Q  LL+  I+ +K GG +VF
Sbjct: 307 KQLFDAVLLDAPCSSTGTIRRHPDILWTKSMNDVIKLAALQYDLLVAAIALLKKGGRIVF 366

Query: 364 SNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML--E 421
           SNCSL K++ E+++ ++L S    + L P+ +       MA  LS EG +R TP     E
Sbjct: 367 SNCSLAKEEGEDLITRIL-SERGDIVLEPILAEEMGV--MAHLLSVEGILRTTPADFCHE 423

Query: 422 KIDGVSS---GMDGFFAVALRRL 441
             D   +   GMDGFFA  LR++
Sbjct: 424 NFDAEKNIFLGMDGFFAARLRKV 446


>gi|319409409|emb|CBI83055.1| SUN-family protein [Bartonella schoenbuchensis R1]
          Length = 447

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 208/446 (46%), Positives = 281/446 (63%), Gaps = 15/446 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V + LL  V+ K  SL+ L D EYG   +  LS RD++L RAI+   LR   +I
Sbjct: 8   GLVVRQVCARLLGVVLDKHKSLSGLTDHEYGHPHYLKLSHRDRLLCRAILMAALRHRGQI 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A L   L   LP +  SLQ LL +S AQILYLD+ D+A +DLAV+ AK D   R F+ L
Sbjct: 68  TAALSRFLKRPLPLQALSLQHLLHISAAQILYLDIPDHAAIDLAVQMAKIDPRTRRFSGL 127

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYG---KERVLAISDACISPLYIDL 180
           VN+ILR  +RE + L  +   I  +P WF + L + YG     ++LAI +   S   +DL
Sbjct: 128 VNAILRNFAREAVCLRVQEPTIKDVPAWFGQLLVSTYGVDKAHQILAIQNNAPS---LDL 184

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  V+LP G IRL  L  S+V+LPG+A+G WWVQD +A++P  L G +
Sbjct: 185 TVKSDSIGWAKRLGGVVLPNGSIRLGALDGSVVNLPGYAQGAWWVQDFAAALPACLLGDI 244

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V+D CA+PGGKTAQL + GA VTA++ S  RLE+L+ N++RLHL A      D  D
Sbjct: 245 RGKRVVDFCASPGGKTAQLALQGADVTAVESSANRLERLKENMERLHLSAH-YWTGDMRD 303

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           +  ++LFDAVL+DAPCSSTGTIRRHPD+LWT+ +DDI K A  Q  LLL  I+FVK GG 
Sbjct: 304 FYSEQLFDAVLLDAPCSSTGTIRRHPDILWTKSSDDITKLAAVQYDLLLAAIAFVKKGGC 363

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP--- 417
           ++FSNCSL +Q+ E++++K+L S+   + L P+ +    S  M   LS +G +R TP   
Sbjct: 364 IIFSNCSLARQEGEDLIKKIL-STRDDIILEPILAEEMGS--MKHLLSSDGTLRTTPADC 420

Query: 418 --DMLEKIDGVSSGMDGFFAVALRRL 441
             D  +  D +  GMDGFFA  LR++
Sbjct: 421 CYDNCDVEDPLLFGMDGFFAARLRKV 446


>gi|153008423|ref|YP_001369638.1| Fmu (Sun) domain-containing protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151560311|gb|ABS13809.1| Fmu (Sun) domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 453

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 277/447 (61%), Gaps = 10/447 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 8   LRPGLAARLCAARLLGAVIEKNTSLDGLTDNTHGHPQYLALEPRDRALVRAILGSALRNR 67

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V++AQI YL++ D++ VDLAVE A  D  NR +
Sbjct: 68  GSIERAINKRLDRPLPENAVALKHLLHVAIAQIFYLNLPDHSAVDLAVEAANADPRNRKY 127

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR+SR K   L   +   + +PEWF + + + YG E+  AI         ID
Sbjct: 128 AGLVNALLRRLSRNKERALAHTLEPETNVPEWFAKSITDAYGAEKAAAILAMHAYEPPID 187

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 188 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGDWWVQDVAASLPARLMGD 247

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++LR NL+RL   A+  +  +  
Sbjct: 248 IKGKRVADLCAAPGGKTAQLVLQGANVTALDLSENRLKRLRGNLERLGFEAK-TVATNLM 306

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 307 DFQPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 366

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID--MAMALSPEGWIRITP 417
           ++VFSNCSL   + EE+ +K    +P+ +E  P+      S++  +   ++ EG++R TP
Sbjct: 367 VIVFSNCSLHPLEGEEMARKAA-ENPL-LEPFPITEQDCPSLNGLLDGLVTAEGFLRSTP 424

Query: 418 DML--EKIDGVS--SGMDGFFAVALRR 440
             L  ++ +G    +GMDGFFA   +R
Sbjct: 425 ADLPPDRFEGNPHMAGMDGFFAARFKR 451


>gi|254700459|ref|ZP_05162287.1| Sun [Brucella suis bv. 5 str. 513]
 gi|261750960|ref|ZP_05994669.1| fmu domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261740713|gb|EEY28639.1| fmu domain-containing protein [Brucella suis bv. 5 str. 513]
          Length = 465

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 275/446 (61%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++VVDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSVVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|239832893|ref|ZP_04681222.1| Sun, sun protein [Ochrobactrum intermedium LMG 3301]
 gi|239825160|gb|EEQ96728.1| Sun, sun protein [Ochrobactrum intermedium LMG 3301]
          Length = 465

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 199/445 (44%), Positives = 273/445 (61%), Gaps = 10/445 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 24  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNTHGHPQYLALEPRDRALVRAILGSALRNR 83

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V++AQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 84  GSIERAINKRLDRPLPENAVALKHLLHVAIAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 143

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR+SR K   L   +   + +PEWF + +   YG E+  AI         ID
Sbjct: 144 AGLVNALLRRLSRNKERALAHTLEPETNVPEWFAKSITEAYGAEKAAAILAMHAYEPPID 203

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D E WA KL  V LP G +RL+ +  ++  L GFAEG WWVQD +AS+P +L G 
Sbjct: 204 FTVKGDAEAWAEKLGGVALPNGSVRLQTVEGNLTDLLGFAEGDWWVQDVAASLPARLMGD 263

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++LR NL+RL   A+  +  +  
Sbjct: 264 IRGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLRGNLERLGFEAK-TVATNLM 322

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 323 DFQPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 382

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++  + +  EG++R TP  
Sbjct: 383 VIVFSNCSLHPLEGEEMARKAA-ENPL-LEPFPITEQDCSGLEGLVTV--EGFLRSTPAD 438

Query: 420 L--EKIDGVS--SGMDGFFAVALRR 440
           L  ++ DG    +GMDGFFA   +R
Sbjct: 439 LPPKRFDGNPQMAGMDGFFAARFKR 463


>gi|62290679|ref|YP_222472.1| Sun, sun protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700594|ref|YP_415168.1| hypothetical protein BAB1_1822 [Brucella melitensis biovar Abortus
           2308]
 gi|148559652|ref|YP_001259653.1| sun protein [Brucella ovis ATCC 25840]
 gi|189024891|ref|YP_001935659.1| Sun [Brucella abortus S19]
 gi|237816180|ref|ZP_04595175.1| Sun, sun protein [Brucella abortus str. 2308 A]
 gi|254689968|ref|ZP_05153222.1| Sun [Brucella abortus bv. 6 str. 870]
 gi|254698119|ref|ZP_05159947.1| Sun [Brucella abortus bv. 2 str. 86/8/59]
 gi|254708333|ref|ZP_05170161.1| Sun [Brucella pinnipedialis M163/99/10]
 gi|254708815|ref|ZP_05170626.1| Sun [Brucella pinnipedialis B2/94]
 gi|254731003|ref|ZP_05189581.1| Sun [Brucella abortus bv. 4 str. 292]
 gi|256030341|ref|ZP_05443955.1| Sun [Brucella pinnipedialis M292/94/1]
 gi|256061838|ref|ZP_05451973.1| Sun [Brucella neotomae 5K33]
 gi|256258223|ref|ZP_05463759.1| Sun [Brucella abortus bv. 9 str. C68]
 gi|256370218|ref|YP_003107729.1| sun protein [Brucella microti CCM 4915]
 gi|260547084|ref|ZP_05822822.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755503|ref|ZP_05867851.1| fmu domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260758726|ref|ZP_05871074.1| fmu domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260762560|ref|ZP_05874897.1| fmu domain-containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884524|ref|ZP_05896138.1| fmu domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261315833|ref|ZP_05955030.1| fmu domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261316307|ref|ZP_05955504.1| fmu domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261325843|ref|ZP_05965040.1| fmu domain-containing protein [Brucella neotomae 5K33]
 gi|265987375|ref|ZP_06099932.1| fmu domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294851054|ref|ZP_06791730.1| ribosomal RNA small subunit methyltransferase B [Brucella sp. NVSL
           07-0026]
 gi|297249071|ref|ZP_06932779.1| ribosomal RNA small subunit methyltransferase B [Brucella abortus
           bv. 5 str. B3196]
 gi|62196811|gb|AAX75111.1| Sun, sun protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616695|emb|CAJ11778.1| SAM (and some other nucleotide) binding motif:Bacterial
           Sun/eukaryotic nucleolar Nop1/Nop2:Antitermination
           protein NusB:NusB [Brucella melitensis biovar Abortus
           2308]
 gi|148370909|gb|ABQ60888.1| sun protein [Brucella ovis ATCC 25840]
 gi|189020463|gb|ACD73185.1| Sun [Brucella abortus S19]
 gi|237788642|gb|EEP62855.1| Sun, sun protein [Brucella abortus str. 2308 A]
 gi|256000381|gb|ACU48780.1| sun protein [Brucella microti CCM 4915]
 gi|260095449|gb|EEW79327.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260669044|gb|EEX55984.1| fmu domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260672986|gb|EEX59807.1| fmu domain-containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675611|gb|EEX62432.1| fmu domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260874052|gb|EEX81121.1| fmu domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261295530|gb|EEX99026.1| fmu domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261301823|gb|EEY05320.1| fmu domain-containing protein [Brucella neotomae 5K33]
 gi|261304859|gb|EEY08356.1| fmu domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|264659572|gb|EEZ29833.1| fmu domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294821697|gb|EFG38693.1| ribosomal RNA small subunit methyltransferase B [Brucella sp. NVSL
           07-0026]
 gi|297174204|gb|EFH33561.1| ribosomal RNA small subunit methyltransferase B [Brucella abortus
           bv. 5 str. B3196]
          Length = 465

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 197/446 (44%), Positives = 274/446 (61%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|256160512|ref|ZP_05458201.1| Sun [Brucella ceti M490/95/1]
 gi|256255718|ref|ZP_05461254.1| Sun [Brucella ceti B1/94]
 gi|261222929|ref|ZP_05937210.1| fmu domain-containing protein [Brucella ceti B1/94]
 gi|265998888|ref|ZP_06111445.1| fmu domain-containing protein [Brucella ceti M490/95/1]
 gi|260921513|gb|EEX88166.1| fmu domain-containing protein [Brucella ceti B1/94]
 gi|262553577|gb|EEZ09346.1| fmu domain-containing protein [Brucella ceti M490/95/1]
          Length = 465

 Score =  365 bits (938), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 197/446 (44%), Positives = 274/446 (61%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDITKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|260168015|ref|ZP_05754826.1| sun protein [Brucella sp. F5/99]
 gi|261757460|ref|ZP_06001169.1| RNA methyltransferase- sun protein [Brucella sp. F5/99]
 gi|261737444|gb|EEY25440.1| RNA methyltransferase- sun protein [Brucella sp. F5/99]
          Length = 465

 Score =  365 bits (937), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 197/446 (44%), Positives = 274/446 (61%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGFALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++  +  + EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLEGLV--TAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|306841594|ref|ZP_07474291.1| Sun [Brucella sp. BO2]
 gi|306288340|gb|EFM59703.1| Sun [Brucella sp. BO2]
          Length = 464

 Score =  364 bits (935), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 196/446 (43%), Positives = 273/446 (61%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 24  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 83

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 84  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 143

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 144 AGLVNALLRRLARNKERALAHTFEPEANVPEWFSKSITDAYGAEKAATILAMHAYEPPID 203

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 204 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 263

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 264 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 322

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q +LL    + VKPGG
Sbjct: 323 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLADLQGRLLAHAATLVKPGG 382

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 383 VIVFSNCSLHPLEGEEMARKAA-ENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 438

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  ++ DG    +GMDGFFA   +R+
Sbjct: 439 LPPDRFDGNPHMAGMDGFFAARFKRV 464


>gi|23502667|ref|NP_698794.1| sun protein [Brucella suis 1330]
 gi|161619734|ref|YP_001593621.1| Fmu (Sun) domain-containing protein [Brucella canis ATCC 23365]
 gi|163845392|ref|YP_001623047.1| hypothetical protein BSUIS_B1292 [Brucella suis ATCC 23445]
 gi|254703581|ref|ZP_05165409.1| hypothetical protein Bsuib36_06589 [Brucella suis bv. 3 str. 686]
 gi|260568886|ref|ZP_05839354.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261754214|ref|ZP_05997923.1| fmu domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|23348676|gb|AAN30709.1| sun protein [Brucella suis 1330]
 gi|161336545|gb|ABX62850.1| Fmu (Sun) domain protein [Brucella canis ATCC 23365]
 gi|163676115|gb|ABY40225.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|260154270|gb|EEW89352.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261743967|gb|EEY31893.1| fmu domain-containing protein [Brucella suis bv. 3 str. 686]
          Length = 465

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 196/446 (43%), Positives = 273/446 (61%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LR ++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRHLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|254719803|ref|ZP_05181614.1| Sun [Brucella sp. 83/13]
 gi|265984821|ref|ZP_06097556.1| fmu domain-containing protein [Brucella sp. 83/13]
 gi|306839499|ref|ZP_07472307.1| Sun [Brucella sp. NF 2653]
 gi|264663413|gb|EEZ33674.1| fmu domain-containing protein [Brucella sp. 83/13]
 gi|306405444|gb|EFM61715.1| Sun [Brucella sp. NF 2653]
          Length = 464

 Score =  363 bits (932), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 196/446 (43%), Positives = 272/446 (60%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 24  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 83

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 84  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 143

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 144 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGVEKAATILAIHAYEPPID 203

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 204 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 263

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 264 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 322

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 323 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 382

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K   +  + +E  P+       ++  +  + EG++R TP  
Sbjct: 383 VIVFSNCSLHPLEGEEMARKAAEN--LLLEPFPITEQDCPGLEGLV--TAEGFLRSTPAD 438

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  ++ DG    +GMDGFFA   +R+
Sbjct: 439 LPPDRFDGNPHMAGMDGFFAARFKRV 464


>gi|49474771|ref|YP_032813.1| SUN protein (Fmu protein) [Bartonella quintana str. Toulouse]
 gi|49240275|emb|CAF26748.1| SUN protein (FMU protein) [Bartonella quintana str. Toulouse]
          Length = 447

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 201/446 (45%), Positives = 279/446 (62%), Gaps = 15/446 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ K  SL  L D E+G   +  LS RD++L RAI+   LR   +I
Sbjct: 8   GLTVRQVCVRLLGAVLDKHTSLAGLTDNEHGHPQYLGLSHRDRLLCRAILGAALRHRGQI 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A L   L   LP + +SLQ LL +SVAQILYLD+ D+A +DLAV  AK D   R F+ L
Sbjct: 68  TAALSRFLTRPLPLQAFSLQHLLHISVAQILYLDIPDHAAIDLAVRVAKIDPRMRRFSGL 127

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKER---VLAISDACISPLYIDL 180
           VN +LR V+RE + L +++  I  IP WF + L + YGKE+   +LAI    + P  +DL
Sbjct: 128 VNVLLRNVAREAVFLCRKVPTIEEIPGWFGQLLVSTYGKEKADQILAIQS--LEP-PLDL 184

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  ++LP G +RL  L  S+  LPG+A+G WW+QD +A++P  L G +
Sbjct: 185 TVKSDSVGWAERLGGIILPNGSVRLSRLNCSVSELPGYADGDWWIQDFAAALPACLLGNI 244

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V+DLCA+PGGKTAQL + GA VTA+D+S  RL++L+ N+ RLH ++    E D  +
Sbjct: 245 YGKQVVDLCASPGGKTAQLALQGADVTAVDLSAHRLKRLKENMKRLH-FSVRYHEGDVKN 303

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + PK+LFDA L+DAPCSSTGTIRRHPD+LWT+   D++K A  Q  LL+  I+ VK GG 
Sbjct: 304 FHPKRLFDAALLDAPCSSTGTIRRHPDILWTKSMHDVIKLAALQYDLLVAAIALVKKGGR 363

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL +++ E++++K+L S+   V L P+ +    +  +A  LS +G +R TP   
Sbjct: 364 IVFSNCSLAREEGEDLIEKIL-STCNDVVLEPICAEEMGA--LAHLLSAKGILRTTPADF 420

Query: 421 --EKIDGVSS---GMDGFFAVALRRL 441
             E  D       GMDGFF    R++
Sbjct: 421 CHENFDAEKKMFLGMDGFFTARFRKV 446


>gi|306844795|ref|ZP_07477380.1| Sun [Brucella sp. BO1]
 gi|306274967|gb|EFM56737.1| Sun [Brucella sp. BO1]
          Length = 465

 Score =  361 bits (926), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 194/446 (43%), Positives = 272/446 (60%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGAEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   D+ K A  Q +LL    + VKPG 
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDVAKLAELQGRLLAHAATLVKPGS 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++  + +  EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKAA-ENPL-LEPFPITEQDCPGLEGLVTV--EGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  ++ DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRFDGNPHMAGMDGFFAARFKRV 465


>gi|256045414|ref|ZP_05448306.1| Fmu domain protein, Sun [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565697|ref|ZP_05836180.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991841|ref|ZP_06104398.1| fmu domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151070|gb|EEW86165.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002797|gb|EEZ15200.1| fmu domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 465

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 195/446 (43%), Positives = 272/446 (60%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   L   
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALHNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L   
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVESNLTDLPGFAEGEWWVQDVAASLPARLMDD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|225853258|ref|YP_002733491.1| Fmu domain-containing protein, Sun [Brucella melitensis ATCC 23457]
 gi|256114379|ref|ZP_05455112.1| Fmu domain protein, Sun [Brucella melitensis bv. 3 str. Ether]
 gi|256263253|ref|ZP_05465785.1| NOL1/NOP2/sun family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|265995679|ref|ZP_06108236.1| fmu domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225641623|gb|ACO01537.1| Fmu domain protein, Sun [Brucella melitensis ATCC 23457]
 gi|262766963|gb|EEZ12581.1| fmu domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093217|gb|EEZ17314.1| NOL1/NOP2/sun family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409818|gb|ADZ66883.1| Fmu domain-containing protein, Sun [Brucella melitensis M28]
 gi|326539536|gb|ADZ87751.1| Fmu domain protein, Sun [Brucella melitensis M5-90]
          Length = 465

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 195/446 (43%), Positives = 272/446 (60%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   L   
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALHNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L   
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMDD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|254714655|ref|ZP_05176466.1| Sun [Brucella ceti M644/93/1]
 gi|254717553|ref|ZP_05179364.1| Sun [Brucella ceti M13/05/1]
 gi|261219386|ref|ZP_05933667.1| fmu domain-containing protein [Brucella ceti M13/05/1]
 gi|261322448|ref|ZP_05961645.1| fmu domain-containing protein [Brucella ceti M644/93/1]
 gi|260924475|gb|EEX91043.1| fmu domain-containing protein [Brucella ceti M13/05/1]
 gi|261295138|gb|EEX98634.1| fmu domain-containing protein [Brucella ceti M644/93/1]
          Length = 465

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 195/446 (43%), Positives = 272/446 (60%), Gaps = 10/446 (2%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAE  WWVQD +AS+P +L G 
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAESEWWVQDVAASLPARLMGD 264

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
           +    V DLCAAPGGKTAQL++ GA VTALD+S+ R ++L  NL+RL   A+  +  +  
Sbjct: 265 IKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRRKRLNANLERLGFEAK-TVATNLM 323

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG
Sbjct: 324 DFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGG 383

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++VFSNCSL   + EE+ +K    +P+ +E  P+       ++    ++ EG++R TP  
Sbjct: 384 VIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPAD 439

Query: 420 L--EKIDGVS--SGMDGFFAVALRRL 441
           L  +++DG    +GMDGFFA   +R+
Sbjct: 440 LPPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|163869265|ref|YP_001610521.1| SUN-family protein [Bartonella tribocorum CIP 105476]
 gi|161018968|emb|CAK02526.1| SUN-family protein [Bartonella tribocorum CIP 105476]
          Length = 454

 Score =  358 bits (920), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 198/443 (44%), Positives = 279/443 (62%), Gaps = 10/443 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ +   L+ L D E+G   +  LSQRD++L RAI+  +LR   +I
Sbjct: 16  GLAVRQVCVRLLGAVVDRYTPLSGLTDNEHGHPQYLKLSQRDRLLCRAILTTSLRHRGQI 75

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A L   L   LP +  SLQ LL +SVAQILYLD+ D+A +DLAV  AK D   R F+ +
Sbjct: 76  TAALSCFLERPLPSQALSLQHLLHISVAQILYLDIPDHAAIDLAVRVAKFDPRMRRFSGV 135

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN++LR V+RE   L Q++  I  +P WF + L + YG E+   I +       +DLTVK
Sbjct: 136 VNALLRNVAREAAPLRQQVPTIEGVPAWFSQLLVSAYGIEKAQQIIELQSVEPPLDLTVK 195

Query: 184 FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
            D   WA +L  V+LP G +RL  L  S+  LPG+ EG WWVQD +A++P  L G L   
Sbjct: 196 SDSIGWAERLGGVVLPNGSVRLNRLECSVSDLPGYREGAWWVQDFAAALPACLLGELRGK 255

Query: 244 SVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP 303
            V DLCA+PGGKTAQL + GA+VTA+++S  R+++L+ N++RL+ ++  I + D  ++ P
Sbjct: 256 RVADLCASPGGKTAQLALQGAEVTAIELSANRVKRLKENMERLY-FSVHIWQGDVRNFHP 314

Query: 304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVF 363
            +LFDAVL+DAPCSSTGTIRRHPD+LWT+  DD++K A  Q  LL+  I+ VK GG +VF
Sbjct: 315 TQLFDAVLLDAPCSSTGTIRRHPDILWTKSRDDVIKLAALQYDLLVAAIALVKKGGRIVF 374

Query: 364 SNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP-DMLEK 422
           SNCSL +++ E++++K+L    I  ++V L+  Y + +     L  EG +R TP D   K
Sbjct: 375 SNCSLAREEGEDLIEKILS---IRNDIV-LDPIYPEEMGALAHLLSEGMVRTTPADFCHK 430

Query: 423 -IDGVSS---GMDGFFAVALRRL 441
             D   +   GMDGFFA  LR++
Sbjct: 431 NFDAEKTAPLGMDGFFAARLRKI 453


>gi|319406332|emb|CBI79969.1| SUN-family protein [Bartonella sp. AR 15-3]
          Length = 455

 Score =  356 bits (913), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 201/448 (44%), Positives = 277/448 (61%), Gaps = 19/448 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ KR SL  L D EYG   +  LS RD++L RAI+   LR   +I
Sbjct: 16  GLIVRQVCVRLLGAVLDKRTSLAGLTDNEYGHPQYLKLSYRDRLLCRAILGAALRHRSQI 75

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L   L+  LP + +SL  LL +S+ QILYLD+ D+A +DLAV  AK D   R F+ L
Sbjct: 76  TVALSHFLVQPLPAQAFSLHHLLHISITQILYLDIPDHAAIDLAVRVAKIDSRLRRFSGL 135

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKER---VLAISDACISPLYIDL 180
           VN+ILR  +RE   L  +   I  IP WF++ L + YG E+   +LAI  + I PL  DL
Sbjct: 136 VNAILRNCAREAAILRVQTPTIEAIPTWFRQLLVSTYGVEKADQILAIQ-SIIPPL--DL 192

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  ++LP G +RL     S+  LPG+AEG WWVQD +A++P++L G +
Sbjct: 193 TVKSDSAGWAKRLGGIVLPNGSVRLVSSAYSVADLPGYAEGAWWVQDVAAALPIRLLGNI 252

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           ++  V DLCA+PGGKTAQL + GA VTA+D+S  RL++LR N++RL+ ++      D   
Sbjct: 253 HDKKVADLCASPGGKTAQLALQGADVTAIDISANRLKRLRENINRLN-FSVHYWHGDLRQ 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+D PCSSTGTIRRHPD+LWT+  +D+ K A  Q  LLL  I+ VK  G 
Sbjct: 312 FHPDQLFDAVLLDTPCSSTGTIRRHPDILWTKTMEDVTKLAEMQYDLLLAAIALVKKNGR 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL K++ E++V+K+L S+   + L P+ +    +  MA  +S EG +R  P   
Sbjct: 372 IVFSNCSLAKEEGEDLVKKIL-STRHDIVLEPILAEEMGA--MAHLVSMEGCLRTIPS-- 426

Query: 421 EKIDGVSS-------GMDGFFAVALRRL 441
           +  DG  +       GMDGFFA   R++
Sbjct: 427 DCCDGNFNTEEKLFLGMDGFFAARFRKV 454


>gi|121602907|ref|YP_988410.1| putative ribosomal RNA small subunit methyltransferase B
           [Bartonella bacilliformis KC583]
 gi|120615084|gb|ABM45685.1| putative ribosomal RNA small subunit methyltransferase B
           [Bartonella bacilliformis KC583]
          Length = 456

 Score =  353 bits (907), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 202/456 (44%), Positives = 279/456 (61%), Gaps = 26/456 (5%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ K  SL+ L D E+G   +  LS RD++L RAI+   LR   +I
Sbjct: 8   GLAVRQVCVRLLGAVLDKHTSLSGLTDHEHGHPLYLKLSYRDRLLCRAILIAALRHRGQI 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A L   L   LP K ++LQ L  +S AQILYLD+ DYA +DLAV  AK D   R F+ L
Sbjct: 68  QAALSRFLTRPLPSKAFALQHLFHISAAQILYLDIPDYAAIDLAVRAAKIDPRTRCFSGL 127

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKE---RVLAISDACISPLYIDL 180
           VN+ILR  +R+ + L ++    + +P+WF + L + YG+E   R+LA+      PL  DL
Sbjct: 128 VNAILRNFARDAMVLKRQALTFNEVPDWFWQLLVSTYGEEKAQRILAMQSET-PPL--DL 184

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +L  V+L  G +RLK L  S+V LPG+AEG WWVQD +A++P +  G +
Sbjct: 185 TVKSDSEGWAKRLGGVVLSNGSVRLKALESSVVDLPGYAEGAWWVQDVAAALPARFLGDI 244

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +   V DLCA+PGGKTAQL + GA VTA+D+S  RL++L  N+ RL+ ++      D  +
Sbjct: 245 HGKRVADLCASPGGKTAQLALQGADVTAVDLSANRLKRLTANMHRLN-FSVSYWNGDVRN 303

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P+KLFDAVL+DAPCSS GTIRRHPD+LW +  +DI+K A  Q  LLL  I+ VK GG 
Sbjct: 304 FHPEKLFDAVLLDAPCSSLGTIRRHPDILWIKSREDIMKLAAVQYDLLLAAIAVVKKGGH 363

Query: 361 VVFSNCSLDKQDSEEVVQKVLRS-SPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP-- 417
           +VFSNCSL +++ E++++KVL +   + +E +  N       DM   L+ EG +R TP  
Sbjct: 364 IVFSNCSLAREEGEDLIEKVLATRDDVVLEPILENELG----DMKHVLTVEGIVRTTPAD 419

Query: 418 --DMLEKIDGVSS----------GMDGFFAVALRRL 441
               +E  D  S           GMDGF+A  LR++
Sbjct: 420 FCGSVEFADFKSENFYAENKLLFGMDGFYAARLRKI 455


>gi|319407809|emb|CBI81460.1| SUN-family protein [Bartonella sp. 1-1C]
          Length = 456

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 202/450 (44%), Positives = 272/450 (60%), Gaps = 23/450 (5%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ KR SL  L D EYG   +  LS RD++L RAI+   LR   +I
Sbjct: 17  GLAVRQVCVRLLGAVLDKRTSLAGLTDNEYGHPQYLKLSYRDRLLCRAILGAALRHRSQI 76

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L   L+  LP + +SL  LL +S+ QILYLD+ D+A +DLAV  AK D   R F+ L
Sbjct: 77  TVALSRFLVRPLPAQAFSLHHLLHISITQILYLDIPDHAAIDLAVRVAKIDPRMRRFSGL 136

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKER---VLAISDACISPLYIDL 180
           VN+ILR  +RE   L  +   I  IP WF + L + YG E+   +LAI    I+P  +DL
Sbjct: 137 VNAILRNFAREAPILRMQTPTIKAIPMWFGQLLVSTYGAEKADQILAIQS--ITP-PLDL 193

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  ++LP G +RL     SI  LPG+AEG WWVQD +A++P +L G +
Sbjct: 194 TVKSDSAGWAKRLGGIVLPNGSVRLISSAYSIADLPGYAEGAWWVQDVAAALPARLLGNV 253

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRL----HLYAEDIIEM 296
               V DLCA+PGGKTAQL + GA V ALD+S  RL++LR N+DRL    H +  D+ E 
Sbjct: 254 YGKKVADLCASPGGKTAQLALQGADVMALDISANRLKRLRENMDRLNFSVHYWLGDLRE- 312

Query: 297 DAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVK 356
               + P +LFDAVL+D PCSSTGTIRRHPD+LWT+  DD+ K A  Q  LLL  I+ VK
Sbjct: 313 ----FHPDQLFDAVLLDTPCSSTGTIRRHPDILWTKTMDDVTKLAEVQYGLLLAAIALVK 368

Query: 357 PGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRIT 416
             G VVFSNCSL +++ E++V+K+L +    + L P+ +    +  MA  +S EG++R  
Sbjct: 369 KNGRVVFSNCSLAREEGEDLVKKILATRD-DIVLEPILAEEMGA--MAHLISMEGFLRTI 425

Query: 417 P-----DMLEKIDGVSSGMDGFFAVALRRL 441
           P     +     + +  GMDGFFA   R++
Sbjct: 426 PSDCCYENFNAEEKLFLGMDGFFAARFRKV 455


>gi|319404848|emb|CBI78449.1| SUN-family protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 456

 Score =  348 bits (892), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 198/446 (44%), Positives = 269/446 (60%), Gaps = 15/446 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ KR SL  L D EYG   +  LS RD++L RAI+   LR   +I
Sbjct: 17  GLAVRQVCVRLLGAVLDKRTSLAGLTDNEYGHPQYLKLSYRDRLLCRAILGAALRHRSQI 76

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L   L+  LP + +SL  LL +S+ QILYLD+ D+A +DLAV  AK D     F+ L
Sbjct: 77  TVALSRFLVRPLPAQAFSLHHLLHISITQILYLDIPDHAAIDLAVRVAKIDPRMPRFSGL 136

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKER---VLAISDACISPLYIDL 180
           VN+ILR  +RE   L  +   I  IP WF + L + YG E+   +LAI    I+P  +DL
Sbjct: 137 VNAILRNFAREAPILRMQTPTIKAIPMWFGQLLVSTYGAEKADQILAIQS--ITP-PLDL 193

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  ++LP G +RL     S+  LPG+AEG WWVQD +A++P +L G +
Sbjct: 194 TVKSDSAGWAKRLGGIVLPNGSVRLISSAYSVADLPGYAEGAWWVQDVAAALPARLLGNV 253

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCA+PGGKTAQL + GA VTALD+S  RL++LR N+DRL+      +  D   
Sbjct: 254 CGKKVADLCASPGGKTAQLALQGADVTALDISANRLKRLRENMDRLNFSVHYWLG-DLRQ 312

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+D PCSSTGTIRRHPD+LWT+  DD+ K A  Q  LLL  I  VK  G 
Sbjct: 313 FHPDQLFDAVLLDTPCSSTGTIRRHPDILWTKTMDDVTKLAEVQYDLLLAAIDLVKKNGC 372

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP--- 417
           +VFSNCSL +++ E++V+K+L +    + L P+ +    +  MA  +S EG++R  P   
Sbjct: 373 IVFSNCSLAREEGEDLVKKIL-AIRHDIVLEPILAEEMGA--MAHLISMEGFLRTIPSDC 429

Query: 418 --DMLEKIDGVSSGMDGFFAVALRRL 441
             +     + +  GMDGFFA   R++
Sbjct: 430 CYENFNTEEKLFLGMDGFFAARFRKV 455


>gi|17986519|ref|NP_539153.1| 16S rRNA m(5)C 967 methyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|17982123|gb|AAL51417.1| 16S rRNA m(5)c 967 methyltransferase [Brucella melitensis bv. 1
           str. 16M]
          Length = 424

 Score =  347 bits (889), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 188/429 (43%), Positives = 261/429 (60%), Gaps = 10/429 (2%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           ++ K  SL  L D  +G   +  L  RD+ LVRAI+   L     I+  ++  L   LP 
Sbjct: 1   MIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALHNRGSIERAINKRLDRPLPE 60

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A LVN++LRR++R K  
Sbjct: 61  NAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYAGLVNALLRRLARNKER 120

Query: 138 LL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
            L       + +PEWF + + + YG E+   I         ID TVK D + WA KL  V
Sbjct: 121 ALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDFTVKGDAKAWAEKLGGV 180

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
            LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L   +    V DLCAAPGGKT
Sbjct: 181 ALPNGSVRLQTVESNLTDLPGFAEGEWWVQDVAASLPARLMDDIKGKRVADLCAAPGGKT 240

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQL++ GA VTALD+S+ RL++L  NL+RL   A+  +  +  D+ P +LFDAVL+DAPC
Sbjct: 241 AQLVLQGADVTALDLSENRLKRLNANLERLGFEAK-TVATNLMDFKPDELFDAVLLDAPC 299

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG++VFSNCSL   + EE+
Sbjct: 300 SSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGVIVFSNCSLHPLEGEEM 359

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML--EKIDGVS--SGMDG 432
            +K    +P+ +E  P+       ++    ++ EG++R TP  L  +++DG    +GMDG
Sbjct: 360 ARKA-PENPL-LEPFPITEQDCPGLE--GLVTAEGFLRSTPADLPPDRLDGNPHMAGMDG 415

Query: 433 FFAVALRRL 441
           FFA   +R+
Sbjct: 416 FFAARFKRV 424


>gi|218659414|ref|ZP_03515344.1| RNA methyltransferase - sun protein [Rhizobium etli IE4771]
          Length = 311

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 163/282 (57%), Positives = 199/282 (70%), Gaps = 1/282 (0%)

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENF 159
           D++ VDLAVEQA +D  NR FAKLVN++LRR+ REK E+L  I  ++ +P WF  RLE  
Sbjct: 3   DHSAVDLAVEQANQDPRNRRFAKLVNAVLRRLGREKEEVLAEIGKVAPMPSWFLARLEKA 62

Query: 160 YGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFA 219
           YG+E  LAIS + + P  IDLTVK D E WA +LN V LPTGG+RL      I SL GF 
Sbjct: 63  YGREAALAISQSQLEPAAIDLTVKSDAEGWAKRLNGVALPTGGVRLAAFDGGIPSLEGFD 122

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKL 279
           EG WWVQDA+ASIP +LFG L      DLCAAPGGKTAQLI++G  VTALD S+ RL +L
Sbjct: 123 EGAWWVQDAAASIPARLFGDLAGKRAADLCAAPGGKTAQLILAGGAVTALDQSESRLRRL 182

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           R NLDRL L AE  +  D   + P + FDA+L+DAPCSSTGT RRHPDVLWT+  DDI +
Sbjct: 183 RSNLDRLGLTAE-TVAADLTTFKPPEGFDAILLDAPCSSTGTTRRHPDVLWTKGPDDIAR 241

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q +LL   ++ + PGG++VFSNCSLD  + EEVV +VL
Sbjct: 242 LAALQERLLRHALTLLTPGGMLVFSNCSLDPAEGEEVVARVL 283


>gi|319899453|ref|YP_004159550.1| SUN-family protein [Bartonella clarridgeiae 73]
 gi|319403421|emb|CBI76989.1| SUN-family protein [Bartonella clarridgeiae 73]
          Length = 455

 Score =  336 bits (862), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 196/446 (43%), Positives = 271/446 (60%), Gaps = 15/446 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ K   L+ L D EYG   +  LS RD++L RAI+   LR   +I
Sbjct: 16  GLVVRQVCVRLLGAVLDKHTPLSGLTDNEYGHPQYLGLSYRDRLLCRAILGAALRHRSQI 75

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L   L   LP + +SL  LL +S+ QILYLDV D+A +DLAV  AK D   R F+ L
Sbjct: 76  TVALSRFLTRPLPSQAFSLHHLLHISITQILYLDVPDHAAIDLAVRVAKIDPRMRRFSGL 135

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKER---VLAISDACISPLYIDL 180
           VN+ILR  +RE   L  +   I  IP WF+  L + YG E+   ++AI  + I PL  DL
Sbjct: 136 VNAILRNFAREAAILRVQTPTIKAIPTWFERLLVSTYGAEKADQIVAIQ-SIIPPL--DL 192

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L  ++LP G +RL     SI  LPG+AEG WWVQD +A++P  L G +
Sbjct: 193 TVKSDSAGWAKQLGGIVLPNGSVRLVSSAYSITDLPGYAEGAWWVQDVAAALPACLLGNI 252

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +   V DLCA+PGGKTAQL++ GA VTA+D+S  RL++L+ N+DRL+      +  D   
Sbjct: 253 HGKKVADLCASPGGKTAQLVLQGADVTAIDISANRLKRLKENMDRLNFSVRYWLG-DVRQ 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGTIRRHPD+LW +  DD+ K A  Q  LLL  I+ +K  G 
Sbjct: 312 FHPDQLFDAVLLDAPCSSTGTIRRHPDILWIKTMDDVTKLAEMQYDLLLAAIALLKKNGR 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP--- 417
           ++FSNCSL +++ E++V+K+L S+   + L P+ +    +  MA  LS +G++R  P   
Sbjct: 372 IIFSNCSLAREEGEDLVEKIL-STRHDIVLEPILAEEMGA--MAHLLSIKGFLRTIPSDF 428

Query: 418 --DMLEKIDGVSSGMDGFFAVALRRL 441
             +     + +  GMDGFFA   R++
Sbjct: 429 CDENFNTEEKLFLGMDGFFAARFRKV 454


>gi|114706034|ref|ZP_01438937.1| hypothetical protein FP2506_16249 [Fulvimarina pelagi HTCC2506]
 gi|114538880|gb|EAU42001.1| hypothetical protein FP2506_16249 [Fulvimarina pelagi HTCC2506]
          Length = 473

 Score =  330 bits (845), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 201/456 (44%), Positives = 263/456 (57%), Gaps = 39/456 (8%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR V++ LL  V+ ++ SL  L D ++G   FR L  RDQ LV+AI+   LRF  
Sbjct: 40  KPGLKARQVAAKLLGAVIEQQTSLDGLTDPDHGHPHFRQLEARDQGLVKAILLTALRFRG 99

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +   +   L   LP    +L  LL V+ AQI +LDV D A VDLAV  A+ D   R F 
Sbjct: 100 TLTQEIAARLDRPLPSNATALNHLLHVAAAQIRFLDVPDSAAVDLAVTAAEADPRTRRFK 159

Query: 122 KLVNSILRRVSREKIELLQRIAGISII-------PEWFKERLENFYGKERVLAISDACIS 174
            +VN++LRR++RE       + G  +        P W  ERL   YG+ R  AI+ A   
Sbjct: 160 GVVNAVLRRMTRE-------LGGAEVTTEPAIDCPNWLLERLIAAYGEPRAKAIAAAHRM 212

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPE-SIVSLPGFAEGVWWVQDASASIP 233
           P  IDLTVK D E WA +L   ++    IRL    + SI SL GFAEG WWVQDASA++P
Sbjct: 213 PAPIDLTVKTDPEAWAERLGGQVVSGPSIRLDATTQGSIASLDGFAEGKWWVQDASAALP 272

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           V+LFG L   +  DLCAAPGGKTAQL++S A VTA + SK R ++L  NL RL   AE +
Sbjct: 273 VRLFGDLTGKTAADLCAAPGGKTAQLVLSDATVTACEASKSRAKRLVANLTRLAHDAETL 332

Query: 294 IEMDAF-DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
           I    F +    + FDAVL+DAPCSSTGT+RRHPDV  T+  DD+ + A  QRKLL    
Sbjct: 333 I--GPFQETLGDRTFDAVLLDAPCSSTGTLRRHPDVGHTKSLDDVRRLAEVQRKLLDAAA 390

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS------SPI-PVELVPLNSAYWKSIDMAM 405
           + V PGG +VFSNCS+D  + EE+V+  L         PI P EL   +           
Sbjct: 391 NHVAPGGTLVFSNCSIDPIEGEELVKAFLAERKDFTRRPIEPTELPGFDK---------- 440

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           A++ +G +R TP+ML  I G+    DGF+A  L+R+
Sbjct: 441 AVTSDGDLRTTPEMLSAIGGI----DGFYASRLQRV 472


>gi|254502120|ref|ZP_05114271.1| ribosomal RNA small subunit methyltransferase B [Labrenzia
           alexandrii DFL-11]
 gi|222438191|gb|EEE44870.1| ribosomal RNA small subunit methyltransferase B [Labrenzia
           alexandrii DFL-11]
          Length = 468

 Score =  325 bits (833), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 178/439 (40%), Positives = 263/439 (59%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR V++ +L  V+ K+  L   LD+  G S FR L+  D+ LVRAI    LR   
Sbjct: 32  KPGFAARKVAADILGNVVHKKRPLDGELDMASGHSGFRALAANDRALVRAIAGAALRHRG 91

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I  +L  +L   +P K   +  +L V++AQ+ +LD+ D A V LAV+ A  D+  R + 
Sbjct: 92  EITEILGRLLDRDIPEKTGRVLDILHVAIAQMQFLDIPDRAAVSLAVDHASMDRRARPYK 151

Query: 122 KLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+ RE+ E+   +    +  P+W  E  +  YG+E   AI+ A      +DL
Sbjct: 152 GLVNGVLRRLGRERDEITSDLDAPRLNTPDWLWESWQAAYGEEGARAIAKAHEREAALDL 211

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA KL+ V++  G +RL +   ++ +L GF +G WWVQDA+AS+P +L G +
Sbjct: 212 TVKADAAAWAEKLDGVVVGAGSVRLTK-KGAVDALEGFEDGAWWVQDAAASLPAKLLGDV 270

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +   V DLCAAPGGKTAQL   GA++TA+D+SK RL++L  N+ RL L     +  D  +
Sbjct: 271 SGKQVADLCAAPGGKTAQLAAVGAEITAIDISKARLKRLAENMTRLGLSVT-TVAADLRE 329

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P+ LFDA+L+DAPCS+TGTIRRHPDV W +   DI K +  Q  LL + +S++KPGG+
Sbjct: 330 FEPEVLFDAILLDAPCSATGTIRRHPDVPWIKKPYDIEKLSEIQTALLDRVMSWLKPGGV 389

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL++ + E   +  L  +   V LVP++++      +A +++PEG++R  PD  
Sbjct: 390 LVYCTCSLERAEGEGQAEAFLERNKDRVSLVPVDASEIGG--LAESVTPEGYLRCRPDQS 447

Query: 421 EKIDGVSSGMDGFFAVALR 439
              +    GMDGFFA   R
Sbjct: 448 AGPETGLFGMDGFFAARFR 466


>gi|304392692|ref|ZP_07374632.1| ribosomal RNA small subunit methyltransferase B [Ahrensia sp.
           R2A130]
 gi|303295322|gb|EFL89682.1| ribosomal RNA small subunit methyltransferase B [Ahrensia sp.
           R2A130]
          Length = 471

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 179/449 (39%), Positives = 266/449 (59%), Gaps = 20/449 (4%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR V++ LL+ ++     L  LLD  +G +A R + + D++LVRAIV   LR   
Sbjct: 23  KPGLAARQVATTLLTRIVDDGRGLDGLLDTRHGPAALRDMPEADRLLVRAIVTTALRHRG 82

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  LD  +    P+    L   L V+ AQIL+++V D A VDLAV     D+ +  F+
Sbjct: 83  EIEHALDRCMDRKPPKNARQLIHALHVAAAQILFMEVPDSAAVDLAVTALSSDQRSTRFS 142

Query: 122 KLVNSILRRVSREKIELLQRIA----GISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            L N++LRR+ REK  L + ++     +  +P W ++R    YGKER+ +I+   +    
Sbjct: 143 GLANAVLRRMGREKDTLFEAMSDEARAVINMPPWLRKRTRKSYGKERLASIAMRHMQEPV 202

Query: 178 IDLTVKFDIETWAHKLNAVMLPTGGIR-LKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
           ID+ V+ + E WA KL  V L    +R ++E   +I + PG+ +G WWVQDA+A +P QL
Sbjct: 203 IDICVRENPEEWAEKLGGVHLFGNAVRVMRE--GAIHTWPGYDDGGWWVQDAAAQLPAQL 260

Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEM 296
            G ++   VLDLCAAPGGKTAQL  +GA VTAL+++  RL +L+ N++RL L  E  IE 
Sbjct: 261 MGDIDGKRVLDLCAAPGGKTAQLAAAGASVTALELNASRLHRLKGNMERLKLDVE-TIEG 319

Query: 297 DAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVK 356
           D F+Y P +LFDAVL+DAPCSS GTIRRHPDV W +    + + A  Q+++     +F+K
Sbjct: 320 DLFEYEPAELFDAVLLDAPCSSLGTIRRHPDVQWAKSQAIVEELADLQKRMCEHAATFIK 379

Query: 357 PGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRIT 416
           PGG ++F+NCSLD+ + E+VV  + + +  P+EL PL       +D    ++ +G +R  
Sbjct: 380 PGGTLIFANCSLDRAEGEDVVAAITKGA-APLELSPLTPDDLFGLD--DFITGQGTVRTH 436

Query: 417 PDMLEKIDGVSS---------GMDGFFAV 436
           P  L  +   +S         G+DGFFA 
Sbjct: 437 PGQLNDVPPPTSADVDPARYGGLDGFFAA 465


>gi|27375690|ref|NP_767219.1| SUN protein [Bradyrhizobium japonicum USDA 110]
 gi|27348828|dbj|BAC45844.1| SUN protein [Bradyrhizobium japonicum USDA 110]
          Length = 448

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 175/437 (40%), Positives = 260/437 (59%), Gaps = 7/437 (1%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ ++  V+ K  +L   LD        + L+ RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADIVDGVLHKHRTLDDQLDGSGAHPGLKTLADRDRALMRRLVATVLRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             VL  +L   +P +    Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  GHVLSRLLDKGIPSEAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAARYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +A  S+ +P W   R    YG+     ++ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQALVEEVATQSLDLPPWLLARWRAHYGEATARDMALALGHEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D E WA +L+   LPTG +R+  L  S+  LPGFAEG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDAEQWASRLHGETLPTGTVRML-LHGSVTMLPGFAEGQWWVQDAAAALPARLFGDIKG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            S+ DLCAAPGGKTAQL  +GA VTA+D S  R+ +LR NL RL L AE ++  DA ++ 
Sbjct: 253 KSIADLCAAPGGKTAQLAHAGAHVTAIDRSPARVARLRENLARLSLQAETVV-ADAAEWA 311

Query: 303 -PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P + FD +L+DAPC+STGTIRRHPDV W R   DI      Q++LL + +S +KPGG +
Sbjct: 312 GPAEGFDGILIDAPCTSTGTIRRHPDVAWLRQESDIAALTALQQRLLRKSVSLLKPGGTL 371

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E+ +  +L + P  +  VP+ ++  +   ++  ++ EG +R  P  L 
Sbjct: 372 VYCTCSLEPEEGEQAIATLLAAEPA-LRRVPIEAS--EVSGLSEIITAEGDLRTLPSHLP 428

Query: 422 KIDGVSSGMDGFFAVAL 438
             D    G+DGFFA  L
Sbjct: 429 NADPKLGGLDGFFAARL 445


>gi|75674355|ref|YP_316776.1| tRNA and rRNA cytosine-C5-methylase [Nitrobacter winogradskyi
           Nb-255]
 gi|74419225|gb|ABA03424.1| tRNA and rRNA cytosine-C5-methylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 450

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 175/441 (39%), Positives = 260/441 (58%), Gaps = 9/441 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V+ KR +L   L+        + L+ RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLHKRRTLDEQLEGPTAHPGLKALADRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  GHLLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +   S+  P W   R   +YG+    AI+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQSLIEEVRSESLDTPSWLMARWSGYYGEGTAKAIAAAISHEPALDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K +   WA +L+   LPTG +R   L  S+  LPGF+EG WWVQDA+A++P +LFG L  
Sbjct: 194 KANAAHWATRLHGETLPTGTVR-TSLHGSVTMLPGFSEGQWWVQDAAAALPARLFGDLRG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY- 301
             V+DLCAAPGGKTAQL+ +GA+VTA+D S  R+ +LR NL RL L A  ++  DA ++ 
Sbjct: 253 RRVIDLCAAPGGKTAQLVQAGAEVTAIDRSPNRVARLRENLGRLSLDARSLV-ADAIEWQ 311

Query: 302 --CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FD VLVDAPCS+TGTIRRHPDV W +   DI      Q++LL + I+ ++PGG
Sbjct: 312 DDVAGDGFDGVLVDAPCSATGTIRRHPDVAWLKQDSDIAALTALQQRLLNKAITLLRPGG 371

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E+VV  +L ++   +  VP+++   +   +A  ++PEG +R  P  
Sbjct: 372 TLVYCTCSLEPEEGEQVVAALL-ATDTGIRRVPVSAD--EVAGLADIVTPEGDLRTLPCH 428

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D    G+DGF+A  L R
Sbjct: 429 LAHDDPTLGGLDGFYAARLTR 449


>gi|307943521|ref|ZP_07658865.1| ribosomal RNA small subunit methyltransferase B [Roseibium sp.
           TrichSKD4]
 gi|307773151|gb|EFO32368.1| ribosomal RNA small subunit methyltransferase B [Roseibium sp.
           TrichSKD4]
          Length = 462

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 178/442 (40%), Positives = 261/442 (59%), Gaps = 10/442 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR V++ +L  V+ K   L   L+L+ G S FR L  +D+ LVRAI+   LR   
Sbjct: 27  KPGFAARKVAADILGNVVHKHRPLDGELELKSGHSGFRALEPKDRALVRAILGAALRHRG 86

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I  +L  +L   +P K   +  +L V++AQ+LYLD+ D A V LAV+ A  D  +R + 
Sbjct: 87  EISEILTRLLDRDIPEKTGRVLDILHVAIAQMLYLDIPDRAAVSLAVDHASADSRSRVYK 146

Query: 122 KLVNSILRRVSREKIELLQRIAG-ISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+ RE+  + + + G +   PEW   R    YG+E    I+ A      +D+
Sbjct: 147 GLVNGVLRRLGRERDMMTEDLDGEVLNTPEWLFTRWVETYGEETARKIAAAHQHEAALDI 206

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           +VK + + WA +L  V+L    IRL     ++  L GF EG WWVQD +AS+P +L G +
Sbjct: 207 SVKSNPKVWAERLEGVLLAGKTIRLSR-KGAVDGLVGFEEGAWWVQDLAASLPARLLGDV 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +  +V DLCAAPGGKTAQL  S  KVTA+D+SK RL++L  N+DRL L  E ++  D   
Sbjct: 266 SGQTVADLCAAPGGKTAQLAASSGKVTAVDISKGRLKRLSQNMDRLGLPVETVV-ADLRK 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           Y P +LFDA+L+D PCS+TGTIRRHPDV W +   DI   A  Q++LL +   ++KPGG 
Sbjct: 325 YDPPELFDAILLDVPCSATGTIRRHPDVPWLKGERDIETLAEIQKELLERVAGWLKPGGQ 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CS+++ + E  ++  L++  +   LVP+       ++    +SPEG++R  P   
Sbjct: 385 MVYCTCSMERDEGEAQIEAFLKAH-LDFRLVPVAGDEIGGLN--ACISPEGYVRTLP--F 439

Query: 421 EKIDGVS--SGMDGFFAVALRR 440
             +D  S  +G+DGFFA  L+R
Sbjct: 440 HSVDPNSELTGLDGFFAARLQR 461


>gi|118591346|ref|ZP_01548744.1| SUN protein [Stappia aggregata IAM 12614]
 gi|118436018|gb|EAV42661.1| SUN protein [Stappia aggregata IAM 12614]
          Length = 458

 Score =  313 bits (803), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 182/442 (41%), Positives = 264/442 (59%), Gaps = 7/442 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR V++ +L  V+ K+  L   LD   G S FR L+  D+ LVRAI+   LR   
Sbjct: 22  KPGFAARKVAADILGNVVHKKRPLDGELDTASGHSGFRALAANDRSLVRAIIGAALRHRG 81

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I  +LD +L   +P K   +  +L V++AQ+L+LD+ D A V LAV+ A  D+  R + 
Sbjct: 82  EIAEILDRLLDRPIPEKTGRVLDILHVAIAQMLFLDIPDRAAVSLAVDHAGLDRRARPYK 141

Query: 122 KLVNSILRRVSREKIELLQRI-AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+ RE+ E+   + A +   P+W  E  +  YG E    I+ A  +   +DL
Sbjct: 142 GLVNGVLRRLGRERDEVTADLDAAVLNTPDWLMESWQVAYGPETAREIARAHETEAALDL 201

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           +VK D E WA KL+  ++  G +RL     ++ +L G+ +G WWVQDA+A++P +L G +
Sbjct: 202 SVKADPEGWAQKLDGQIVGAGSVRLVR-KGAVDALEGYGDGQWWVQDAAAALPARLLGDV 260

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI-IEMDAF 299
             L V DLCAAPGGKTAQL  +GA VTA+D+SK RL++L  N+ RL L  E +  ++ AF
Sbjct: 261 KGLRVADLCAAPGGKTAQLAAAGASVTAVDISKARLKRLEENMTRLGLSVETVAADLRAF 320

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           +  P++ FDA+L+DAPCS+TGTIRRHPDV W +   DI K    Q +LL + + +VKPGG
Sbjct: 321 E--PEEPFDAILLDAPCSATGTIRRHPDVPWIKKPYDIEKLTEIQSELLDRVVGWVKPGG 378

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
           ++V+  CSL+  + E  V   L      +EL+ + +       +A  ++ EG++R  P  
Sbjct: 379 LIVYCTCSLEAAEGEAQVSAFLERQGGKMELIAVEAGEVGG--LAECVTKEGYLRCLPCH 436

Query: 420 LEKIDGVSSGMDGFFAVALRRL 441
              +D VS GMDGFFA  LRR 
Sbjct: 437 SAAVDPVSKGMDGFFAARLRRF 458


>gi|91975197|ref|YP_567856.1| Fmu (Sun) [Rhodopseudomonas palustris BisB5]
 gi|91681653|gb|ABE37955.1| Fmu (Sun) [Rhodopseudomonas palustris BisB5]
          Length = 450

 Score =  311 bits (797), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 176/441 (39%), Positives = 263/441 (59%), Gaps = 10/441 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V++KR +L   L+        + L  RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLQKRRTLDEQLEGPAAHPGLKTLPDRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           + +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  EHLLARMLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +AG ++ +PEW   R    YG++   AI+ A      +D+TV
Sbjct: 134 VNAVLRRCAREGQPLIEEVAGQALDVPEWLMARWRAHYGEDAAKAIAVAISHEPSLDITV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D + WA +L   +LPTG +R   L  S+  LPGF +G WWVQDA+A++P +LFG L  
Sbjct: 194 KSDPQHWAGRLYGELLPTGTVRTL-LQGSVKMLPGFEDGEWWVQDAAAALPARLFGDLAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY- 301
            SV DLCAAPGGKTAQL  +GA+V+A+D S  R+ +LR NL RL L AE  +  DA ++ 
Sbjct: 253 KSVADLCAAPGGKTAQLAQAGARVSAIDRSPARVARLRENLARLSLEAETGV-ADATEWR 311

Query: 302 --CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
              P   FD VLVDAPC+STGTIRRHPDV W +   DI   +  Q +LL +  + +KPGG
Sbjct: 312 SDAPGS-FDGVLVDAPCASTGTIRRHPDVAWLKQESDIGALSAVQSRLLEKAAALLKPGG 370

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E+ + K+L + P  +  VP+  A  +   +A  ++P+G +R  P  
Sbjct: 371 TLVYCTCSLEPEEGEQAIAKLLAAEPQ-MRRVPVEPA--EVAGLADIVTPQGDLRTLPSH 427

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D   +G DGF+A  L +
Sbjct: 428 LPHADPRLAGFDGFYAARLTK 448


>gi|146337494|ref|YP_001202542.1| putative ribosomal RNA small subunit methyltransferase B
           [Bradyrhizobium sp. ORS278]
 gi|146190300|emb|CAL74296.1| putative Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967
           methyltransferase)(rsmB) [Bradyrhizobium sp. ORS278]
          Length = 450

 Score =  309 bits (791), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 177/440 (40%), Positives = 256/440 (58%), Gaps = 8/440 (1%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ ++  V+ K  +L   LD        + L+ RD+ L+R +V  TLR L  +
Sbjct: 14  GLAARRIAADVIDGVLHKHRTLDDQLDGPGAHPGLKQLADRDRALMRRLVATTLRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             VL  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  GNVLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   LL    G  + I  W  +R  + YG+     I+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGAALLDDAKGQPLDIAPWLLKRWTDHYGEATARDIAAALGQEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+  +LPTG +R   L  S+  LPGFAEG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDPAQWASRLHGEVLPTGTVR-TLLHGSVTVLPGFAEGQWWVQDAAAALPARLFGDVAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            S+ DLCAAPGGKTAQL   GA+VTA+D S  R+ +L+ N+ RL L AE ++  DA ++ 
Sbjct: 253 KSMADLCAAPGGKTAQLAHGGARVTAVDRSPARMSRLKDNMTRLQLPAETVV-TDAAEWQ 311

Query: 303 PKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           P     FD +L+DAPC+STGTIRRHPDV W R+  DI   +  Q +LL +    +KPGG 
Sbjct: 312 PADAGGFDGILLDAPCTSTGTIRRHPDVGWLRNEADIAALSGTQVRLLTRAAGLLKPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+VV  VL +    +  VP++ A  +   +A  ++P G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQVVDHVLAAG-TELRRVPIDPA--EVAGLAELVTPMGDLRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D    G+DGF+A  L R
Sbjct: 429 PHADPRLGGLDGFYAARLER 448


>gi|299133157|ref|ZP_07026352.1| Fmu (Sun) domain protein [Afipia sp. 1NLS2]
 gi|298593294|gb|EFI53494.1| Fmu (Sun) domain protein [Afipia sp. 1NLS2]
          Length = 446

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 260/438 (59%), Gaps = 11/438 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ ++  V+ KR +L   L+        + LS RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADIIDGVLHKRRTLDDQLEGPAAHPVLKTLSDRDRALMRRLVATVLRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  GHLLSRLLDRGIPSDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE + L++ +  G+  +P W   R    YG++   A++ A      +DLTV
Sbjct: 134 VNAVLRRCAREGLPLVEEVKDGMIDLPPWLVARWIKAYGEDNARAMARAIGHEPPLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D E+WA +L+  MLPTG +R  +L   I  LPGF+EG WWVQDA+A+IP +LFG +  
Sbjct: 194 KTDSESWATRLHGEMLPTGTVR-TQLHGPITMLPGFSEGAWWVQDAAAAIPARLFGDITG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA--FD 300
            SV DLCAAPGGKTAQL  +GA VTA+D S  RL +L+ N  RL L A   +  DA  +D
Sbjct: 253 KSVADLCAAPGGKTAQLAQAGAHVTAVDRSAGRLARLKDNFARLSLEAS-CVATDATEWD 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
             P   FDA+L+DAPC +TGTIRRHPDV W ++  D+      Q++LL + ++ +KPGG+
Sbjct: 312 GGP---FDAILLDAPCMATGTIRRHPDVAWLKNEADMGALNALQKRLLQKSVTLLKPGGM 368

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+ +  +L S P  V+ +P+         ++  ++ +G +R  P  L
Sbjct: 369 LVYCTCSLEPEEGEQAIASLLASEPQ-VKRMPVTPGELAG--LSELITADGDVRTLPCHL 425

Query: 421 EKIDGVSSGMDGFFAVAL 438
              D   SG+DGF+A  L
Sbjct: 426 PHADPKLSGLDGFYAARL 443


>gi|90421553|ref|YP_529923.1| Fmu (Sun) [Rhodopseudomonas palustris BisB18]
 gi|90103567|gb|ABD85604.1| Fmu (Sun) [Rhodopseudomonas palustris BisB18]
          Length = 450

 Score =  307 bits (787), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 179/444 (40%), Positives = 260/444 (58%), Gaps = 11/444 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V+ K  +L   L+        + LS RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLHKHRTLDDQLEGAAAHPGLKTLSDRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             VL  +L   LP      Q  L +  AQIL+++V D+A VDL+V   + D+    +A L
Sbjct: 74  GHVLSRMLDRGLPTDAPRAQSALLIGAAQILWMEVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L+  + G S+ +P W   R    YG +   AI+ A      +DL+V
Sbjct: 134 VNAVLRRCAREGQPLIDEVQGQSLDVPPWLLARWSAHYGADTARAIARAIGEEPSLDLSV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D E WA +L+  +LPTG +R   L  S+  LPGF +G WWVQDA+A++P +LFG L  
Sbjct: 194 KSDAEAWASRLHGEVLPTGTVR-TLLQGSVKMLPGFDDGQWWVQDAAAALPARLFGDLTG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            SV DLCAAPGGKTAQL  +GA VTA+D S+ R+ +LR NL RL L AE  +  DA ++ 
Sbjct: 253 KSVADLCAAPGGKTAQLCNAGAWVTAIDRSQSRVARLRENLGRLGLPAETAV-ADAAEWP 311

Query: 303 PKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDAVL+DAPCSSTGTIRRHPDV W +   DI   A  Q++LL + +S +KPGG 
Sbjct: 312 GNGGDGFDAVLLDAPCSSTGTIRRHPDVAWLKQEADIGALAAQQQRLLHKAVSLLKPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E  +  +L  +   +   P++S+  +   +   ++P+G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEVAIAALLAGNS-GMRRAPVDSS--EVAGLGDLITPDGALRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRRLIQP 444
              D    G+DGF+A    RL++P
Sbjct: 429 PHPDPRLGGLDGFYAA---RLVKP 449


>gi|85714014|ref|ZP_01045003.1| tRNA and rRNA methylase [Nitrobacter sp. Nb-311A]
 gi|85699140|gb|EAQ37008.1| tRNA and rRNA methylase [Nitrobacter sp. Nb-311A]
          Length = 454

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 171/441 (38%), Positives = 254/441 (57%), Gaps = 9/441 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R  ++ +L  ++ KR +L   L+        + L+ RD+ L+R +V   LR L  +
Sbjct: 18  GLATRRTAADILDGILHKRRTLDEQLEGATAHPGLKALADRDRALMRRLVATILRRLGTL 77

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 78  GHLLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 137

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +   S+ +P W   R    YG+    AI+ A      +DLTV
Sbjct: 138 VNAVLRRCAREGQALIEEVRSESLDVPPWLMARWSRHYGENTAKAIAAAINYEPALDLTV 197

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+   LPTG +R   L  S+  LPGF++G WWVQDA+A++P +LFG ++ 
Sbjct: 198 KADAAYWATRLHGEALPTGTVR-TSLQGSVTMLPGFSDGQWWVQDAAAALPARLFGDISG 256

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY- 301
             ++DLCAAPGGKTAQL  +GA VTA+D S  R+ +LR NL RL L    I+  DA ++ 
Sbjct: 257 RRIIDLCAAPGGKTAQLAQAGADVTAMDRSPNRVARLRENLGRLSLTVRSIV-ADAIEWQ 315

Query: 302 --CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FD VLVDAPCS+TGTIRRHPDV W +   DI      Q++LL + I+ +KPGG
Sbjct: 316 NDVGVDSFDGVLVDAPCSATGTIRRHPDVAWLKQESDIGALTALQQRLLKKAITLLKPGG 375

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +++  CSL+ ++ E+VV  +L S P  +  VP++ A  +   +   ++P G +R  P  
Sbjct: 376 TLIYCTCSLEPEEGEQVVAALLASEP-GIRRVPVSGA--EVAGLTDIVTPAGDLRTLPCH 432

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D    G+DGF+A  L +
Sbjct: 433 LPHDDPTLGGLDGFYAARLTK 453


>gi|86747213|ref|YP_483709.1| RNA methyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570241|gb|ABD04798.1| RNA methyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 450

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 179/445 (40%), Positives = 260/445 (58%), Gaps = 18/445 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V++KR  L   L+        + L  RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLPDRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           + +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  EHLLARMLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L+  +AG ++ +PEW   R    YG +   AI+ A      +D+TV
Sbjct: 134 VNAVLRRCAREGHPLIDAVAGQALDVPEWLMARWRAHYGDDAAKAIALAISHEPSLDITV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D + WA +L   +LPTG +R   L  S+  LPGF +G WWVQDA+A++P +LFG L  
Sbjct: 194 KSDPDHWAGRLYGELLPTGTVRTL-LQGSVKMLPGFDDGQWWVQDAAAALPARLFGDLAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY- 301
            SV DLCAAPGGKTAQL  +GA+V+A+D S  R+ +LR NL RL L AE  +  DA ++ 
Sbjct: 253 KSVADLCAAPGGKTAQLAQAGARVSAIDRSPARVARLRENLARLGLEAETAV-ADATEWR 311

Query: 302 --CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
              P   FD VLVDAPC+STGTIRRHPDV W +   DI   +  Q +LL + ++ +KPGG
Sbjct: 312 SDAPGS-FDGVLVDAPCASTGTIRRHPDVAWLKQESDIGALSAVQSRLLHKAVALLKPGG 370

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSP----IPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
            +V+  CSL+ ++ E+VV  +L + P    +PVE  P   A      +A  ++ EG +R 
Sbjct: 371 TLVYCTCSLEPEEGEQVVGALLDAEPGMRRLPVE--PAEVA-----GLAEIVTAEGDVRT 423

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRR 440
            P  L   D   +G DGF+A  L +
Sbjct: 424 LPSHLPHADPRLAGFDGFYAARLTK 448


>gi|254472533|ref|ZP_05085933.1| SUN protein [Pseudovibrio sp. JE062]
 gi|211958816|gb|EEA94016.1| SUN protein [Pseudovibrio sp. JE062]
          Length = 415

 Score =  306 bits (783), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 173/419 (41%), Positives = 249/419 (59%), Gaps = 8/419 (1%)

Query: 23  ISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSL 82
           + L C LDL  G   ++ L   D+ LVRAI+   LR   +I  V+D  L   +P K   +
Sbjct: 1   MPLDCELDLNNGHPGYKRLEPNDRALVRAIIGTALRRRGQIQDVIDRFLDRPIPEKTGRV 60

Query: 83  QQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELL-QR 141
             +L V++AQ+ ++ V D+A V LAV  A RD   + +  LVN++LRR +RE   ++ ++
Sbjct: 61  LDILHVAMAQLFFMSVPDHAAVSLAVTLAGRDGRAKPYKNLVNAVLRRATREGAAIIAEQ 120

Query: 142 IAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTG 201
            A     PEW   R    YG+E   A+S A ++  Y+DLTV  D E WA KL   +    
Sbjct: 121 DAEKLNAPEWMFARWCEVYGEEAARAMSAAHMTEPYLDLTVPADREAWAEKLGGEVQLGY 180

Query: 202 GIRLKELPES-IVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI 260
            +RL+  P+  I  L GF +G WWVQDA+A++P +L G +    V DLCAAPGGKT QL 
Sbjct: 181 SVRLQ--PDGPIEKLEGFDDGKWWVQDAAAAVPARLLGDIKGKVVADLCAAPGGKTMQLA 238

Query: 261 VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTG 320
            +GA VTA+D+S RRL++L  NL R+ L AE  I  D  ++ P  LFDA+L+DAPCS+TG
Sbjct: 239 AAGADVTAVDISARRLQRLTQNLKRVGLEAETEIS-DLREFVPIDLFDAILLDAPCSATG 297

Query: 321 TIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKV 380
           TIRRHPDV W +  DD++K A  Q +LL + + ++KPGG +V+  CSL++++ E  +Q++
Sbjct: 298 TIRRHPDVAWLKREDDVLKLADLQYELLEKALGWLKPGGTLVYCTCSLEQEEGELQIQRL 357

Query: 381 LRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
           L   P  V+ VP+ +     +  A A++ +G  R  P         S G+DGFFA  LR
Sbjct: 358 LLEHP-EVQRVPVTAEELGGV--AEAINSQGDFRAMPGQNLSSGKTSGGLDGFFAARLR 413


>gi|328541770|ref|YP_004301879.1| ribosomal RNA small subunit methyltransferase B [polymorphum gilvum
           SL003B-26A1]
 gi|326411522|gb|ADZ68585.1| Ribosomal RNA small subunit methyltransferase B [Polymorphum gilvum
           SL003B-26A1]
          Length = 439

 Score =  304 bits (778), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 179/439 (40%), Positives = 256/439 (58%), Gaps = 6/439 (1%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G   R  ++ +L  V+  R  L   LD   G S FR L  +D+ LVRAI+   LR   RI
Sbjct: 6   GFAVRKAAADILGAVVHARRPLDGELDPVSGHSGFRALDSKDRALVRAILGACLRRRGRI 65

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A++D +L   +P K   +  +L V+ AQ+L+LDV D A V +AV+ A  D+  R +  L
Sbjct: 66  AAIVDALLDRPIPEKTGRVLDILHVAAAQVLFLDVPDRAAVSVAVDLAAADRRARPYKGL 125

Query: 124 VNSILRRVSREKIELLQRIAGI-SIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN +LRR+SREK  LL   + +    P+W  +R    +G+   +AI+ A  +   +DLTV
Sbjct: 126 VNGVLRRLSREKDALLADFSDVRGTPPDWLFDRWTAAWGEATAVAIAHALANEPELDLTV 185

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D E WA +L   ++ TG +RL     ++ +  G+ EG WWVQDA+A++P +L G L  
Sbjct: 186 KSDPELWAQRLGGRVVATGSVRLSR-KGAVETFEGYGEGAWWVQDAAAALPARLLGPLAG 244

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCAAPGGKTAQL  +G +VTA+D+S +RL+++  NL RL   A DI+  D  D+ 
Sbjct: 245 KRVADLCAAPGGKTAQLAAAGGRVTAVDISGKRLKRVAENLARLGFEA-DIVAADLKDWQ 303

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P + FDA+L+DAPCS+TGTIRRHPDV WT+ + DI   A  Q  LL +   ++ PGG +V
Sbjct: 304 PAERFDAILLDAPCSATGTIRRHPDVAWTKRSQDIATLAGVQALLLRRAAGWLVPGGTLV 363

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           +  CSL+ ++ E  +   L   P    LVP+  A  +   +A  ++ EG +R  P  L  
Sbjct: 364 YCTCSLELEEGEAQIAAFLAEVP-GFALVPV--APGEIGGLAECVTDEGCLRTLPCHLGG 420

Query: 423 IDGVSSGMDGFFAVALRRL 441
            +    G+DGFFA  L RL
Sbjct: 421 AEAADGGLDGFFAARLTRL 439


>gi|39933110|ref|NP_945386.1| Sun/ nucleolar Nop1/Nop2 [Rhodopseudomonas palustris CGA009]
 gi|39652735|emb|CAE25474.1| Bacterial Sun/eukaryotic nucleolar Nop1/Nop2 [Rhodopseudomonas
           palustris CGA009]
          Length = 450

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 178/445 (40%), Positives = 255/445 (57%), Gaps = 22/445 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V++KR  L   L+        + LS RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLSDRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           + +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  EGLLAKLLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +A G   +P+W   R    YG E   AI+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQPLVEELAAGTPDVPQWLLARWSEHYGAETTRAIAHAISHEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+  +LPTG +R   L  S+  LPGF EG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDPAHWAARLHGEVLPTGTVRTL-LQGSVRMLPGFDEGQWWVQDAAAALPARLFGDIAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            SV DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL L  E  +  DA ++ 
Sbjct: 253 KSVADLCAAPGGKTAQLAAAGARVTAIDRSPARVARLRENLARLSLKVETGV-ADAAEWR 311

Query: 303 PKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDAVL+DAPC+STGTIRRHPDV W +   DI   A  Q +LL +  S ++PGG 
Sbjct: 312 GDATAEFDAVLIDAPCASTGTIRRHPDVAWLKQESDIGALAAVQNRLLKKAASLLRPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVL------RSSPI-PVELVPLNSAYWKSIDMAMALSPEGWI 413
           +V+  CSL+ ++ E+ +  +L      R  PI P E+  L          A  ++ +G +
Sbjct: 372 LVYCTCSLEPEEGEQAIAALLDAESSMRRQPIDPAEVAGL----------AEIVTTDGAL 421

Query: 414 RITPDMLEKIDGVSSGMDGFFAVAL 438
           R  P  L   D   +G+DGF+A  L
Sbjct: 422 RTLPCHLPHSDPRLAGLDGFYAARL 446


>gi|192288464|ref|YP_001989069.1| Fmu (Sun) domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192282213|gb|ACE98593.1| Fmu (Sun) domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 450

 Score =  303 bits (775), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 177/445 (39%), Positives = 255/445 (57%), Gaps = 22/445 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V++KR  L   L+        + LS RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLSDRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           + +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  EGLLAKLLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +A G   +P+W   R    YG E   AI+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQPLVEELAAGTPDVPQWLLARWSEHYGAETARAIAHAISHEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+  +LPTG +R   L  S+  LPGF EG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDPAHWAARLHGEVLPTGTVRTL-LQGSVRMLPGFDEGQWWVQDAAAALPARLFGDIAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            SV DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL    E  +  DA ++ 
Sbjct: 253 KSVADLCAAPGGKTAQLAAAGARVTAIDRSPARVARLRENLARLSFEVETGV-ADAAEWR 311

Query: 303 PKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
             +   FDAVL+DAPC+STGTIRRHPDV W +   DI   A  Q +LL +  S ++PGG 
Sbjct: 312 GDETAEFDAVLIDAPCASTGTIRRHPDVAWLKQESDIGALAAVQNRLLKKAASLLRPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVL------RSSPI-PVELVPLNSAYWKSIDMAMALSPEGWI 413
           +V+  CSL+ ++ E+ +  +L      R  PI P E+  L          A  ++ +G +
Sbjct: 372 LVYCTCSLEPEEGEQAIAALLDAESSMRRQPIDPAEVAGL----------AEIVTADGAL 421

Query: 414 RITPDMLEKIDGVSSGMDGFFAVAL 438
           R  P  L   D   +G+DGF+A  L
Sbjct: 422 RTLPCHLPHSDPRLAGLDGFYAARL 446


>gi|316931426|ref|YP_004106408.1| Fmu (Sun) domain-containing protein [Rhodopseudomonas palustris
           DX-1]
 gi|315599140|gb|ADU41675.1| Fmu (Sun) domain protein [Rhodopseudomonas palustris DX-1]
          Length = 450

 Score =  302 bits (773), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 173/438 (39%), Positives = 256/438 (58%), Gaps = 8/438 (1%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V++KR  L   L+        + LS RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLSDRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           + +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  EGLLARLLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L++ +A G   +P+W   R    YG +   AI+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQPLVEELAAGTPDVPQWLLARWSAHYGADTARAIAQAISHEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+  +LPTG +R   L  S+  LPGF EG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDPAHWATRLHGEVLPTGTVRTL-LQGSVRMLPGFDEGQWWVQDAAAALPARLFGDIAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            SV DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL L  E  +  DA ++ 
Sbjct: 253 KSVADLCAAPGGKTAQLAAAGARVTAIDRSPARVARLRENLARLSLEVETGV-ADAAEWR 311

Query: 303 PKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDAVL+DAPC+STGTIRRHPDV W +   DI   A  Q +LL +  S ++PGG 
Sbjct: 312 GDATAEFDAVLIDAPCASTGTIRRHPDVAWLKQESDIGALAAVQNRLLKKAASLLRPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+ +  +L + P  +   P++ A  +   +   ++ +G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQAIAVLLAAEP-SMRRQPIDPA--EVAGLTEIVTADGALRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVAL 438
              D   +G+DGF+A  L
Sbjct: 429 PHSDPRLAGLDGFYAARL 446


>gi|92115829|ref|YP_575558.1| Fmu (Sun) [Nitrobacter hamburgensis X14]
 gi|91798723|gb|ABE61098.1| Fmu (Sun) [Nitrobacter hamburgensis X14]
          Length = 450

 Score =  302 bits (773), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 175/439 (39%), Positives = 251/439 (57%), Gaps = 9/439 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V+ K  +L   L+        + L+ RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLHKHRTLDEQLEGAAAHPGLKALADRDRALMRRLVATILRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             VL  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  GHVLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L+  +   ++ IP W   R    YG+    AI+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQPLIDEVRSEALDIPPWLMTRWIANYGENTAKAIATAISHEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K     WA +L+  +LPTG +R   L   +  LPGF+EG WWVQDA+A++P +LFG L  
Sbjct: 194 KAGAAQWATRLHGEVLPTGTVR-TALQGPVTMLPGFSEGRWWVQDAAAALPARLFGDLQG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY- 301
             V DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL L A  ++  DA ++ 
Sbjct: 253 RRVADLCAAPGGKTAQLAQAGAEVTAIDRSPNRVARLRDNLGRLSLGARALV-ADAVEWQ 311

Query: 302 --CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FD VLVDAPCSSTGTIRRHPDV W +   DI      Q++LL +  + +KPGG
Sbjct: 312 DDAAGSGFDGVLVDAPCSSTGTIRRHPDVAWLKQDSDIAALTALQKRLLQKAFALLKPGG 371

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E +V  +L +S   V  VP+ +A    ++  +  +P G +R  P  
Sbjct: 372 TLVYCTCSLEPEEGEHLVGALL-ASEAGVRRVPIGAAEVAGLEDIV--TPAGDLRTLPCH 428

Query: 420 LEKIDGVSSGMDGFFAVAL 438
           L   D   SG+DGF+A  L
Sbjct: 429 LPHDDPRLSGLDGFYAARL 447


>gi|148251938|ref|YP_001236523.1| putative ribosomal RNA small subunit methyltransferase B
           [Bradyrhizobium sp. BTAi1]
 gi|146404111|gb|ABQ32617.1| putative Ribosomal RNA small subunit methyltransferase B
           [Bradyrhizobium sp. BTAi1]
          Length = 450

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 175/440 (39%), Positives = 252/440 (57%), Gaps = 8/440 (1%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ ++  V+ K  +L   LD        + L+ RD+ L+R +V  TLR L  +
Sbjct: 14  GLAARRIAADVVDGVLHKHRTLDDQLDGTGAHPGLKQLADRDRALMRRLVATTLRRLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             VL  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  GHVLSRLLDRGVPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   LL  + G  + I  W   R    YG+     I+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGAGLLDDVQGQPLDIAPWLLTRWIAHYGEATAKNIAAALGQEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+  +LPT  +R   L  S+  LPGFAEG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDAAQWAARLHGEVLPTETVRTL-LHGSVTVLPGFAEGQWWVQDAAAALPARLFGDVAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            ++ DLCAAPGGKTAQL   GA VTA+D S  R+ +L+ N+ RL L AE  +  DA ++ 
Sbjct: 253 KTMADLCAAPGGKTAQLAHGGAHVTAVDRSPARMARLKDNMTRLQLTAETAV-ADAAEWQ 311

Query: 303 PKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           P     FD +LVDAPC+STGTIRRHPDV W R   DI   +  QR+LL +  S +KPGG+
Sbjct: 312 PAATGGFDGILVDAPCTSTGTIRRHPDVGWLRSEADIAALSSVQRRLLTRAASLLKPGGM 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+VV+  L  +   +  VP+  +  +   +A  ++  G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQVVESALADT-TELRRVPITPS--EVAGLAELITEAGDLRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D    G+DGF+A  L R
Sbjct: 429 PHQDPRLGGLDGFYAARLER 448


>gi|209883490|ref|YP_002287347.1| SUN protein [Oligotropha carboxidovorans OM5]
 gi|209871686|gb|ACI91482.1| SUN protein [Oligotropha carboxidovorans OM5]
          Length = 446

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 173/440 (39%), Positives = 253/440 (57%), Gaps = 15/440 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ ++  V+ KR +L   L+      A + LS RD+ L+R +V   LR    +
Sbjct: 14  GLAARRIAADIIDGVLHKRRTLDDQLEGAAQHPALKSLSDRDRALMRRLVATVLRRRGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A L
Sbjct: 74  AYLLSRLLDRGVPSDAPRAQSALMIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE I L+       I +P W   R    YG++   A++ A      +DLTV
Sbjct: 134 VNAVLRRCAREGIPLIDESTDEMIDLPPWLATRWIKAYGEDTARAMARAIGHEPPLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D E WA +L+   LPTG +R   L  S+  LPGF+EG WWVQDA+A++P +LFG +  
Sbjct: 194 KSDSENWATRLHGETLPTGTVRTL-LHGSVTMLPGFSEGAWWVQDAAAALPARLFGDIAG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCAAPGGKTAQL  +GAKVTA+D S  RL +L+ N  RL L A   +  DA ++ 
Sbjct: 253 KPVADLCAAPGGKTAQLAQAGAKVTAVDRSAGRLARLKENFARLGLEAT-YVAADATEW- 310

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
               FDA+L+DAPC +TGTIRRHPDV W ++  D+   +  Q +LL + ++ +KPGG +V
Sbjct: 311 EAGPFDAILLDAPCMATGTIRRHPDVAWLKNEADLDALSALQARLLRKSVTLLKPGGTLV 370

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPI----PVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           +  CSL+ ++ E+ +  +L + P     PVE   L         ++  +SP G +R  P 
Sbjct: 371 YCTCSLEPEEGEQAIAALLEAEPQMKRRPVEASELAG-------LSELISPMGDVRTLPC 423

Query: 419 MLEKIDGVSSGMDGFFAVAL 438
            L+  D   SG+DGF+A  L
Sbjct: 424 HLQHDDPKLSGLDGFYAARL 443


>gi|115522058|ref|YP_778969.1| sun protein [Rhodopseudomonas palustris BisA53]
 gi|115516005|gb|ABJ03989.1| sun protein [Rhodopseudomonas palustris BisA53]
          Length = 449

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 176/440 (40%), Positives = 248/440 (56%), Gaps = 13/440 (2%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR +++ +L  V+ KR  L   LD        + LS RD+ L+R +V   LR L  +
Sbjct: 14  GLAARRIAADILDGVLHKRRMLDDQLDGPAAHPGLKTLSDRDRALMRRLVATILRKLGTL 73

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
             VL  +L   +P      Q  L +  AQIL+++V D+A VDL+V   + D+    +A L
Sbjct: 74  GHVLSRLLDRGVPTDAPRAQSALLIGAAQILWMEVPDHAAVDLSVRLVQSDRRAAKYAGL 133

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR +RE   L+  + G  I +P W   R    YG+E    I+ A      +DLTV
Sbjct: 134 VNAVLRRCAREGQPLIAEVQGQPIDLPPWLFARWSAHYGEETARKIALALGEEPSLDLTV 193

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K DIE WA +L+  +LPTG +R   L  S+  L G+ +G WWVQDA+A++P +LFG L  
Sbjct: 194 KSDIEAWAARLHGEILPTGTLR-TALQGSVKMLHGYEDGQWWVQDAAAALPARLFGALQG 252

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE----DIIEMDA 298
             +LDLCAAPGGKTAQL + GA VTA+D S  R+ +L+ NL RL L  E    D  E D 
Sbjct: 253 QRILDLCAAPGGKTAQLALGGANVTAIDRSPNRVARLKENLARLSLKVETVVADATEWDG 312

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
            D      FD VLVDAPCSSTGTIRRHPD+ W +   DI      Q +LL +  S +KPG
Sbjct: 313 GD----TRFDGVLVDAPCSSTGTIRRHPDIAWLKQEADIATLGALQARLLQKASSLLKPG 368

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G +V+  CSL+ ++ E+ +  +L +      L P+  A  +   +A  ++ +G +R  P 
Sbjct: 369 GTLVYCTCSLEPEEGEQAIAALLAADATLRRL-PIEPA--EVAGLAEIVTADGDLRTLPC 425

Query: 419 MLEKIDGVSSGMDGFFAVAL 438
            L   D   +G+DGF+A  L
Sbjct: 426 HLPHPDAKLAGLDGFYAARL 445


>gi|209965632|ref|YP_002298547.1| ribosomal RNA small subunit methyltransferase B [Rhodospirillum
           centenum SW]
 gi|209959098|gb|ACI99734.1| ribosomal RNA small subunit methyltransferase B [Rhodospirillum
           centenum SW]
          Length = 447

 Score =  293 bits (750), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 174/427 (40%), Positives = 245/427 (57%), Gaps = 16/427 (3%)

Query: 15  LSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISS 74
           +   +RK +     L+   G    R L  RD+  VR +     R L ++DA++   L   
Sbjct: 34  IQATLRKGVPFDDALEANRG---VRALEPRDRGFVRLLCATVFRRLGQLDALVQGALAKP 90

Query: 75  LPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE 134
               K  +Q +LR+  AQ+L+L    +A VD +VE A    +   +  LVN++LRR+SRE
Sbjct: 91  GQPVKGPVQDILRLGAAQLLFLGTPAHAAVDTSVELAVARGQT-PYKGLVNAVLRRLSRE 149

Query: 135 KIELLQ-RIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKL 193
              LL  + AG    P+W        YG     AI +A ++   +D+TV+ D + WA +L
Sbjct: 150 GAGLLAAQDAGRLNTPDWLWLAWRQAYGTGATRAIVEAHLAEPPLDITVRADADLWAERL 209

Query: 194 NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPG 253
            A  LP G +RL      +  LPGFAEG WWVQDA+A+IP +LFG +    VLDLCAAPG
Sbjct: 210 GAERLPGGSLRLPAG-GPVTELPGFAEGAWWVQDAAAAIPARLFGDVAGREVLDLCAAPG 268

Query: 254 GKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVD 313
           GKTAQL  +GA+VTA+D S++RLE+LR NL RL L  E  +  DA  + P    DAVL+D
Sbjct: 269 GKTAQLAAAGARVTAVDRSEKRLERLRENLARLGLEVE-TVAADATAWSPDAPVDAVLLD 327

Query: 314 APCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
           APCS+TGTIRRHPDV   +  +D+ K A  Q +LL++    +KPGG++V++ CSL  ++ 
Sbjct: 328 APCSATGTIRRHPDVQRLKTEEDVAKLARVQARLLIRAADMLKPGGLLVYATCSLQPEEG 387

Query: 374 EEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGF 433
           E  V+ +L   P  V  VP++ A      +A A++  G +R TP +      +  GMDGF
Sbjct: 388 ERQVEALLARRPDLVR-VPVDPAELGG--LAGAVTAAGDVRTTPGL------IPGGMDGF 438

Query: 434 FAVALRR 440
           FA  LRR
Sbjct: 439 FAARLRR 445


>gi|288957078|ref|YP_003447419.1| Sun protein [Azospirillum sp. B510]
 gi|288909386|dbj|BAI70875.1| Sun protein [Azospirillum sp. B510]
          Length = 431

 Score =  285 bits (730), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 173/440 (39%), Positives = 249/440 (56%), Gaps = 17/440 (3%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           + + AR V+  LL  V+RK +      D          L  RD+  VR +V   LR L +
Sbjct: 4   TSLAARGVALDLLRDVLRKSVPFDDAFDAH---PELASLQPRDRGFVRLLVATVLRRLGQ 60

Query: 63  IDAVLDFVLIS-SLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           ID ++   L    LP  K ++  +LR+  AQ+++L+   +A VD AVE A   +    + 
Sbjct: 61  IDEMIQASLAKPGLP--KAAIHDMLRLGTAQLVFLNTPAHAAVDTAVELAA-ARNAAPYK 117

Query: 122 KLVNSILRRVSREKIELLQRI-AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            L+N++LRR+ RE  E+  R  AG    P+W      + YG  R   I +A +    +D+
Sbjct: 118 GLINAVLRRIGREGAEMAARQDAGRLNTPDWLWLSWRSAYGTARTRGIVEAHLHEAPLDI 177

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L A +LPTG +R +    S++ LPGF +G WWVQD +AS+P +LFG L
Sbjct: 178 TVKSDPAGWAERLGASLLPTGSLR-RPPGGSVIELPGFEDGEWWVQDLAASLPAKLFGDL 236

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL+V GA+VTA+D S RRLE++  NL RL L AE ++  DA  
Sbjct: 237 AGKRVFDLCAAPGGKTAQLVVQGAQVTAIDRSARRLERVTENLKRLRLEAE-VLAADAAT 295

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P+   DAVL+DAPCS+TG IRRHPD+L  +  DDI K A  Q +LL + +  V+PGG 
Sbjct: 296 WEPEAPADAVLLDAPCSATGAIRRHPDILRVKTPDDIAKLARAQSRLLARSVELVRPGGT 355

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +++  CS+  ++ E  V ++L      VE  P+ +       ++  ++  G +R  P ML
Sbjct: 356 LIYCTCSIQPEEGEAQVARLLEQDGR-VERWPVTADELGG--LSEPINEAGEVRSLPGML 412

Query: 421 EKIDGVSSGMDGFFAVALRR 440
             + G+    DGFF   LRR
Sbjct: 413 ADLGGI----DGFFVARLRR 428


>gi|298292785|ref|YP_003694724.1| sun protein [Starkeya novella DSM 506]
 gi|296929296|gb|ADH90105.1| sun protein [Starkeya novella DSM 506]
          Length = 446

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 171/402 (42%), Positives = 233/402 (57%), Gaps = 9/402 (2%)

Query: 39  RLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDV 98
           R L +RD+ L R I    LR    + A++  +L   LP K   ++ LL    AQIL++DV
Sbjct: 52  RELDERDRGLARMIAATALRKFGTLRALIGSLLERGLPEKAGRVETLLVTGAAQILFMDV 111

Query: 99  ADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLEN 158
            D+A VD +V  A     +  F  LVN++LRRV+RE   +L  +A     P+W  +    
Sbjct: 112 PDHAAVDTSVALAAESPASAGFKGLVNAVLRRVAREGKAMLPDVADQ---PQWMVDGWTA 168

Query: 159 FYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGF 218
            YG +  LAI+ A  S   +DLT K D   WA KL   +L TG IRL E   ++ +LPGF
Sbjct: 169 AYGGKDALAIAHALASEAPLDLTAKDDAAGWAEKLGGKLLSTGSIRLVEA-GNVTALPGF 227

Query: 219 AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEK 278
            EG WWVQDA+A++P +L       ++ DLCAAPGGKTAQL  +GA VTALD S +RL++
Sbjct: 228 EEGAWWVQDAAAALPARLLHAKAGETIADLCAAPGGKTAQLAATGAAVTALDRSGQRLKR 287

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           L+ NL RL L AE I+E DA  +     FD VL+DAPCS+TGTIRRHPDV WT+   DI 
Sbjct: 288 LKQNLARLGLDAE-IVEADAAAW-KGGPFDGVLIDAPCSATGTIRRHPDVAWTKAPADIA 345

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
                Q ++L      VKPGG++V+S CSL+ ++ E+ V+ +L + P   + V    A  
Sbjct: 346 SLGALQARILANAADLVKPGGVLVYSTCSLEPEEGEKQVEALLAARP---DFVRDPVAPG 402

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +    A  ++  G +R  P  L   D   +G+DGFFA  LRR
Sbjct: 403 ECGVAAEWINAAGELRTLPTHLPDADPRFAGIDGFFAARLRR 444


>gi|182679035|ref|YP_001833181.1| sun protein [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634918|gb|ACB95692.1| sun protein [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 463

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 168/439 (38%), Positives = 253/439 (57%), Gaps = 7/439 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+  R  ++ +L  ++ K  +L      E        L  RD+ L R+IV V LR L  
Sbjct: 29  AGLGVRRTAAAILRAIVTKGQALDDFFAPESNPEILAGLEPRDKALARSIVTVALRRLGT 88

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I A L  +L   LPR+   L+ +L V+ AQIL+LDV D+A VDLAV   + D ++  FA 
Sbjct: 89  IRAALTGLLAQGLPRQAPDLEWILLVAGAQILFLDVPDHAAVDLAVRATRLDPKSTPFAP 148

Query: 123 LVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LR ++R + ++L     +++  P W  +R    YG+E   AI+ A      +D+T
Sbjct: 149 LVNAVLRNLARGREKILAESDALAMDTPAWLAKRWRETYGEELARAIALAHREEPTLDVT 208

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           V  + + WA KL A +LPTG +RL E    I  LPGFAEGVW+VQDA+A++P +L     
Sbjct: 209 VLAEPDLWAEKLGARLLPTGSLRL-ETHAPIADLPGFAEGVWFVQDAAAALPARLMPAGP 267

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
            L + D CAAPGGK AQL  +GA VTA+D S  RL++L  N  RLHL AE ++  D   +
Sbjct: 268 GLRIADFCAAPGGKAAQLAATGAHVTAIDRSATRLKRLSANFARLHLEAE-VLAADVLTF 326

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FD +L+DAPCS+TGTIRRHPD+ W +   DI+  A  Q ++L +  + +K GG +
Sbjct: 327 -EAEPFDGILLDAPCSATGTIRRHPDIAWIKQPKDILALALAQARMLDKAATLLKAGGTL 385

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           ++  CSL+ ++ EE ++  L++ P   E      +  +  +++  ++  G +RI P   +
Sbjct: 386 IYCTCSLEPEEGEERIEAFLQNHP---EFRRRPISPGEVGNLSEIINQNGDLRILPAHFQ 442

Query: 422 KIDGVSSGMDGFFAVALRR 440
             +   SG+DGFF   L R
Sbjct: 443 GTEARFSGLDGFFVSRLVR 461


>gi|154243996|ref|YP_001414954.1| sun protein [Xanthobacter autotrophicus Py2]
 gi|154158081|gb|ABS65297.1| sun protein [Xanthobacter autotrophicus Py2]
          Length = 471

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 172/440 (39%), Positives = 259/440 (58%), Gaps = 17/440 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR+++   L  V+R   +L   LD +        L  RD+ L   I+  +LR +  +
Sbjct: 44  GLAARILAVDGLEQVLRHGAALEDALDADVA------LDPRDRALAYRILATSLRRIGTL 97

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A++  ++   LP+    L+ +L     QIL++DV ++A V L V+ A+ D+    FA L
Sbjct: 98  RALIAKLMERGLPKSAPRLESVLLAGATQILFMDVPNHAAVGLCVDVARADRNTAGFAGL 157

Query: 124 VNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LRR++RE   L+  I+   +  PEW  +R    YG E   AI+        +D+TV
Sbjct: 158 VNAVLRRLTREADALMVGISPDFADTPEWMGQRWIKAYGLETTRAIAAMHKVEPPLDITV 217

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L+  +LPTG +R+ +    + +LPGFAEG WWVQDA+A++P +L G +  
Sbjct: 218 KADPALWAERLSGEVLPTGSVRILQA-GPVRALPGFAEGDWWVQDAAAALPARLLGDVKG 276

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
           L V DLCAAPGGKTAQL  +GA VTA+D S  RL +L+ NL+RL L A+ ++  DA D+ 
Sbjct: 277 LKVADLCAAPGGKTAQLAAAGAIVTAVDRSSSRLTRLKENLERLKLSAQ-VVAGDAADFS 335

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
               FDAVL+DAPCS+TGT+RRHPD+   +   D+V  A  Q +L+      +KPGG +V
Sbjct: 336 -GGPFDAVLLDAPCSATGTLRRHPDIAVNKRPGDLVTLAGLQARLIAHAADLLKPGGTLV 394

Query: 363 FSNCSLDKQDSEEVVQKVL--RSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +S CSL+ ++ E+ V+++L  RS  I   +VP      + ID    ++P+G +R  P   
Sbjct: 395 YSTCSLEPEEGEQQVERLLAARSDIIRAPIVP---GEVEGID--PFITPQGDVRTLPSHW 449

Query: 421 EKIDGVSSGMDGFFAVALRR 440
            + +   SG+DGFFA  L+R
Sbjct: 450 MRGEAERSGLDGFFAARLKR 469


>gi|170747459|ref|YP_001753719.1| Fmu (Sun) domain-containing protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653981|gb|ACB23036.1| Fmu (Sun) domain protein [Methylobacterium radiotolerans JCM 2831]
          Length = 459

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 183/403 (45%), Positives = 232/403 (57%), Gaps = 9/403 (2%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           L+  D  L RAI   T R    I A L   L   LP  K  L  LL  + AQIL L V D
Sbjct: 61  LAPADAGLARAIAVATFRRYGLIRAALAARLERGLPAAKPQLTALLATATAQILDLAVPD 120

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISII--PEWFKERLEN 158
           +A VDLAV  AK D    H A LVN++LRRV+RE+  +L   A    +  P+W   R   
Sbjct: 121 HAAVDLAVRLAKADTRTAHLAGLVNAVLRRVARERDAILAADADALAVNTPDWLARRWVA 180

Query: 159 FYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGF 218
            YG ER  AI+ A ++   IDLT + D   WA +L A  LPTG +RL E   +I  LPGF
Sbjct: 181 AYGPERAAAIARAHLAGAAIDLTPRGDAGDWAARLGAATLPTGSLRLPENGPAIPDLPGF 240

Query: 219 AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEK 278
            EG WWVQDA+A++P +L G      VLDLCAAPGGKT QL  +GA+VTA+D S  RLE+
Sbjct: 241 QEGAWWVQDAAAALPARLLGPREGTRVLDLCAAPGGKTLQLAATGARVTAVDRSAPRLER 300

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           LR N+ RL  +A D++  DA    P+   DAVL+DAPCS+TGTIRRHPDV WT+   DI 
Sbjct: 301 LRENVARLG-FAVDVVVADALALEPQD-HDAVLLDAPCSATGTIRRHPDVAWTKAEADIG 358

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q +LL    + V+PGG++V+  CSL+ ++ E  V   L   P     VP+     
Sbjct: 359 RLAALQARLLDHAAALVRPGGLLVYCTCSLEPEEGEAQVAAFLAREPG-YARVPVRP--- 414

Query: 399 KSIDMAMALSPE-GWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +  A AL  + G +R  P  L +I G   G+DGFFA  LRR
Sbjct: 415 DEVGGAAALIDDCGDLRTLPCHLPEIPGARGGLDGFFASRLRR 457


>gi|158426322|ref|YP_001527614.1| rRNA SAM-dependent methyltransferase [Azorhizobium caulinodans ORS
           571]
 gi|158333211|dbj|BAF90696.1| rRNA SAM-dependent methyltransferase [Azorhizobium caulinodans ORS
           571]
          Length = 456

 Score =  277 bits (708), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 177/439 (40%), Positives = 260/439 (59%), Gaps = 13/439 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ ARL+++  L  ++R   SL      + G      L  RD+ L   IV   LR L  
Sbjct: 29  AGLPARLLAADALDRILRGNASLEDAFIHDAG------LEPRDRALAFRIVATALRRLGT 82

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           + AVL  ++    P+    ++ +L V  AQIL++DV D+A V L+V+ A+ D     FA 
Sbjct: 83  LRAVLTALMERGAPKSAPKVETVLLVGAAQILFMDVPDHAAVGLSVDIARGDNSTAGFAG 142

Query: 123 LVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           L+N++LRR++RE+ E L   A + +  PEW ++R    YG ER  AI+D       +D+T
Sbjct: 143 LINAVLRRLAREREERLAAFATLGLDTPEWLRQRWTKAYGPERAKAITDILSHEPALDIT 202

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KL   +LPTG +R+ +   ++ +LPG+ +G WWVQDA+A++P +L G + 
Sbjct: 203 VKSDAAGWAEKLGGEVLPTGTVRVLQA-GAVRALPGYEDGEWWVQDAAAALPARLLGDVA 261

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             SV DLCAAPGGKTAQL  +GAKVTA+D S  RL +L  NL RL L A D+ E DA   
Sbjct: 262 GKSVADLCAAPGGKTAQLAAAGAKVTAVDRSGPRLARLSENLARLKLTA-DVREADAASL 320

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
                FDA+L+DAPC++TGT+RRHPD+ W +   D+   A  Q  L+   +  +K GG++
Sbjct: 321 KAGP-FDAILLDAPCTATGTLRRHPDIAWAKRPSDVATLAAVQAGLIDHALDLLKSGGLL 379

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V++ CSL+ ++ E  V +VL ++   VE VPL     +   +A  ++PEG +R  P  L 
Sbjct: 380 VYATCSLEPEEGEAQVARVL-AARNDVERVPLKPEEMEG--LAPYITPEGDLRTLPCDLV 436

Query: 422 KIDGVSSGMDGFFAVALRR 440
           + +   SG+DGFFA  LR+
Sbjct: 437 RGEPERSGLDGFFAARLRK 455


>gi|144899806|emb|CAM76670.1| Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p:Antitermination protein
           NusB [Magnetospirillum gryphiswaldense MSR-1]
          Length = 437

 Score =  274 bits (700), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 251/439 (57%), Gaps = 18/439 (4%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRL--LSQRDQILVRAIVNVTLRFLPRI 63
           + R +   LL CV+ ++     LLD E  DS  RL  L++RD+   R +V  TLR L +I
Sbjct: 13  DPRSIVLDLLECVLAQKR----LLD-ETLDSEPRLTKLAERDRAFTRMLVATTLRRLGQI 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           DAV+   +   LP K   ++ +LR+  AQ+L+LD   +A +   V+ AK +     FAKL
Sbjct: 68  DAVIARCIDRPLPAKAGRVRNMLRLGAAQLLFLDTPPHAAISTTVDLAK-NSPLAGFAKL 126

Query: 124 VNSILRRVSRE-KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           +N++LRR+ RE +  + ++ AG    P W  +   + YG +    I+ A  +   +D++V
Sbjct: 127 INAVLRRLDREGRAWVAEQDAGPLNTPAWMWQSWLDTYGPDTARLIAQAHQTEAPVDISV 186

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
             D   WA +L A ++PTG +R ++    +  LPGFAEG WWVQD +AS+P +L G +  
Sbjct: 187 AGDPALWAERLEADIMPTGTLR-RQAGGDVTQLPGFAEGAWWVQDLAASLPAKLMGAVKG 245

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCAAPGGK  QL V+ A+VTA+D S +R+ + R NL+RL L A  I+E D   + 
Sbjct: 246 KRVADLCAAPGGKALQLAVAEAEVTAVDRSAKRMVRFRRNLERLKLAAT-IVETDVAGWQ 304

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P   FDAVL+DAPC++TGT+RRHPD +  +   D+   A  Q  LL    + VKPGGI+V
Sbjct: 305 PPAPFDAVLLDAPCTATGTLRRHPDGVHLKGPGDVAYLADQQHALLKAAAAMVKPGGILV 364

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           +  CSL+ Q+ E  + ++L S   P+   P+  +    +D    L+ +G IR  P  L +
Sbjct: 365 YCVCSLEPQEGEAQIIRLLESG-APLVRDPIEPSEIPGLD--FVLTKQGEIRTLPHYLAE 421

Query: 423 IDGVSSGMDGFFAVALRRL 441
                 GMD FF   L+R+
Sbjct: 422 ----KGGMDAFFIARLKRM 436


>gi|254559138|ref|YP_003066233.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Methylobacterium
           extorquens DM4]
 gi|254266416|emb|CAX22180.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Methylobacterium
           extorquens DM4]
          Length = 454

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 164/390 (42%), Positives = 228/390 (58%), Gaps = 12/390 (3%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           + R L  I A L   L   LP  +  L  LL    AQIL L VAD+A VDL+V  AK D 
Sbjct: 70  SFRRLGFIKAALAARLRDGLPEDRPHLLALLVTGAAQILDLAVADHAAVDLSVRLAKADP 129

Query: 116 ENRHFAKLVNSILRRVSREK--IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
           + +H   LVN++LRR++RE+  I   +        P+W   R +  YG+E    I+ A +
Sbjct: 130 QLQHLVPLVNAVLRRIARERDAIRAQESDPLAHNTPDWLARRWQAAYGEEAARRIAVAHL 189

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLTV  D E WA +L  + L  G +RL E+ +++  LPG+AEG WWVQDA+A++P
Sbjct: 190 EGAAVDLTVPHDPEIWAERLGGIRLDLGSVRLAEVRQAVAELPGYAEGAWWVQDAAAALP 249

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           V+L   ++   V+DLCAAPGGKTAQ+  +GA VTA+D S  RLE+L  NL+RL L AE +
Sbjct: 250 VRLLAPVSGERVVDLCAAPGGKTAQMAAAGAAVTAVDRSAVRLERLGRNLERLGLSAE-V 308

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           +  DA        FDAVL+DAPCS+TGTIRRHPDV+WT+   D+V+ A  QR+LL +   
Sbjct: 309 VTADALALPEDAPFDAVLLDAPCSATGTIRRHPDVVWTKSEADVVRLAGLQRRLLDKAAR 368

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLN-SAYWKSIDMAMALSPE 410
             +PGG +V+  CSL+ ++    V   L  +P    + + P   S + + ID +      
Sbjct: 369 LTRPGGRLVYCTCSLEPEEGSAQVAAFLARNPDFERIAITPDRLSGHAELIDAS------ 422

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           G +R  P  +    G + G+DGFFA  LRR
Sbjct: 423 GDLRTLPSHVVGGIGRAGGLDGFFASLLRR 452


>gi|218528533|ref|YP_002419349.1| Fmu (Sun) domain protein [Methylobacterium chloromethanicum CM4]
 gi|218520836|gb|ACK81421.1| Fmu (Sun) domain protein [Methylobacterium chloromethanicum CM4]
          Length = 454

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 164/390 (42%), Positives = 228/390 (58%), Gaps = 12/390 (3%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           + R L  I A L   L   LP  +  L  LL    AQIL L VAD+A VDL+V  AK D 
Sbjct: 70  SFRRLGFIKAALAARLRDGLPEDRPHLLALLVTGAAQILDLAVADHAAVDLSVRLAKADP 129

Query: 116 ENRHFAKLVNSILRRVSREK--IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
           + +H   LVN++LRR++RE+  I   +        P+W   R +  YG+E    I+ A +
Sbjct: 130 QLQHLVPLVNAVLRRIARERDAIRAQESDPLAHNTPDWLARRWQAAYGEETARRIAIAHL 189

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLTV  D E WA +L  + L  G +RL E+ +++  LPG+AEG WWVQDA+A++P
Sbjct: 190 EGAAVDLTVPHDPEIWAERLGGIRLDLGSVRLAEVRQAVAELPGYAEGAWWVQDAAAALP 249

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           V+L   ++   V+DLCAAPGGKTAQ+  +GA VTA+D S  RLE+L  NL+RL L AE +
Sbjct: 250 VRLLAPVSGERVVDLCAAPGGKTAQMAAAGAAVTAVDRSAVRLERLGRNLERLGLSAE-V 308

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           +  DA        FDAVL+DAPCS+TGTIRRHPDV+WT+   D+V+ A  QR+LL +   
Sbjct: 309 VTADALALPEDAPFDAVLLDAPCSATGTIRRHPDVVWTKSEADVVRLAGLQRRLLDKAAR 368

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLN-SAYWKSIDMAMALSPE 410
             +PGG +V+  CSL+ ++    V   L  +P    + + P   S + + ID +      
Sbjct: 369 LTRPGGRLVYCTCSLEPEEGSAQVAAFLARNPDFERIAITPDRLSGHAELIDAS------ 422

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           G +R  P  +    G + G+DGFFA  LRR
Sbjct: 423 GDLRTLPSHVVGGIGRAGGLDGFFASLLRR 452


>gi|163797843|ref|ZP_02191788.1| tRNA and rRNA cytosine-C5-methylase [alpha proteobacterium BAL199]
 gi|159176887|gb|EDP61454.1| tRNA and rRNA cytosine-C5-methylase [alpha proteobacterium BAL199]
          Length = 436

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 165/434 (38%), Positives = 244/434 (56%), Gaps = 13/434 (2%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           +R V+  L   V+ KR  L   L    G      L +RD+   R +V  TLR L  +D +
Sbjct: 15  SRSVAFDLFRAVLAKRTPLDEALAAHDG---LAKLPERDRGFARLLVATTLRRLGHVDRL 71

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNS 126
           +D  +   LP K   ++ +LR++ +++L L VA +A VD AV    R + +  F KL N+
Sbjct: 72  VDACIDKPLPTKAAVVRDILRLAASELLILGVAPHAAVDSAVNTV-RSRGHEPFVKLTNA 130

Query: 127 ILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDI 186
           +LRR+ RE    + +++ +  +P+W  E     YG+    AI+ A      +D++VK D 
Sbjct: 131 VLRRLDREGRGEILKLSALEALPDWLAEGWRAAYGEATAEAIAAAGFVEPPLDISVKDDP 190

Query: 187 ETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVL 246
           E WA KL A +LP G +R +     I  LPGFAEG WWVQD +AS+P++L G + +  V+
Sbjct: 191 EGWAKKLGATLLPNGTLR-RGFDGRIEGLPGFAEGAWWVQDMAASLPIRLLGPVADRRVV 249

Query: 247 DLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKL 306
           DLCAAPGGKTAQL  +GA+V A+D SK RL++L  NL RL L A   +  DA +   +  
Sbjct: 250 DLCAAPGGKTAQLAAAGAQVLAIDRSKPRLQRLERNLARLGLAASTRV-ADATEMKLENP 308

Query: 307 FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC 366
            DA+L+DAPCS+TGTIRRHPD+ W +  +D    A  Q +L+   +  + PGG +VF  C
Sbjct: 309 VDAILLDAPCSATGTIRRHPDIPWLKHANDADSLAGLQDRLIANAVRMLAPGGTLVFCTC 368

Query: 367 SLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGV 426
           SL+  +  E V   L ++P  ++ VP+          A  ++ +G +R  PD L  +   
Sbjct: 369 SLEPIEGPERVAAALAANP-ELKRVPIRPDEIGG--FAELITVDGDLRSRPDQLANL--- 422

Query: 427 SSGMDGFFAVALRR 440
             G+DGF+A  L R
Sbjct: 423 -GGIDGFYACRLVR 435


>gi|23016809|ref|ZP_00056561.1| COG0144: tRNA and rRNA cytosine-C5-methylases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 432

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 166/437 (37%), Positives = 257/437 (58%), Gaps = 15/437 (3%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++  LLS V+ K   L  +LD    DS    L +RD+  VR ++  TLR L +IDA
Sbjct: 9   NPRAIAVDLLSMVLDKARLLDDVLD----DSRLSKLEERDRGFVRMLLGTTLRRLGQIDA 64

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +++  +   +       +  LR+ + Q+L+LDVA +A +   V+  K  K    FAKL+N
Sbjct: 65  LIEHCVEKPMRAGAAGAEHALRLGICQLLFLDVAPHAAISTTVDLVKGSKLA-GFAKLLN 123

Query: 126 SILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF 184
           ++LRR+ RE  EL+ ++ AG+   PEW        YG++   AI+ A +    +D+TV  
Sbjct: 124 AVLRRLDREGRELVTEQDAGLLNTPEWLWRSWVRAYGEDGARAIAQAHLIEAPVDITVAA 183

Query: 185 DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLS 244
           D   WA +L A +L TG +R +    SI +LPGF E  WW+QDA+A++P +L G +   +
Sbjct: 184 DPALWAERLEASILATGSLR-RAGGGSIAALPGFNEAAWWIQDAAAALPARLLGDVRGKA 242

Query: 245 VLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK 304
           V DLCAAPGGK  QL V+GA++TALD S +RL +   NL RL L A+ ++E DA  + P 
Sbjct: 243 VADLCAAPGGKALQLAVAGAELTALDRSAKRLVRFTDNLKRLGLKAK-VVEADAGAWSPP 301

Query: 305 KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFS 364
             FDA+L+DAPCS+TGT+RRHPDV   ++  +++K A  Q +LL   +  +KPGG +V+ 
Sbjct: 302 APFDAILLDAPCSATGTLRRHPDVARHKNPAEVMKLAGVQARLLRAALPMLKPGGTLVYC 361

Query: 365 NCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKID 424
            CSL+ ++  E +  +L +   P++ VP+ +   +   +A  ++ +G +R  P  L ++ 
Sbjct: 362 TCSLEPEEGPEQIAALL-AEGAPLKRVPIRAE--EVGGLAQLITADGDLRTLPCHLAEL- 417

Query: 425 GVSSGMDGFFAVALRRL 441
               GMD FFA  L ++
Sbjct: 418 ---GGMDAFFAARLEKM 431


>gi|312113148|ref|YP_004010744.1| sun protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311218277|gb|ADP69645.1| sun protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 425

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 165/437 (37%), Positives = 248/437 (56%), Gaps = 15/437 (3%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR ++  LL  V+    S            AF  +  RD+   RAI  + LR L +++ +
Sbjct: 2   ARRLAVFLLKSVLHDHQSFDEAFAGSSARDAFAAMESRDRAFARAIATIALRRLGQVEDM 61

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNS 126
           L   L   L    +  + +L     Q+ ++DVA +A + LAVEQAK  + +RH   L+N+
Sbjct: 62  LARFLEKPLAADAFEARAILIAGATQLAFMDVAPHAAIGLAVEQAKASRFSRHLGGLINA 121

Query: 127 ILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFD 185
           +LRRV+  K  +L ++ A +   P W  ER    YG+     I+ A +    +DL+VK D
Sbjct: 122 VLRRVNENKAAILSEQDAAVLNTPAWLWERWVAAYGEATAREITGAHLEEPPLDLSVKAD 181

Query: 186 IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSV 245
             TWA KL   +LP G +RL      +  + G+AEG WWVQDA+A+IP  L G +    V
Sbjct: 182 AATWAAKLEGEVLPWGSVRLSH-KGRVEEIEGYAEGAWWVQDAAAAIPALLLGDIAGKRV 240

Query: 246 LDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKK 305
            DLCAAPGGKTAQL  +GA+VT++D+S  RL +L  N  RL L  E I++ +  D+ PK 
Sbjct: 241 ADLCAAPGGKTAQLAAAGAQVTSVDISASRLRRLGENAARLGLSVE-IVKANVGDWQPKD 299

Query: 306 LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN 365
            F+A+L+DAPCS+TGTIRR+PD+ + +  +DI   A  Q++LL   ++ + PGG +VF+ 
Sbjct: 300 CFEAILLDAPCSATGTIRRNPDIAYLKTAEDIAALARVQKRLLAHALTLLAPGGTLVFAT 359

Query: 366 CSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD-MLEKID 424
           CSL+ ++ E  +  +L +    V L+P+++A       A+ L PE    +TP+  L  + 
Sbjct: 360 CSLEPEEGEAQIAALL-ADRADVRLLPVDAA-------ALNLPPE---VVTPNGCLRTLP 408

Query: 425 GVSSGMDGFFAVALRRL 441
             + GMDGFFA  L R+
Sbjct: 409 FHAGGMDGFFAARLTRI 425


>gi|323137517|ref|ZP_08072594.1| sun protein [Methylocystis sp. ATCC 49242]
 gi|322397143|gb|EFX99667.1| sun protein [Methylocystis sp. ATCC 49242]
          Length = 471

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 169/401 (42%), Positives = 232/401 (57%), Gaps = 8/401 (1%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           L  RD  L R+I  V+LR L  I  VL  +L   LPR+   L+  L  + AQ+L+LD AD
Sbjct: 76  LDPRDVALTRSIATVSLRRLGVIRHVLSELLEKGLPRQAGRLEYTLIAAAAQLLFLDAAD 135

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIA-GISIIPEWFKERLENF 159
           +A VDLAV   + + +   FA LVN +LR + R + E L+  A G    P W  +R    
Sbjct: 136 HAAVDLAVRATRLEPKTGAFAGLVNGVLRNLLRRREEFLELAASGEYDTPPWLAQRWRKH 195

Query: 160 YGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFA 219
           YG E   AIS   +    +D++VK + E WA +L+ ++LPTG +RL+    +I  LPG+A
Sbjct: 196 YGDEAAHAISAMHMLEPPLDVSVKSNPEEWARQLDGLVLPTGSVRLRTR-AAIPELPGYA 254

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKL 279
           +G WWVQDA+A++P +L G   +  VLD+CAAPGGKTAQL+ + A V ALD S  RL+ L
Sbjct: 255 DGEWWVQDAAAALPARLLGAKPDERVLDMCAAPGGKTAQLVHARAHVVALDRSAERLKLL 314

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
             NL RL L A DI   DA  Y  +  FDA+LVDAPCS+TGTIRRHPDV WT+   DI  
Sbjct: 315 AANLARLDLRA-DIAVGDATGYQAQP-FDAILVDAPCSATGTIRRHPDVPWTKKPGDIDT 372

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  Q K+L +     K GG +V+  CSL+ ++ E+ +   LR +P      P+ +A   
Sbjct: 373 LAALQAKMLARAALLTKAGGRIVYCTCSLEPEEGEQQIAAFLRRNPD-FRREPITAAEGV 431

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +    ++ +G +R  P      D   +G+DGFFA  L R
Sbjct: 432 PAEF---INRDGDLRTLPCFWPNEDPRLAGIDGFFAARLTR 469


>gi|163849994|ref|YP_001638037.1| Fmu (Sun) domain-containing protein [Methylobacterium extorquens
           PA1]
 gi|163661599|gb|ABY28966.1| Fmu (Sun) domain protein [Methylobacterium extorquens PA1]
          Length = 425

 Score =  265 bits (678), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 161/390 (41%), Positives = 228/390 (58%), Gaps = 12/390 (3%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           + R L  I A L   L   LP  +  L  LL    AQIL L VAD+A VDL+V  AK D 
Sbjct: 41  SFRRLGFIKAALAARLRDGLPEDRPHLLALLVTGAAQILDLAVADHAAVDLSVRLAKADP 100

Query: 116 ENRHFAKLVNSILRRVSREK--IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
           + +H   LVN++LRR++RE+  I   +        P+W   R +  YG+E    I+ A +
Sbjct: 101 QLQHLVPLVNAVLRRIARERDAIRAQESDPLAHNTPDWLARRWQAAYGEEAARRIAVAHL 160

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLTV  D + WA +L  + L  G +RL E+ +++  LPG+AEG WWVQDA+A++P
Sbjct: 161 EGAAVDLTVPHDPDIWAERLGGIRLDLGSVRLAEVRQAVAELPGYAEGAWWVQDAAAALP 220

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           V+L   ++   V+DLCAAPGGKTAQ+  +GA VTA+D S  RLE+L  NL+RL L AE +
Sbjct: 221 VRLLAPVSGERVVDLCAAPGGKTAQIAAAGAAVTAVDRSAVRLERLGRNLERLGLSAE-V 279

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           +  DA        FDAVL+DAPCS+TGTIRRHPDV+WT+   D+++ A  QR+LL +   
Sbjct: 280 VTADALALPEDAPFDAVLLDAPCSATGTIRRHPDVVWTKSEADVIRLAGLQRRLLDKAAR 339

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLN-SAYWKSIDMAMALSPE 410
             +PGG +V+  CSL+ ++    V   L  +P    + + P   S + + ID +      
Sbjct: 340 LTRPGGRLVYCTCSLEPEEGSAQVAAFLARNPDFERIAITPDRLSGHAELIDAS------ 393

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           G +R  P  +    G + G+DGF+A  LRR
Sbjct: 394 GDLRTLPSHVVGGIGRAGGLDGFYASLLRR 423


>gi|240137127|ref|YP_002961596.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Methylobacterium
           extorquens AM1]
 gi|240007093|gb|ACS38319.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Methylobacterium
           extorquens AM1]
          Length = 454

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 160/390 (41%), Positives = 226/390 (57%), Gaps = 12/390 (3%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           + R L  I A L   L   LP  +  L  LL    AQIL L VAD+A VDL+V  AK D 
Sbjct: 70  SFRRLGFIKAALAARLRDGLPEDRPHLLALLVTGAAQILDLAVADHAAVDLSVRLAKADP 129

Query: 116 ENRHFAKLVNSILRRVSREK--IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
           + +H   LVN++LRR++RE+  I   +        P+W   R +  YG++    I+ A +
Sbjct: 130 QLQHLVPLVNAVLRRIARERDAIRAQESDPLAHNTPDWLARRWQAAYGEDAARRIAVAHL 189

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLT+  D + WA +L  + L  G +RL E+ +++  LPG+AEG WWVQDA+A +P
Sbjct: 190 EGAAVDLTIPHDPDIWAERLGGIRLDLGSVRLAEVRQAVAELPGYAEGAWWVQDAAAGLP 249

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           V+L   +    V+DLCAAPGGKTAQ+  +GA VTA+D S  RLE+L  NL+RL L AE +
Sbjct: 250 VRLLAPVPGERVVDLCAAPGGKTAQMAAAGAAVTAVDRSAARLERLGRNLERLGLSAE-V 308

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           +  DA        FDAVL+DAPCS+TGTIRRHPDV+WT+   D+++ A  QR+LL +   
Sbjct: 309 VTADALALPEDAPFDAVLLDAPCSATGTIRRHPDVVWTKSEADVIRLAGLQRRLLDKAAR 368

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLN-SAYWKSIDMAMALSPE 410
             +PGG +V+  CSL+ ++    V   L  +P    + + P   S + + ID +      
Sbjct: 369 LTRPGGRLVYCTCSLEPEEGSAQVAAFLARNPDFERIAITPDRLSGHAELIDAS------ 422

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           G +R  P  +    G + G+DGFFA  LRR
Sbjct: 423 GDLRTLPSHVVGGIGRAGGLDGFFASLLRR 452


>gi|83309246|ref|YP_419510.1| tRNA and rRNA cytosine-C5-methylase [Magnetospirillum magneticum
           AMB-1]
 gi|82944087|dbj|BAE48951.1| tRNA and rRNA cytosine-C5-methylase [Magnetospirillum magneticum
           AMB-1]
          Length = 431

 Score =  262 bits (670), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 168/440 (38%), Positives = 251/440 (57%), Gaps = 15/440 (3%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           S  + R ++  LLS V+ K   L  +LD    DS    L  RD+  VR ++  TLR L +
Sbjct: 5   SSTSPRAIAVDLLSMVLDKGRLLDDVLD----DSRLSRLEDRDRGFVRMLLGTTLRRLGQ 60

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ID +++  L   +       +  LR+ + Q+L+LDVA +A +   V+  K  K    FAK
Sbjct: 61  IDTLIEHCLDKPMRAGAAGAEHALRLGICQLLFLDVAPHAAISTTVDLVKGSKLA-GFAK 119

Query: 123 LVNSILRRVSREKIELLQ-RIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           L+N++LRR+ RE  +L   + AG+   PEW        YG++   AI+ A +    +D+T
Sbjct: 120 LLNAVLRRLDREGRDLAAAQDAGLLNTPEWLWRSWVKAYGEDGAHAIAAAHLIEAPVDIT 179

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           V  D   WA +L A +LPTG +R +    S+ +LPGF +G WW+QDA+A++P +L G + 
Sbjct: 180 VAADSALWAERLEASVLPTGSLR-RAAGGSVAALPGFDDGAWWIQDAAAALPARLLGDVR 238

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             +V DLCAAPGGK  QL V+GA +TALD S +RL +   NL RL L A+ ++E DA  +
Sbjct: 239 GKAVADLCAAPGGKALQLAVAGADLTALDRSAKRLVRFTANLKRLGLKAK-VVEADAGAW 297

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P   FDA+L+DAPCS+TGT+RRHPDV   ++  +++K A  Q +LL   I  +KPGG +
Sbjct: 298 TPPAPFDAILLDAPCSATGTLRRHPDVARHKNPAEVMKLAGVQARLLQAAIPMLKPGGTL 357

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++  E +  +L +   P+  VP+         +A  ++PEG +R  P  L 
Sbjct: 358 VYCTCSLEAEEGPEQIAALL-AGGAPLRRVPIRPEEVGG--LAELITPEGDLRTLPCHLA 414

Query: 422 KIDGVSSGMDGFFAVALRRL 441
                  GMD FFA  L ++
Sbjct: 415 S----QGGMDAFFAARLEKV 430


>gi|217977604|ref|YP_002361751.1| sun protein [Methylocella silvestris BL2]
 gi|217502980|gb|ACK50389.1| sun protein [Methylocella silvestris BL2]
          Length = 448

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 170/443 (38%), Positives = 247/443 (55%), Gaps = 17/443 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ ARL ++ +L+ ++ K  SL          S  + L  RD  L R+IV   LR L  I
Sbjct: 15  GLPARLAAAAILNDIVGKAHSLEDCFSPGAIPSRLQGLDPRDVALTRSIVTAALRRLGTI 74

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L   L   LPR    L+  L  + AQIL+LDV D+A VDLAV   + + ++  FA +
Sbjct: 75  RKTLGEFLDKGLPRPVAHLEWTLIAAAAQILFLDVPDHAAVDLAVRATRLENKSAPFAGV 134

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           +N++LR ++R + ++L+         P W   R    YG++    I+ A      +DLTV
Sbjct: 135 INAVLRNIARGRDKILEDSDPFDHDTPPWLAARWRKTYGEDLARKIARANRDEPTLDLTV 194

Query: 183 KFDIETWAHKLNAVMLPTGGIRL-KELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           K D   WA +L  ++LPTG +RL    P  I  LPGFAEG WWVQDA+A++P +L     
Sbjct: 195 KSDPALWAERLGGLVLPTGSVRLLTHAP--IAELPGFAEGEWWVQDAAAALPARLIAPAP 252

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE----DIIEMD 297
              V D CAAPGGK AQL  +GAKVTA+D S  RL++L  N  RL L+A+    DI+ + 
Sbjct: 253 GARVADFCAAPGGKAAQLAAAGAKVTAIDRSAERLKRLAANFSRLDLHADVVVADIVGLK 312

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A      + FDA+L+DAPC +TGTIRRHPD+ W +   DI   A  Q ++L + +  V+P
Sbjct: 313 A------QPFDAILIDAPCLATGTIRRHPDIAWIKKPTDIASLAQVQARMLDKAVELVRP 366

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG++V+  CSL+ ++ E  +  +LR +P   +++    +  +  D+   ++ EG +R  P
Sbjct: 367 GGVIVYCTCSLEPEEGELQIAALLRRNP---DMLRSKISPHEVGDVEGVINNEGELRTLP 423

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
             L   D   SG+DGFFA  L R
Sbjct: 424 CHLPADDPRLSGLDGFFAARLIR 446


>gi|170741154|ref|YP_001769809.1| Fmu (Sun) domain-containing protein [Methylobacterium sp. 4-46]
 gi|168195428|gb|ACA17375.1| Fmu (Sun) domain protein [Methylobacterium sp. 4-46]
          Length = 447

 Score =  259 bits (663), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 176/444 (39%), Positives = 238/444 (53%), Gaps = 18/444 (4%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR ++   ++ ++  R S T L D+    ++   L   D  L RAI   T R L  
Sbjct: 10  AGLAARRLAYASVADLLGAR-SGTALDDVLDPAASRAALPGPDLALARAIATATFRHLGL 68

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L   LP  +  L  LL    AQIL L+V D+A VDLAV  AK D   RH + 
Sbjct: 69  IRHALAARLAEGLPEGQPKLLALLATGAAQILVLNVQDHAAVDLAVRLAKADSGLRHLSG 128

Query: 123 LVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFYGKERVLAISDACISPLYID 179
           LVN++LRR+SREK  +L+      +    P W   R    YG E   +I+ A +    +D
Sbjct: 129 LVNAVLRRISREKAAILREGEADPLGIETPGWLARRWSAAYGAETARSIAAAHLRGAPLD 188

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           L+V+ D   WA +L A +LPTG +RL E    +  LPGFAEG WWVQDA+A++P +L   
Sbjct: 189 LSVRGDPAPWAERLGARLLPTGSLRLDESRTPVPLLPGFAEGEWWVQDAAAALPARLLAV 248

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
                V DLCAAPGGKTAQL  +GA V A+D S+ RL +LR NL RL L A         
Sbjct: 249 RPGERVADLCAAPGGKTAQLAAAGASVLAVDRSEARLRRLRENLARLGLTA--EARAADA 306

Query: 300 DYCPK-KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
              P+ + FDA+L+DAPCS+TGTIRRHPDV WT+   D+ +    Q +LL +    ++PG
Sbjct: 307 LALPEDERFDAILLDAPCSATGTIRRHPDVAWTKREADLGRLTALQARLLDKAARLLRPG 366

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSP----IPVELVPLNSAYWKSIDMAMALSPEGWIR 414
           G +V+  CSL+ ++ E   +  L   P     PV+   +          A  L P G +R
Sbjct: 367 GRLVYCTCSLEPEEGEGQAEAFLARHPDFARRPVDPAEIGG-------EAALLGPAGDLR 419

Query: 415 ITPDMLEKIDGVSSGMDGFFAVAL 438
             P      +G   G+DGFFAV L
Sbjct: 420 TLPCAWLPAEGGRGGLDGFFAVRL 443


>gi|296447350|ref|ZP_06889277.1| Fmu (Sun) domain protein [Methylosinus trichosporium OB3b]
 gi|296255129|gb|EFH02229.1| Fmu (Sun) domain protein [Methylosinus trichosporium OB3b]
          Length = 467

 Score =  259 bits (661), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 164/437 (37%), Positives = 243/437 (55%), Gaps = 6/437 (1%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR+ ++H+++ V++    L      +        L  RD  L R+I +  +R L  I
Sbjct: 35  GLAARIAAAHVIADVVQGGRRLDERFSPQAVPQRVAGLDARDAALARSIASAAIRRLGTI 94

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
              L  ++   LP++   L+  + V+ AQI +LD  D+A VDLAV  A+ + +   FA L
Sbjct: 95  RHALAALMDKGLPKQGARLEWPMIVAAAQIFFLDTPDHAAVDLAVRAARLEPKTAPFAGL 154

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN +LR + R + E L         P W  +R    YG+ +  A + A +    +D+TVK
Sbjct: 155 VNGVLRNLVRRREEFLDCDPLELDTPSWLAQRWTKTYGEAQARAFARAHMLEPPLDVTVK 214

Query: 184 FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
            + E WA +L+ V++PTG +RL+ L E I  L G+ EG WWVQDA+A++P +L     + 
Sbjct: 215 SEPERWAERLDGVVMPTGSVRLRTL-EPIAGLEGYEEGEWWVQDAAAALPARLLRAEPDE 273

Query: 244 SVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP 303
            +LD+CAAPGGKTAQL  + A VTALD S  RL+ L  NL R  L+A DI   DA  +  
Sbjct: 274 RILDMCAAPGGKTAQLAQARALVTALDRSAERLKLLAANLQRARLHA-DIAVGDATSFQA 332

Query: 304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVF 363
           +  FDA+LVDAPCS+TGTIRRHPDV W +   D+   A  Q K+L +  + ++PGG +V+
Sbjct: 333 RP-FDAILVDAPCSATGTIRRHPDVAWIKKPGDLDALASLQSKMLDRAAALLRPGGRMVY 391

Query: 364 SNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKI 423
             CSL+ ++ E  V   LR  P  +  +P++ A  + I     ++ EG +R  P      
Sbjct: 392 CTCSLEPEEGEAQVAAFLRRQPD-MRRIPID-AEGEGIPHEF-VTAEGDLRSLPSHWPAE 448

Query: 424 DGVSSGMDGFFAVALRR 440
           +    G+DGFFA    R
Sbjct: 449 EPRLRGVDGFFAARFSR 465


>gi|154251779|ref|YP_001412603.1| sun protein [Parvibaculum lavamentivorans DS-1]
 gi|154155729|gb|ABS62946.1| sun protein [Parvibaculum lavamentivorans DS-1]
          Length = 440

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 168/448 (37%), Positives = 248/448 (55%), Gaps = 24/448 (5%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           ++G+ AR  ++ +L+ V+++R +       E      R    RD+   RAI    LR L 
Sbjct: 6   ETGLAARQGAASILTAVLKERRAFDDAFIAEAASGHLRNAEPRDRAFARAITATALRRLG 65

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            ID +L  ++   LP++  + + +LR  +A+IL+L VA +A V + VE A RD+  RHF 
Sbjct: 66  TIDHILSLLIDKELPKRAGATENILRAGLAEILFLRVAAHAAVGMNVEAASRDENARHFK 125

Query: 122 KLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR +RE   +L  +    +  P+W  +     YG+E   AI     +   +D+
Sbjct: 126 ALVNAVLRRATREGDAILDNLDTERLDTPDWLWQSWSAAYGEETARAIVRMHYADPPLDI 185

Query: 181 TVKFDIE--TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFG 238
           +VK   E  T A  L A +LP+G +RL++    I  LPGF +G WWVQDA+A++P +L G
Sbjct: 186 SVKRAEERMTIAEALGATVLPSGTLRLEDAGR-IEDLPGFDDGAWWVQDAAAALPAKLLG 244

Query: 239 TLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA 298
            +    VLDLCAAPGGKTA+L  +GA VTALD S+ RL++L  NL RL L A+ ++  DA
Sbjct: 245 DVTGREVLDLCAAPGGKTAELAAAGAHVTALDRSRPRLDRLEQNLSRLGLEAKTVV-ADA 303

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
             Y P + +D +L+DAPCSSTGT RRHPDV   +   D  K A  Q +LL    + + PG
Sbjct: 304 TAYAPGRTWDLILLDAPCSSTGTARRHPDVPHLKSPADRDKLAALQARLLAHAATLLAPG 363

Query: 359 GIVVFSNCSLDKQDSEEVVQKVL------RSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
           G +V+  CSL+ ++    V+  L      R  P+ VE V           +   ++ EG 
Sbjct: 364 GTLVYCTCSLEPEEGVRQVEAFLAAHPAFRRQPVGVEDV---------AGLGEIVTGEGD 414

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +R  P  L  +     G+DGF+A  L R
Sbjct: 415 LRTLPCHLAAL----GGLDGFYAARLTR 438


>gi|254295350|ref|YP_003061373.1| Fmu (Sun) domain protein [Hirschia baltica ATCC 49814]
 gi|254043881|gb|ACT60676.1| Fmu (Sun) domain protein [Hirschia baltica ATCC 49814]
          Length = 487

 Score =  256 bits (654), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 150/370 (40%), Positives = 207/370 (55%), Gaps = 11/370 (2%)

Query: 38  FRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD 97
           F  L   D+   RAI +  LR   RID  L+  L   L +   ++  LLRV  AQ+  L 
Sbjct: 91  FDELEGPDRGFARAIASAALRAFGRIDDALETYLDRPLEKIDPAVLSLLRVGCAQLWVLK 150

Query: 98  VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLE 157
              YA VD  VE A++ K       +VN+ILRR  RE  E  + +    I P+W  ER  
Sbjct: 151 APSYAAVDATVEAARQWKPASRGGGMVNAILRRAGREP-EAYESLPASRIWPDWLSERFS 209

Query: 158 NFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPG 217
           +  G+E    I+   +    IDLTVK D E WA KL    LP+G +RL     S+  L G
Sbjct: 210 SALGEETTQNIAMMQMLEPRIDLTVKSDPEAWAQKLEGTALPSGSVRLP-TGASLTELEG 268

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLE 277
           + EG WWVQD +A++P QLFG +  LS+ DLCAAPGGKT QL   GAKVTA+D+S++R+E
Sbjct: 269 YVEGEWWVQDVAATLPAQLFGDVKGLSIGDLCAAPGGKTMQLASKGAKVTAIDLSEQRIE 328

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           K+R NL+R  L A+  +  DA  + P + FDAVL+DAPCS+ GT+RRHP+  W R+   +
Sbjct: 329 KVRENLERTGLKAKTQV-TDARHWRPAEPFDAVLLDAPCSALGTLRRHPEGAWRRNDKGL 387

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS-----PIPVELVP 392
            + +  Q KL+      +K GG +++  C+    +  EVV++ + S      PI  E VP
Sbjct: 388 DRYSGLQIKLVQAAYDMMKSGGTMLYCVCTPLPAEGIEVVKEAVDSGKWISKPITPEEVP 447

Query: 393 LNSAYWKSID 402
               Y  +ID
Sbjct: 448 ---GYEHAID 454


>gi|188579790|ref|YP_001923235.1| Fmu (Sun) domain protein [Methylobacterium populi BJ001]
 gi|179343288|gb|ACB78700.1| Fmu (Sun) domain protein [Methylobacterium populi BJ001]
          Length = 438

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 162/389 (41%), Positives = 219/389 (56%), Gaps = 10/389 (2%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           + R L  I A L   L   LP  +  L  LL    AQIL L VAD+A VDL+V  AK D 
Sbjct: 54  SFRRLGFIQAALAARLRDGLPENRPHLLALLVTGAAQILDLAVADHAAVDLSVRLAKADP 113

Query: 116 ENRHFAKLVNSILRRVSREK--IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
           + +H A LVN++LRR+ RE+  I   +        P+W   R    YG+    AI+ A +
Sbjct: 114 QLQHLAPLVNAVLRRIVRERDAIRAEETDPLAHNTPDWLARRWRAAYGEAAARAIATAHL 173

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLT+  D E WA +L  V L  G +RL E  E++  LPG+AEG WWVQDA+A++P
Sbjct: 174 EGAAVDLTLARDPEIWAERLGGVRLDLGSVRLVEAREAVADLPGYAEGAWWVQDAAAALP 233

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           V+L   ++   V DLCAAPGGKTAQ+  +GA VTA+D S  RLE+L  NL+RL L AE +
Sbjct: 234 VRLLAPVSGERVADLCAAPGGKTAQIAAAGAAVTAIDRSAGRLERLGRNLERLGLTAE-V 292

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           +  DA        FDAVL+DAPCS+TGT+RRHPDV WT+   D+ +    QR+LL +   
Sbjct: 293 VTTDALALPEDTPFDAVLLDAPCSATGTLRRHPDVAWTKSETDVFRLVGLQRRLLDKAAR 352

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPI--PVELVPLNSAYWKSIDMAMALSPEG 411
             +PGG +V+  CSL+ ++    +   L   P    + + P   A    +     + P G
Sbjct: 353 LTRPGGRLVYCTCSLEPEEGSGQIADFLNRHPNFERIAITPDRVAGHAEL-----IDPSG 407

Query: 412 WIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +R  P  L    G + G+DGFFA  LRR
Sbjct: 408 DLRTLPSHLAGGTGRAGGLDGFFASLLRR 436


>gi|300024959|ref|YP_003757570.1| sun protein [Hyphomicrobium denitrificans ATCC 51888]
 gi|299526780|gb|ADJ25249.1| sun protein [Hyphomicrobium denitrificans ATCC 51888]
          Length = 468

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 159/409 (38%), Positives = 228/409 (55%), Gaps = 22/409 (5%)

Query: 39  RLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDV 98
           R L+ RD+   R I    LR    + AVL   L   LP     L+Q+L  + AQ+L +  
Sbjct: 68  RNLAPRDRAFARLIATTVLRNRGSLQAVLRTYLEKPLPEHLGRLEQILLAAAAQLLLIKT 127

Query: 99  ADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLE 157
             +A + LAV+Q + D+  + F  LVN++LRR+S      L  +  + +  P+W   R  
Sbjct: 128 PPHAAISLAVDQCRADRVGKRFGNLVNAVLRRLSESGSGRLASLDNVMLTFPDWLMARWS 187

Query: 158 NFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPG 217
             YG      I+ A +S   +D+TVK D + WA +LN V LPTG IR   +   +  L G
Sbjct: 188 RTYGAAEARQIARASLSEPSLDITVKSDADAWASRLNGVALPTGSIRCSHVGR-VEELDG 246

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLE 277
           + +G WWVQDA+A++PV+L G ++ LS LDLCAAPGGKTAQL   GA+V A+D S  RL 
Sbjct: 247 YNDGAWWVQDAAAALPVKLLGDVSGLSALDLCAAPGGKTAQLAAGGARVVAVDKSAGRLA 306

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           +L+ NL RL L AE I   DA  +  +  FD VL+DAPC++TGTIRRHPD+L+ +  +D+
Sbjct: 307 RLQENLQRLGLSAE-ISVADAQSFSSETAFDVVLLDAPCTATGTIRRHPDILYLKRPEDV 365

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL------RSSPIPVE-- 389
              A  Q KLL Q    VK GG +++  CSL+ ++ EE +   L      R  PI ++  
Sbjct: 366 AALAALQAKLLRQAAGLVKSGGTLLYCTCSLEPEEGEEQIAAFLSEHRDFRRRPIALDET 425

Query: 390 LVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           ++PL    W++ D        G +R  P    ++     G+DGF+A  L
Sbjct: 426 VIPL---LWRTAD--------GDLRTLPSYFSELPEGFRGLDGFYAAML 463


>gi|294675830|ref|YP_003576445.1| ribosomal RNA small subunit methyltransferase B [Rhodobacter
           capsulatus SB 1003]
 gi|294474650|gb|ADE84038.1| ribosomal RNA small subunit methyltransferase B-1 [Rhodobacter
           capsulatus SB 1003]
          Length = 421

 Score =  252 bits (644), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 165/428 (38%), Positives = 243/428 (56%), Gaps = 27/428 (6%)

Query: 16  SCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSL 75
           S V+++R++L      + G+ A   L+  D+   + I   TLR L R DA+L   L  + 
Sbjct: 16  SGVLQERLTLA----EQAGELAA--LAPPDRARAQRIALATLRNLTRADAMLKPHLRKAP 69

Query: 76  PRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRD-KENRHFAKLVNSILRRVSRE 134
           P     L  LLR+   +I  L  A + V D  V  A+   ++   FA L+N++LR+++ +
Sbjct: 70  P---PDLHVLLRLGTVEICALGEAPHGVTDALVTLARSGGQKTEGFAGLINAVLRKIASD 126

Query: 135 KIELLQRIAGI--SIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHK 192
                 R A +    +P W + RL + YGK  V+ +  A ++    DL+VK + ETWA K
Sbjct: 127 T----DRWARLDPPALPGWLRGRLMSAYGKVAVMRMEAAHLAGAPTDLSVKAEAETWAAK 182

Query: 193 LNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAP 252
           L A +LPTG +RL +  + I  LPG+A G WWVQDA+A++P ++        VLDLCAAP
Sbjct: 183 LGAELLPTGSLRLAQAGQ-ITELPGYATGDWWVQDAAAALPARVLNAQPGEHVLDLCAAP 241

Query: 253 GGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLV 312
           GGKT QL+ +GA+VTALDVS  RL++L  NL R  + AE ++  DA D+ P   FDA+L+
Sbjct: 242 GGKTLQLLAAGARVTALDVSAPRLDRLEENLARCGMRAETVV-ADALDWTPAAPFDAILL 300

Query: 313 DAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQD 372
           DAPCS+TGTIRRHPD+ + +D   I + A  Q  LL +   ++KPGG +V++ CSL  ++
Sbjct: 301 DAPCSATGTIRRHPDLPFVKDASGIKELAALQAALLDRAPGWLKPGGRLVYATCSLLPEE 360

Query: 373 SEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDG 432
            E  +   L   P  + LVP+ +     +D    L+  G +R+ PD          G+DG
Sbjct: 361 GEAQIAAALSRHPG-LRLVPITA---PGLDPDW-LTETGCLRLRPDFWPD----RGGLDG 411

Query: 433 FFAVALRR 440
           FF   LRR
Sbjct: 412 FFIAVLRR 419


>gi|114571463|ref|YP_758143.1| Fmu (Sun) domain-containing protein [Maricaulis maris MCS10]
 gi|114341925|gb|ABI67205.1| Fmu (Sun) domain protein [Maricaulis maris MCS10]
          Length = 433

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 163/427 (38%), Positives = 234/427 (54%), Gaps = 28/427 (6%)

Query: 17  CVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLP 76
            VM++R +L   L+       F  +S RD+   RAI   T R L +   VL+ +L   L 
Sbjct: 17  AVMKQRRTLEAALEHT---PEFAAMSDRDRAFARAITATTFRRLGQTRTVLNGLLSRPLH 73

Query: 77  RKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKI 136
                 Q LL     Q+L++D A +AVV   VE A    + R    L+N++LRRV RE  
Sbjct: 74  ETSEGAQALLITGATQLLWMDGAPHAVVSSTVELADARSDARKLKGLINAVLRRVDREGR 133

Query: 137 ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF--DIETWAHKLN 194
           E L+       +P+W ++     YG   +  +++A      +DLTVK     E WA  L+
Sbjct: 134 ERLKPTLPRDNLPDWLRDSWRAAYGPGTLSRMANAITVAPPLDLTVKDPDTREHWARALD 193

Query: 195 AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGG 254
           A +LP G +R ++    + +LPG+ EG WW QDA+A+IP  L       SV+DLCAAPGG
Sbjct: 194 ATILPNGSLR-RDTVGDVRALPGYREGAWWAQDAAAAIPATLLTLGPGSSVIDLCAAPGG 252

Query: 255 KTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDA 314
           KT QL  +GA VTALD+S++RLE++R NL R  L A  ++  DA  Y P +  DAVL+DA
Sbjct: 253 KTMQLAATGADVTALDLSEKRLERVRENLGRTGLSAT-LVAGDALTYKPAQPVDAVLLDA 311

Query: 315 PCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSE 374
           PC++TGT+RRHP+  W +  DD  + A  Q +++    + +KPGG +V   CSL  ++ E
Sbjct: 312 PCTATGTLRRHPEAAWIKRADDTGRMARLQDEMIKAAAAMLKPGGQLVLCTCSLQPEEGE 371

Query: 375 EVVQKV------LRSSPI-PVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
            +  +V      L+ SPI P EL  + S          AL+P GW+R+TP +  +     
Sbjct: 372 ALAGRVAGRHRQLKESPIQPDELAGVES----------ALTPAGWVRLTPALWAE----Q 417

Query: 428 SGMDGFF 434
            GMDGFF
Sbjct: 418 GGMDGFF 424


>gi|84684376|ref|ZP_01012277.1| ribosomal RNA small subunit methyltransferase B, putative
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667355|gb|EAQ13824.1| ribosomal RNA small subunit methyltransferase B, putative
           [Rhodobacterales bacterium HTCC2654]
          Length = 420

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 159/433 (36%), Positives = 238/433 (54%), Gaps = 39/433 (9%)

Query: 21  KRISLTCLLD-LEYGDSAFRLLSQR-------DQILVRAIVNVTLRFLPRIDAVLDFVLI 72
           +R++L  + D +E+G     +L +R       D+   + +V    R + R D VL   L 
Sbjct: 9   RRVALDLMGDVMEHGRLLPEVLPRRLEKLAPEDRARTQRLVATAFRVMDRADRVLGPHL- 67

Query: 73  SSLPRKKYSL--QQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRR 130
               RK+ +L    +LR+SVA+I  L  A + VV+ AVE A+ DK+    A LVN+ILR+
Sbjct: 68  ----RKRPTLRIHNILRLSVAEICELGAAPHGVVNTAVELARADKKTAGMAGLVNAILRK 123

Query: 131 VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWA 190
           V       L        +P+W ++ L + YGK+ V A+  A  +   +DLT K D ET A
Sbjct: 124 VDPAGWAALP----TPRLPKWLRKPLTDDYGKDIVAAMETAFYAGAPLDLTPKGDAETLA 179

Query: 191 HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCA 250
             L   +LPTG +R+    + + +LPGFAEG WWVQDA+A++P ++       +VLDLCA
Sbjct: 180 QALGGTVLPTGSVRVTGAGQ-VSTLPGFAEGDWWVQDAAAALPARVLNAQPGEAVLDLCA 238

Query: 251 APGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAV 310
           APGGKT QL  +GA+VTA+D+S+ R+ ++  NL R  L A D++ MDA +Y     FDA+
Sbjct: 239 APGGKTMQLAAAGAEVTAVDISEHRMARVGENLARCGLSA-DLVTMDALEY-EGGPFDAI 296

Query: 311 LVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDK 370
           L+DAPC++TGTIRRHPD+ + +D  D       Q  L+ + +  +KPGG +V+  CSL  
Sbjct: 297 LLDAPCTATGTIRRHPDLPYAKDGSDFPGLFELQEHLIDRALGMLKPGGRLVYCTCSLLI 356

Query: 371 QDSEEVVQKVL-RSSPIPVELVPLNSAY----WKSIDMAMALSPEGWIRITPDMLEKIDG 425
            + EE V+  L R   + V+   L+       W++ +  + L P+ W             
Sbjct: 357 DEGEEQVRDALGRHEGLSVDTAALDRPGIDPDWRTDEGGLRLRPDYWAD----------- 405

Query: 426 VSSGMDGFFAVAL 438
              GMDGF+   L
Sbjct: 406 -KGGMDGFYIACL 417


>gi|297184252|gb|ADI20370.1| tRNA and rRNA cytosine-c5-methylases [uncultured alpha
           proteobacterium EB080_L27A02]
          Length = 430

 Score =  249 bits (635), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 162/440 (36%), Positives = 255/440 (57%), Gaps = 27/440 (6%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRL-LSQRDQILVRAIVNVTLRFL 60
           K G+ AR  +  LL  V+ +R     L+D+  G+ +  + L   ++   +++   TLR L
Sbjct: 3   KPGLFAREAAVRLLHAVLLER---RLLIDIVNGEDSLLIDLEPSERARAQSLAMTTLRNL 59

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             ID VL   L    P   ++L  +LRVS A++L   +A +A VD AV  AKR  +  H 
Sbjct: 60  GPIDFVLQKYLTKQTP---FALLNILRVSAAEMLVDGIAAHAAVDSAVTMAKRRHKTAHL 116

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             L N++LR+V+ E +E+ + +    + P+ F+ ++     KE + +I  +  +   +DL
Sbjct: 117 KDLANAVLRKVASEGMEIFEGLEPQEL-PKAFRSQMAKIVTKEEMTSIERSHQAGAPVDL 175

Query: 181 TVKFDIE---TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           + K DI+   ++    N +M+P G +RLK   + I  + GF +G WWVQD +ASIP + F
Sbjct: 176 SFK-DIKKANSFIENSNGIMMPNGSVRLKRAGQ-ITEMNGFLDGDWWVQDLAASIPAKCF 233

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G L+   VLDLCAAPGGKT QL   GA VTALD+S +RLE+++ NL+R  L A + I  D
Sbjct: 234 GDLSGKKVLDLCAAPGGKTMQLASMGATVTALDISSKRLERVKQNLERTKLKA-NCIAAD 292

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A  + P + FDA+L+DAPCS++GTIRRHPD+ + ++  D+ +    QR LLL+  +++ P
Sbjct: 293 ALKWKPVECFDAILLDAPCSASGTIRRHPDLPFAKENFDLGELLKLQRALLLKASNWLVP 352

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLNSAYWKSIDMAMALS-PEGWIR 414
           GGI+++S CS+   + E  VQ + + +   IP ++ P      K I ++  ++  +G IR
Sbjct: 353 GGILIYSTCSIFSAEGEGQVQWLAKQNNDLIPQKIDP------KLIGLSDYMANKDGQIR 406

Query: 415 ITPDMLEKIDGVSSGMDGFF 434
           + PD    +     GMDGFF
Sbjct: 407 LRPDFFADL----GGMDGFF 422


>gi|83945706|ref|ZP_00958051.1| rRNA methyltransferase RsmB [Oceanicaulis alexandrii HTCC2633]
 gi|83850907|gb|EAP88767.1| rRNA methyltransferase RsmB [Oceanicaulis alexandrii HTCC2633]
          Length = 450

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 153/429 (35%), Positives = 235/429 (54%), Gaps = 14/429 (3%)

Query: 8   RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVL 67
           R V+   +  V+ K + L   L    G   ++ +  RD+   RAI +  +R    +DA L
Sbjct: 27  RAVALGAVEGVLAKAVPLDGAL---AGRPEWKRMEPRDRAFARAIASAVIRRPIALDAAL 83

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSI 127
             VL   LP ++     +LR   A+ L LD   +A VD  V    +D+    F  L N++
Sbjct: 84  MQVLDKPLPDEEVRAHLILRCGAAERLILDTPAHAAVDAWVSLMAQDRHTARFKNLANAV 143

Query: 128 LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK--FD 185
           LRRV  +  +       +  +P+W  ER    YG+    AI+ A   P  +DLT K  FD
Sbjct: 144 LRRVVDQGKDAFLDSDPLEDLPDWLAERWVETYGEPTARAIAIARSVPPTLDLTAKPGFD 203

Query: 186 IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSV 245
            +++A ++ A +L TG IR  ++  ++  LPGF  G WWVQDA+A++P +L G     +V
Sbjct: 204 AQSFAEEIGASVLETGTIRRPDI-GAVDGLPGFENGDWWVQDAAAALPAKLLGVKAGETV 262

Query: 246 LDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKK 305
            DLCAAPGGKT QL  +GA V A+D S +RL++L  NL+R  L AE I+  D  D+   +
Sbjct: 263 ADLCAAPGGKTLQLAATGASVIAVDASPKRLKRLEDNLERTKLKAE-IVAADVADWTAPE 321

Query: 306 LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN 365
             DA+L+DAPCS+TGT+RR PD  W +   DI   A  QR+LL    + +KPGG +V+  
Sbjct: 322 PLDAILLDAPCSATGTLRRRPDAAWAKQPGDIANLADIQRRLLDASFNQLKPGGRLVYCT 381

Query: 366 CSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDG 425
           CSL++++ E+ ++  L+ +P    L P+ +       +  A++P+G +R  PD+  +   
Sbjct: 382 CSLEREEGEDQIEAFLKRTPD-ARLDPVTADELPG--LKAAITPDGAVRTRPDLWSE--- 435

Query: 426 VSSGMDGFF 434
              G+DGF+
Sbjct: 436 -RGGLDGFY 443


>gi|114769580|ref|ZP_01447190.1| ribosomal RNA small subunit methyltransferase B, putative [alpha
           proteobacterium HTCC2255]
 gi|114549285|gb|EAU52167.1| ribosomal RNA small subunit methyltransferase B, putative [alpha
           proteobacterium HTCC2255]
 gi|297183946|gb|ADI20067.1| hypothetical protein [uncultured alpha proteobacterium
           EB080_L11F12]
          Length = 430

 Score =  246 bits (629), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 161/440 (36%), Positives = 254/440 (57%), Gaps = 27/440 (6%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRL-LSQRDQILVRAIVNVTLRFL 60
           K G+ AR  +  LL  V+ +R     L+D+  G+ +  + L   ++   +++   TLR L
Sbjct: 3   KPGLFAREAAVRLLHAVLLER---RLLIDIVNGEDSLLIDLEPSERARAQSLAMTTLRNL 59

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             ID VL   L    P   ++L  +LRVS A++L   +A +A VD AV  AKR  +  H 
Sbjct: 60  GPIDFVLQKYLTKQTP---FALLNILRVSAAEMLVDGIAAHAAVDSAVTMAKRRHKTAHL 116

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             L N++LR+V+ E +++ + +    + P+ F+ ++     KE + +I  +  +   +DL
Sbjct: 117 KDLANAVLRKVASEGMDIFEGLEPQEL-PKAFRSQMAKIVTKEEMTSIERSHQAGAPVDL 175

Query: 181 TVKFDIE---TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           + K DI+    +    N +M+P G +RLK   + I  + GF +G WWVQD +ASIP + F
Sbjct: 176 SFK-DIKKANAFIENSNGIMMPNGSVRLKRAGQ-ITEMNGFLDGDWWVQDLAASIPAKCF 233

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G L+   VLDLCAAPGGKT QL   GA VTALD+S +RLE+++ NL+R  L A + I  D
Sbjct: 234 GDLSGKKVLDLCAAPGGKTMQLASMGATVTALDISSKRLERVKQNLERTKLKA-NCIAAD 292

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A  + P + FDA+L+DAPCS++GTIRRHPD+ + ++  D+ +    QR LLL+  +++ P
Sbjct: 293 ALKWKPVERFDAILLDAPCSASGTIRRHPDLPFAKENFDLGELLKLQRALLLKASNWLVP 352

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLNSAYWKSIDMAMALS-PEGWIR 414
           GGI+++S CS+   + E  VQ + + +   IP ++ P      K I ++  ++  +G IR
Sbjct: 353 GGILIYSTCSIFSAEGEGQVQWLAKQNNDLIPQKIDP------KLIGLSDYMANKDGQIR 406

Query: 415 ITPDMLEKIDGVSSGMDGFF 434
           + PD    +     GMDGFF
Sbjct: 407 LRPDFFADL----GGMDGFF 422


>gi|167648734|ref|YP_001686397.1| Fmu (Sun) domain-containing protein [Caulobacter sp. K31]
 gi|167351164|gb|ABZ73899.1| Fmu (Sun) domain protein [Caulobacter sp. K31]
          Length = 426

 Score =  245 bits (626), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 161/438 (36%), Positives = 230/438 (52%), Gaps = 23/438 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +  G+ AR  +  L+   + +R  L    D     +AFR L  R++   RA+   TLR L
Sbjct: 5   LNDGLPAREGALALIDAALSRRGGL----DEAASANAFRFLEPRERAFARALAMATLRHL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             ID  L   L    P +   ++ LLR+   Q  +L+V  +A V  +VE A   K +R F
Sbjct: 61  GPIDRALAGKLAKEPPPR---VRNLLRLGATQAFFLEVPAFAAVATSVELAGASKTSRPF 117

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             LVN++LR + R+        A   + P W   R  + YGKE   A++         DL
Sbjct: 118 KGLVNAVLRGLLRDGA---LSDASEHLAPPWLYARWVSAYGKETADAVAAQIGFEPATDL 174

Query: 181 TVK--FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFG 238
           ++K  FD    A +L   +LP G +R  E    + + P F +GVWW+QDA+A+IP +L  
Sbjct: 175 SLKPDFDATALAAELEGEILPGGTLR-TERRGDVSAWPAFDDGVWWIQDAAAAIPARLLN 233

Query: 239 TLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA 298
                + LDLCAAPGGKT Q++ +GA+V A+D S  RL ++  NL R+ + AE +I  DA
Sbjct: 234 LKPGETALDLCAAPGGKTMQMVAAGAQVVAIDRSPARLGRVTENLARMSMQAE-VIAADA 292

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
             +   + FDAVL+DAPCS+TGT RRHPDVLW     D+   A  Q KLL      +KPG
Sbjct: 293 GAWDDARTFDAVLLDAPCSATGTFRRHPDVLWAARPGDVASLAGVQSKLLDSAAGRLKPG 352

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G +V+  CSL+ ++ E  V+  L   P  + L P+ S    +   A +L+P G +RI P 
Sbjct: 353 GRLVYCVCSLEPEEGEAQVEAFLARRPD-MALDPITSEEGGAP--AASLTPRGTLRILPH 409

Query: 419 MLEKIDGVSSGMDGFFAV 436
             E       G+DGFFA 
Sbjct: 410 HRE------GGLDGFFAA 421


>gi|297184029|gb|ADI20149.1| tRNA and rRNA cytosine-c5-methylases [uncultured alpha
           proteobacterium EB080_L06A09]
          Length = 430

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 160/439 (36%), Positives = 247/439 (56%), Gaps = 25/439 (5%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRL-LSQRDQILVRAIVNVTLRFL 60
           K G+ AR  +  LL  V+   +    L+D+  G+ +  + L   ++   +++   TLR L
Sbjct: 3   KPGLFAREAAVRLLHAVL---LEHRLLIDIVNGEDSLLIDLEPSERARAQSLAMTTLRNL 59

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             ID VL   L    P   ++L  +LRVS A++L   +A +A VD AV  AKR  +  H 
Sbjct: 60  GPIDIVLKKYLTKKPP---FALLNILRVSSAEMLVDGIAAHAAVDSAVTMAKRKHKTAHL 116

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             L N++LR+V+ E IE+ +++    + P+ F+ ++     KE ++ I  +      +DL
Sbjct: 117 KDLTNAVLRKVASEGIEVFKKLEPQEL-PKAFRSQMAKIATKEEIIRIERSHQIGAPVDL 175

Query: 181 TVKFDIE---TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           + K DI+   T+    N +M+P G +RLK   + I  + GF++G WWVQD +ASIP + F
Sbjct: 176 SFK-DIKKAKTFLESYNGIMMPNGSVRLKRAGQ-ITEMNGFSDGDWWVQDLAASIPAKCF 233

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
             LN   VLDLCAAPGGKT QL   GA VTALD+S +RLE+++ NLDR  L A   I  D
Sbjct: 234 NDLNGKKVLDLCAAPGGKTMQLASMGAIVTALDISSKRLERVKQNLDRTKLKAH-CIAAD 292

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A  + P + FDA+L+DAPCS++GTIRRHPD+ + ++  D+ +    QR LLL+   ++ P
Sbjct: 293 ALKWKPAERFDAILLDAPCSASGTIRRHPDLPFAKENFDLGELLKLQRALLLKASGWLAP 352

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSP--IPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           GG +++S CS+   + E  VQ + + +    P ++ P     ++ +      + +G IR+
Sbjct: 353 GGELIYSTCSIFSAEGEGQVQWLSKQNNNLAPQKIDPTLLGLYEFM-----ANNDGQIRL 407

Query: 416 TPDMLEKIDGVSSGMDGFF 434
            PD          GMDGFF
Sbjct: 408 RPDYFAD----QGGMDGFF 422


>gi|254420361|ref|ZP_05034085.1| NOL1/NOP2/sun family protein [Brevundimonas sp. BAL3]
 gi|196186538|gb|EDX81514.1| NOL1/NOP2/sun family protein [Brevundimonas sp. BAL3]
          Length = 445

 Score =  242 bits (618), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 163/440 (37%), Positives = 239/440 (54%), Gaps = 21/440 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR+V+  LL+  + KR  L    D      A R L   D+   RA+    LR L  I
Sbjct: 24  GVEARVVAGILLNAALEKRNGL----DEALSQPAARALEPVDRAFARAVAMAALRRLGEI 79

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D +L+  L  S P    +++ L+R+++AQ L L+   +A V  AV+ A+RD + R +  L
Sbjct: 80  DQILNRRLQKSPPE---AVRTLMRIALAQTLVLETPAFAAVSTAVKLAERDPKTRPYKNL 136

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN++LR V R+   L       S +P+W   R +  YG+  +  ++ A       DL++K
Sbjct: 137 VNAVLRGVGRDGPGL---TTAESNLPDWIAARWKATYGEAALTGLALAAREEPATDLSLK 193

Query: 184 --FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              D    A  +    L  G +R     + + + PGF +G WWVQDA+A++P +L G   
Sbjct: 194 PGVDPAAVAAAVEGEALEGGTVRTGRRGD-VATWPGFDDGDWWVQDAAAAVPGRLLGVKP 252

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             + LD+CAAPGGKT QL  +GA V ALD S  RL++L  NL+R  L AE +I + A D+
Sbjct: 253 GETALDMCAAPGGKTLQLAAAGASVVALDRSAPRLKRLSQNLERTGLTAE-VIAVPAEDW 311

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDAVL+DAPC++TGT RR+P+VL      ++ K A  Q +LL      VKPGG +
Sbjct: 312 EDDRSFDAVLLDAPCTATGTFRRNPEVLRATKPAEVAKLADVQHRLLDAAAERVKPGGRL 371

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL++++ E  V   LR +P     V  + A   +     AL+PEGW+RI P M  
Sbjct: 372 VYCTCSLEREEGETQVIAFLRRNPG-FRTVAADPAALGA--PPEALTPEGWLRILPSMWA 428

Query: 422 KIDGVSSGMDGFFAVALRRL 441
           +      G+DGFFA  L R+
Sbjct: 429 E----HGGLDGFFAAKLERI 444


>gi|254437147|ref|ZP_05050641.1| Methyltransferase small domain family [Octadecabacter antarcticus
           307]
 gi|198252593|gb|EDY76907.1| Methyltransferase small domain family [Octadecabacter antarcticus
           307]
          Length = 410

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 150/414 (36%), Positives = 225/414 (54%), Gaps = 25/414 (6%)

Query: 34  GDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQI 93
           G+ A + LS  D+   + +   TLR L R D +L   L  + P    S++ +LR+   ++
Sbjct: 17  GEGALQHLSPEDRARAQRLTTETLRGLARADRMLARFLQKTPP---LSVRNVLRLCTVEL 73

Query: 94  LYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFK 153
              + A Y VV+  VE   R+K       LVN++LR+V+ E  E   ++A    +P W +
Sbjct: 74  AGGEAA-YGVVNAGVEMVARNKRTSSMKGLVNAVLRKVAAEGPEGWAQLA-TPRMPGWLR 131

Query: 154 ERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIV 213
             L++ YG E V AI  A  +   +D+T K D +     L   +LPTG IRL++  + + 
Sbjct: 132 SPLKDAYGPEIVAAIETAQFAGAPLDITAKGDPQAANETLKGEILPTGTIRLRDAGQ-VS 190

Query: 214 SLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSK 273
           +LPGF  G WWVQDA+A+IPVQ+        +LDLCAAPGGKT QL ++GA VTA+D S+
Sbjct: 191 TLPGFESGDWWVQDAAAAIPVQILAPQKGEKILDLCAAPGGKTMQLAMAGADVTAVDSSE 250

Query: 274 RRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
            R+ ++  NL R  L A   I  DAF +     FDA+L+DAPCS+TGTIRRHPD+ + +D
Sbjct: 251 GRMIRVGENLKRTGLNAT-TITADAFAFTSGG-FDAILLDAPCSATGTIRRHPDLPYAKD 308

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVP 392
             +       Q +++   +S + PGG +VF  CSL   + E  V++ L R   + V+   
Sbjct: 309 GSEFGILIHQQARMIDHALSLLNPGGRLVFCTCSLLPDEGEVQVEEALARHRGLTVDASA 368

Query: 393 LNSA----YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           L+ +     W++ D  + L P+ W                GMDGF+ V LR+ +
Sbjct: 369 LDRSGIDPAWRTEDGGLRLRPDYWAD------------KGGMDGFYIVQLRKPV 410


>gi|220925067|ref|YP_002500369.1| sun protein [Methylobacterium nodulans ORS 2060]
 gi|219949674|gb|ACL60066.1| sun protein [Methylobacterium nodulans ORS 2060]
          Length = 448

 Score =  241 bits (616), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 176/447 (39%), Positives = 241/447 (53%), Gaps = 20/447 (4%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR ++   ++ ++  R S T L D+    +A   L  +D  L RAI   T R L  
Sbjct: 10  AGLAARRLAHASVADLLGAR-SGTVLDDVLDPAAARASLGAQDLGLARAIAAATFRHLGV 68

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   +   LP  +  L  LL    AQILYL+V D+A VDL+V  AK +   RH + 
Sbjct: 69  IRHALAARMTQGLPEDQPRLLALLATGAAQILYLNVQDHAAVDLSVRIAKNEAALRHLSG 128

Query: 123 LVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFYGKERVLAISDACISPLYID 179
           LVN++LRR++RE+  + Q      +    P W   R    +G     AI++A +    +D
Sbjct: 129 LVNAVLRRIAREQAAIRQEGDADPLGLGTPAWLARRWSAAHGAATARAIAEAHMRGAPLD 188

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           LTVK D ETWA +L A +LPTG +RL +    +  L G+  G WWVQDA+A++P +L   
Sbjct: 189 LTVKADPETWAERLGARLLPTGSLRLDDARTPVPQLAGYDSGAWWVQDAAAALPARLLAV 248

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
                V DLCAAPGGKTAQL  +GA V A+D S+ RL +L  NL RL L AE    +DA 
Sbjct: 249 RPGERVADLCAAPGGKTAQLAAAGAAVVAVDRSEARLRRLSENLARLGLAAE-TRAVDAL 307

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FDA+L+DAPCS+TGTIRRHPDV WT+   D+ + A  Q KLL +    ++PGG
Sbjct: 308 TLPDDDQFDAILLDAPCSATGTIRRHPDVAWTKREGDLPRLAALQGKLLDKAARLLRPGG 367

Query: 360 IVVFSNCSLDKQDSEEVVQKVL-RSS-----PIPVELVPLNSAYWKSIDMAMALSPEGWI 413
            +V+  CSL+ ++ E      L R S     PI  E V   + +         +S  G +
Sbjct: 368 RLVYCTCSLEPEEGEAQADAFLARHSDFARLPIAAEEVGGETGF---------VSERGDL 418

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRR 440
           R  P       G   G+DGFFAV LR+
Sbjct: 419 RTLPSHWPDAAGGRGGIDGFFAVRLRK 445


>gi|149203489|ref|ZP_01880459.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius sp. TM1035]
 gi|149143322|gb|EDM31361.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius sp. TM1035]
          Length = 422

 Score =  240 bits (613), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 159/442 (35%), Positives = 240/442 (54%), Gaps = 27/442 (6%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K  + AR  ++HLL  V+ +   ++ L+       A   L+  D+   + + + TLR L 
Sbjct: 3   KPKLTARSAAAHLLDRVLGEGRLMSDLI----AGGALEPLAPADRARAQRLASETLRGLA 58

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R D +L   L    P     +Q +LR++  + L      + VV+ AV+   +   + +  
Sbjct: 59  RADRLLSRHLRKGPP---LPVQNVLRLATVE-LAQGGESHGVVNDAVDIIGQSPRHANLK 114

Query: 122 KLVNSILRRVSREKIELLQ--RIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
            LVN++LR+V+ E        R  G+   P+W +  L   +GK  V A+  A  +   +D
Sbjct: 115 GLVNAVLRKVAEEAPRSWNDLRQPGL---PDWLRGPLVEAWGKGAVTAMERAHFAGAALD 171

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           +TVK D + WA +L A +LPTG +R  + P  + +LPG+AEG WWVQDA+A++PVQ+   
Sbjct: 172 ITVKSDPQGWADRLGATLLPTGSLRRSD-PGQVSALPGYAEGAWWVQDAAAALPVQVLAP 230

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE-MDA 298
               +VLDLCAAPGGKT QL  +GA+VTALD+S+RR+ ++  NL R  L A   +E   A
Sbjct: 231 QPGETVLDLCAAPGGKTLQLAAAGAEVTALDLSERRMARVAENLARTGLEATCRVEDARA 290

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
               P   +DA+L+DAPCS+TGTIRRHPD+   +D  D       Q ++L   ++ +KPG
Sbjct: 291 HQGGP---YDAILLDAPCSATGTIRRHPDLPHAKDGSDFGALITLQAEMLDHALTLLKPG 347

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSP-IPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           G +VF  CSL   + E  V++ L   P + V+   L       ID A  ++ EG +R+ P
Sbjct: 348 GRLVFCTCSLLPDEGECQVEEALARHPGLTVDRAALAQ---PGIDPAW-ITEEGGLRLRP 403

Query: 418 DMLEKIDGVSSGMDGFFAVALR 439
           D    +     GMDGF+   LR
Sbjct: 404 DYWADL----GGMDGFYIACLR 421


>gi|329847341|ref|ZP_08262369.1| nusB family protein [Asticcacaulis biprosthecum C19]
 gi|328842404|gb|EGF91973.1| nusB family protein [Asticcacaulis biprosthecum C19]
          Length = 457

 Score =  239 bits (611), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 159/443 (35%), Positives = 228/443 (51%), Gaps = 27/443 (6%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           GMNARL +  L+   + KR       D     S F  L+  ++   RA+  + LR L ++
Sbjct: 33  GMNARLAALTLIDAALEKRTGF----DEAVTRSDFLSLNDSERGFARALAMLVLRRLGQL 88

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D V+D     +       +  LLR+ +AQI ++ V D+A V   V+ A+R+   R F  L
Sbjct: 89  DYVIDKKTQKA---PNDGVWALLRIGLAQIGFMQVPDFAAVSTTVKLAEREAHTRPFKGL 145

Query: 124 VNSILRRVSRE---KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           +N+ILR V RE      L  R+A     P+W  +R +  YG+     I+         DL
Sbjct: 146 INAILRSVIREGGLNTPLPSRLA-----PDWLFQRWKAAYGEPNAEGIALMLTEEPATDL 200

Query: 181 TVKF--DIETWAHKLNAVMLPTGGIRLKE-LPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           T K   D+E    +L     P GG+ L+  L  +I    G+ +GVWWVQDA+AS+   L 
Sbjct: 201 TFKTAADLERLKDELQGT--PLGGLALRSALRGNIAEWAGYGQGVWWVQDAAASVAAGLL 258

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G L   + +DLCAAPGGK  Q+I +G  V ALD S+ RL+++  NL R  L AE ++  D
Sbjct: 259 GDLTGKTAIDLCAAPGGKALQMIAAGGDVIALDRSRNRLKRVEENLVRTGLTAE-VVMGD 317

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A  +   + FDAVL+DAPCS+TGT+RR PDVLW     DI K A  Q +LL      VKP
Sbjct: 318 AETWEDTRQFDAVLLDAPCSATGTLRRQPDVLWATRPTDIAKLADVQHRLLDSASGRVKP 377

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG +++  CSL++++ E  V   LR  P      P ++          +++ +GW+R+ P
Sbjct: 378 GGSLIYCTCSLEREEGETQVVAFLRRHPDFAIKKPDDATVIALGVPVESVAAQGWLRLLP 437

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
                      G DGFF   L R
Sbjct: 438 HHR------PGGQDGFFIAHLVR 454


>gi|16124357|ref|NP_418921.1| rRNA methyltransferase RsmB [Caulobacter crescentus CB15]
 gi|221233040|ref|YP_002515476.1| 16S rRNA m5C methyltransferase RsmB [Caulobacter crescentus NA1000]
 gi|13421207|gb|AAK22089.1| rRNA methyltransferase RsmB [Caulobacter crescentus CB15]
 gi|220962212|gb|ACL93568.1| 16S rRNA m5C methyltransferase RsmB [Caulobacter crescentus NA1000]
          Length = 429

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 159/444 (35%), Positives = 227/444 (51%), Gaps = 22/444 (4%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +  G+ AR  +  L+   + +R  L    D     + FR L  R++   RA+    LR L
Sbjct: 5   LNDGLPAREAALTLIDAALSRRGGL----DEAASANGFRFLEPRERAFARALAMAVLRHL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             ID  L   L  + P +   +  LLR+  AQ  YL+V  +A V  +VE A  +K +R F
Sbjct: 61  GPIDRALTARLQKAPPDR---VMHLLRLGAAQAFYLEVPAFAAVATSVELAGANKTSRPF 117

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             LVN++LR + R+            + P W   R    +G+     I+         DL
Sbjct: 118 KGLVNAVLRGLLRDAPPADDPSL---LAPPWLYARWVAAFGEATARQIAGQIAIEPATDL 174

Query: 181 TVK--FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFG 238
           + K   D+      L A +LP G +RL+   + + + PGF +G WWVQDA+A++P +L  
Sbjct: 175 SAKPGADLAPLVEALEAEVLPGGTLRLRRKGD-VAAWPGFEDGTWWVQDAAAAVPARLLD 233

Query: 239 TLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA 298
                SVLDLCAAPGGKT QL  +GA+V ALD S  RL++L  NL R  L AE I+  DA
Sbjct: 234 VQPGASVLDLCAAPGGKTLQLAAAGAQVVALDRSAARLKRLSENLTRTGLSAE-IVAADA 292

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
             +   + FDA+L+DAPCS+TGT RRHPDVLW     D+   A  Q ++L      +KPG
Sbjct: 293 AVWDDTRTFDAILLDAPCSATGTFRRHPDVLWAARPGDVASLANVQARILDAAADRLKPG 352

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA-LSPEGWIRITP 417
             +V+  CSL+ ++ E  V+  L +    V L P+ +A   S     A L+P G +R+ P
Sbjct: 353 ARLVYCVCSLEPEEGEAQVEAFL-ARRQDVALEPITAAEAPSAGFPEASLTPRGTLRLLP 411

Query: 418 DMLEKIDGVSSGMDGFFAVALRRL 441
              +       G DGFFA   R+L
Sbjct: 412 HHRD------DGQDGFFAARFRKL 429


>gi|304320686|ref|YP_003854329.1| tRNA and rRNA cytosine-C5-methylase-like protein [Parvularcula
           bermudensis HTCC2503]
 gi|303299588|gb|ADM09187.1| tRNA and rRNA cytosine-C5-methylase-like protein [Parvularcula
           bermudensis HTCC2503]
          Length = 455

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 154/458 (33%), Positives = 236/458 (51%), Gaps = 48/458 (10%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDS-AFRLLSQRDQILVRAIVNVTLRFL 60
           + G+ AR  +  +L  + R +      LD+   +S AF  L   D+   R ++   LR  
Sbjct: 25  EPGLPARRAALDILLAIRRGQA-----LDMAMAESEAFEDLEGADRGFARTLIMAVLRRQ 79

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             +D      L   L   + ++  LLR++ AQIL L V  +A     V+ AK  +++  F
Sbjct: 80  NTLDEAYGTFLDRPLKSTQGTVITLLRLAAAQILLLGVPPHAATATTVDLAKERRDSAGF 139

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKL+N++ RR+  +   L++     + +P W   RLE  YG +    ++ A +    +DL
Sbjct: 140 AKLLNALCRRMVEKGPSLIEDYPPRTDVPGWLWRRLERHYGAKTARRLAAAFVQEPALDL 199

Query: 181 TVKFDIETW-------AHKLNAVMLP-TGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
           T K   E         AH L  V L  T G R+++LP       G+ EG WW+QD +A++
Sbjct: 200 TPKDPKERERLATALEAHPLGPVSLRRTAGGRIEDLP-------GYTEGDWWIQDLAAAL 252

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAED 292
           P+ L G L    V DLCAAPGGKTAQL  +GA VTA+D+S +RL +L  NL RL L A+ 
Sbjct: 253 PISLLGDLTGQRVYDLCAAPGGKTAQLAAAGAHVTAVDISAKRLRRLEDNLARLGLRADT 312

Query: 293 IIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
            +  D   + P +  D V++DAPC++TGT+RRHPD+LW++  +D+ + +  Q ++L    
Sbjct: 313 FV-GDVLGFSPDEPADLVVLDAPCTATGTVRRHPDLLWSKKEEDVAELSALQDQMLHHAA 371

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVE---------LVPLNSAYWKSID 402
             V+PGG ++F  CSL  ++ E+  +  L R S    E         L PLN+A      
Sbjct: 372 RLVRPGGRLMFITCSLLAEEGEDRSRAFLSRHSQFTAEPLSDDEKERLGPLNAAK----- 426

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  +G +R  PD++      + GMDGF+A    R
Sbjct: 427 -------DGHLRTRPDLIAD----AGGMDGFYAARFTR 453


>gi|159045573|ref|YP_001534367.1| ribosomal RNA small subunit methyltransferase B [Dinoroseobacter
           shibae DFL 12]
 gi|157913333|gb|ABV94766.1| ribosomal RNA small subunit methyltransferase B [Dinoroseobacter
           shibae DFL 12]
          Length = 443

 Score =  237 bits (604), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 140/366 (38%), Positives = 210/366 (57%), Gaps = 21/366 (5%)

Query: 81  SLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQ 140
           ++  +LR+   ++  L  A + VV  AV+ A+ +        LVN++LR+V+ +    L 
Sbjct: 78  AIHNILRLGAYELCALGEAPHGVVHAAVDLARAEDPQSRAPGLVNAVLRKVA-DLGPALW 136

Query: 141 RIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET--WAHKLNAVML 198
             A  + +P+ F++ L   +G + V+    A  +   +DLT++   E   WA +L AV+L
Sbjct: 137 AAAPPAQLPKPFRKGLVKVWGNKTVIGFEAAHGAGAPLDLTLRDPSEAALWADRLGAVVL 196

Query: 199 PTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ 258
           PTGG+RL +  + +  LPG+AEG WWVQDA+AS+P +  G +    VLDLCAAPGGKT Q
Sbjct: 197 PTGGLRLSDAGQ-VSQLPGYAEGAWWVQDAAASLPARALGPVVGARVLDLCAAPGGKTLQ 255

Query: 259 LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSS 318
           L  +GA+VTALD+S  R+ +LR NL R  L AE +I  D   Y  +  FDA+L+DAPCS+
Sbjct: 256 LAAAGAQVTALDISDARVARLRENLARTGLAAEVVI-ADGLTYAAETPFDAILLDAPCSA 314

Query: 319 TGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQ 378
           TGTIRRHPD+ + RD  D+      Q  LL + +  ++PGG +VF+ CSL   + E+ V 
Sbjct: 315 TGTIRRHPDLPFLRDLSDLSDLTALQAGLLDRAVGLLRPGGRLVFATCSLLPAEGEDQVA 374

Query: 379 KVLRSSP----IPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
             L   P    +P+  +  ++A W        L+  G +R+ PD   +      G+DGFF
Sbjct: 375 AALARHPGLAQVPLSDLAGSAAEW--------LTDTGALRLRPDFWAE----RGGLDGFF 422

Query: 435 AVALRR 440
             AL +
Sbjct: 423 IAALAK 428


>gi|254450298|ref|ZP_05063735.1| rRNA methyltransferase RsmB [Octadecabacter antarcticus 238]
 gi|198264704|gb|EDY88974.1| rRNA methyltransferase RsmB [Octadecabacter antarcticus 238]
          Length = 410

 Score =  236 bits (602), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 148/412 (35%), Positives = 222/412 (53%), Gaps = 25/412 (6%)

Query: 34  GDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQI 93
           G+ A + LS  D+   + +   TLR L R D +L   L  + P    S++ +LR+   ++
Sbjct: 17  GEGALQHLSPEDRARAQRLTTETLRGLARADRMLARFLAKTPP---LSVRNVLRLCTVEL 73

Query: 94  LYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFK 153
              + A + VV+  VE   R +       LVN++LR+V+ E  E   ++     +P W +
Sbjct: 74  AGGEAA-HGVVNAGVEMVARSQRTSSMKGLVNAVLRKVAAEGPEGWAQLV-TPRLPGWLR 131

Query: 154 ERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIV 213
             L++ YG + V AI  A  +   +D+T K D       L   +LPTG IRL++  + + 
Sbjct: 132 SPLKDAYGPDVVAAIEVAQFAGAPLDITAKGDPNAANETLKGEILPTGTIRLRDAGQ-VS 190

Query: 214 SLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSK 273
           +LPGF  G WWVQDA+A+IPVQ+    +   +LDLCAAPGGKT QL  SGA VTA+D S+
Sbjct: 191 TLPGFETGDWWVQDAAAAIPVQILAPQSGEKILDLCAAPGGKTMQLAASGADVTAVDSSE 250

Query: 274 RRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
            R+ ++  NL R  L A   I  DAF +     FDAVL+DAPCS+TGTIRRHPD+ + +D
Sbjct: 251 GRMIRVGENLKRTGLSAT-TITADAFAFTDGG-FDAVLLDAPCSATGTIRRHPDLPYAKD 308

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVP 392
             +       Q +++   +S +KPGG +VF  CSL   + E  V++ L R + + V+   
Sbjct: 309 GSEFGILIHQQERMIDHALSLLKPGGRLVFCTCSLLPDEGEVQVEEALARHAGLTVDASA 368

Query: 393 LNSAY----WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           ++ A     W++ D  + L P+ W                GMDGF+   LR+
Sbjct: 369 IDRAGIDPDWRTEDGGLRLRPDYWAD------------KGGMDGFYIAQLRK 408


>gi|302381615|ref|YP_003817438.1| Fmu (Sun) domain protein [Brevundimonas subvibrioides ATCC 15264]
 gi|302192243|gb|ADK99814.1| Fmu (Sun) domain protein [Brevundimonas subvibrioides ATCC 15264]
          Length = 463

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 162/444 (36%), Positives = 238/444 (53%), Gaps = 29/444 (6%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR+ +  LL+  + +R  L   + L     A   L   D+   RA+    LR L  I
Sbjct: 43  GVEARIAAGILLNAALERRNGLDEAMSL----PAVAALPGPDRAFARAVAMAALRRLGEI 98

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D +L+  L  S P    +++ LLR+S+AQ L L    +A V  AV+ A+RD + R +  L
Sbjct: 99  DHILNQRLQKSPPE---AVRTLLRISLAQTLVLGTPAFAAVSTAVKLAERDAKTRPYKAL 155

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN++LR V RE   L       S +P+W   R    YG   + AI+ A       DL++K
Sbjct: 156 VNAVLRGVEREGPGL---TTAESNLPDWIAARWRQAYGPATLAAIALAAREEPPTDLSLK 212

Query: 184 --FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              D    A  L A +LP G +R   +   + + PG+  G WW+QDA+A+IP ++     
Sbjct: 213 PGEDAAALAEALEATVLPGGTVR-SGVRGDVSAWPGYDAGGWWIQDAAAAIPARMLAPKA 271

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             + LD+CAAPGGKT QL  SGA V ALD S+ RL +LR NL+R  L  E I+   A D+
Sbjct: 272 GETALDMCAAPGGKTLQLAASGASVVALDRSEARLRRLRQNLERTGLSVE-IVVTAAEDW 330

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDAVL+DAPC++TGT+RR+P+VL      ++ K A  Q +LL      V PGG +
Sbjct: 331 DDPRTFDAVLLDAPCTATGTLRRNPEVLRATKPAEVAKLADVQHRLLDAAALRVAPGGRL 390

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSP----IPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           V+  CSL++++ E  V   LR +P    +P ++  + +        A AL+PEGW+R+ P
Sbjct: 391 VYCVCSLEREEGETQVIAFLRRNPDFRTVPADVAAVGAP-------AEALTPEGWLRVLP 443

Query: 418 DMLEKIDGVSSGMDGFFAVALRRL 441
               +      G+DGFF   L+R+
Sbjct: 444 SYWPE----QGGLDGFFIAGLQRV 463


>gi|197106963|ref|YP_002132340.1| rRNA methyltransferase RsmB [Phenylobacterium zucineum HLK1]
 gi|196480383|gb|ACG79911.1| rRNA methyltransferase RsmB [Phenylobacterium zucineum HLK1]
          Length = 598

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 160/414 (38%), Positives = 217/414 (52%), Gaps = 21/414 (5%)

Query: 31  LEYG--DSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRV 88
           LE G    A   L+ RD+   RA+    LR L  IDA L   L    P +   + Q+LR+
Sbjct: 201 LEEGLTHPALGRLAPRDRAFARALAMAALRHLGPIDAALQARLRKPPPDR---IVQVLRL 257

Query: 89  SVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISII 148
             AQ+L L    +A V   V+ A   K  + F  LVN++LR +SRE  +L        + 
Sbjct: 258 GAAQLLVLKTPAHAAVSATVDLAASQKGGQAFKGLVNAVLRGLSREPPDLSDPDL---LA 314

Query: 149 PEWFKERLENFYGKERVLAISDACISPLYIDLTVK--FDIETWAHKLNAVMLPTGGIRLK 206
           P+W   R    +G E   A++         D+T K   D E     L   +LP G +R  
Sbjct: 315 PQWLAARWRAAFGPEAARAMAAMVADEPATDVTPKDSADAEALGQMLEGRVLPGGSVRAG 374

Query: 207 ELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV 266
            L   + + PGFAEG WWVQDASA+IP +L     + + LDLCAAPGGKT QL  +GA+V
Sbjct: 375 -LKGEVQAWPGFAEGRWWVQDASAAIPARLLAVKADETALDLCAAPGGKTLQLAAAGARV 433

Query: 267 TALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHP 326
           TA+D +  RL+++  NL R  L AE +++ DA ++  ++ FDAVL+DAPCS+TGT RRHP
Sbjct: 434 TAVDKAAGRLKRVSENLARTGLSAE-VVQADAAEWPDRRRFDAVLLDAPCSATGTYRRHP 492

Query: 327 DVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPI 386
           DVLW     DI K A  Q +LL      VK GG +V+  CSL+ ++ E  V+  L+ SP 
Sbjct: 493 DVLWVASPADIPKLATLQARLLDAAARRVKAGGRLVYCVCSLEPEEGEAQVEAFLKRSP- 551

Query: 387 PVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             E  P      +      +  P G +RI P  L+       G DGFF   LRR
Sbjct: 552 --EFAPEPVEPGEGGAPEASRLPNGTLRILPHHLD------GGTDGFFIARLRR 597


>gi|310816801|ref|YP_003964765.1| ribosomal RNA small subunit methyltransferase B, putative
           [Ketogulonicigenium vulgare Y25]
 gi|308755536|gb|ADO43465.1| ribosomal RNA small subunit methyltransferase B, putative
           [Ketogulonicigenium vulgare Y25]
          Length = 417

 Score =  234 bits (597), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 151/408 (37%), Positives = 220/408 (53%), Gaps = 32/408 (7%)

Query: 38  FRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD 97
           F  LS  D+   + +    LR   R D  L   L     R    +Q  LR+ V +I    
Sbjct: 32  FDPLSPPDRARAQRLATSVLRAASRADRWLKPHLKK---RPPVQVQNALRLGVVEIAE-G 87

Query: 98  VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI--IPEWFKER 155
            A + VV+  V      K   +FA L N++LR+ +    +L Q+   +++  +P+W +E 
Sbjct: 88  AAPHGVVNDIVTLLADGKRTANFAALANAVLRKGA----DLPQQWGKLALPQLPDWLREP 143

Query: 156 LENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVS- 214
           L   +G   + AI  A      +DLT+  D   WA +L  ++LPTG +RL      +VS 
Sbjct: 144 LREAWGNSAINAIERAHFRGAPLDLTIPRDTADWAARLGGLVLPTGSVRLDG--HGMVST 201

Query: 215 LPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKR 274
           LPGFAEG WWVQDA+A++PV+L G L     LD+CAAPGGKT QL  +GA+VTALD+S  
Sbjct: 202 LPGFAEGAWWVQDAAAALPVRLLGDLRGQRALDICAAPGGKTMQLASAGAEVTALDLSAN 261

Query: 275 RLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           RL+++  NL R +L A  I++ DA ++     +D +++DAPCS+TGTIRRHPD+ + RD 
Sbjct: 262 RLQRVAENLARTNLNAT-IVQGDALEFTTTG-WDVIVLDAPCSATGTIRRHPDLPFARDG 319

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP----IPVEL 390
            +I      Q +++   +  + PGG ++F  CSL   + E  V++ L   P    IP EL
Sbjct: 320 AEIGSLIALQAQMIDHALRLLNPGGRLLFCTCSLLPDEGEVQVEEALARHPGLRVIPPEL 379

Query: 391 VPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
            P   A W        +SPEG +R+ PD    +     GMDGF+   L
Sbjct: 380 -PEIEADW--------ISPEGGVRLRPDYWPSL----GGMDGFYMAVL 414


>gi|294010239|ref|YP_003543699.1| tRNA/rRNA cytosine-C5-methylase [Sphingobium japonicum UT26S]
 gi|292673569|dbj|BAI95087.1| tRNA/rRNA cytosine-C5-methylase [Sphingobium japonicum UT26S]
          Length = 429

 Score =  233 bits (594), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 230/443 (51%), Gaps = 27/443 (6%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR  +  LL  V+R+   L   L       A + L+  D+ LV AI   TLR LP +
Sbjct: 12  GLPARRAALRLLDAVLRRGDPLELALH-----GAAQGLAPADRALVHAIAAETLRHLPDL 66

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           DA++D      LP    + + +LR+++ Q+L L  A +A +  A+     D   R   KL
Sbjct: 67  DALIDGATRQPLPHDAKA-RMVLRIALIQVLALGTAPHAAIATALPLV--DGGPR---KL 120

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           V+ +   ++R    L    A    +P     R    +G     A + A      +D++++
Sbjct: 121 VHGVFGTLTRADPTLPSPPA----LPPETAGRWAAQWGDAMPQAAAHAYAQRPPVDVSLR 176

Query: 184 FDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
               T  WA  LN   L  G +RL E    I  LPGF EG WWVQD +AS P +L G   
Sbjct: 177 DPARTAHWAEALNGRSLAPGHVRLPEG-AVIPDLPGFGEGAWWVQDLAASTPARLLGAGE 235

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              VLDLCAAPGGKT QL  +G +VTA+D SK+RLE+L  NL R  L A  I++ D   +
Sbjct: 236 GRCVLDLCAAPGGKTMQLAAAGWRVTAVDQSKKRLERLSENLARTGLSAA-IVQDDLRAW 294

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P+   DAVL+DAPC++TG  RRHPDVL       I + A  Q +LL +  +++KPGG +
Sbjct: 295 RPEAPADAVLLDAPCTATGIYRRHPDVLHRIGPRQIAEMAELQAELLARAAAWLKPGGTL 354

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V++ CSL++ + E+ V + L + P   +  PL  A    +   +A + +GW+R  PD+L 
Sbjct: 355 VYATCSLEQAEGEDQVARFLDARP---DFGPL-PAMPAELPDGIAPAAQGWVRTLPDIL- 409

Query: 422 KIDGVSSGMDGFFAVALRRLIQP 444
                  G DGFF   L R  +P
Sbjct: 410 ---AAQGGTDGFFVARLIRSTKP 429


>gi|330993136|ref|ZP_08317074.1| Ribosomal RNA small subunit methyltransferase B [Gluconacetobacter
           sp. SXCC-1]
 gi|329759906|gb|EGG76412.1| Ribosomal RNA small subunit methyltransferase B [Gluconacetobacter
           sp. SXCC-1]
          Length = 395

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 149/412 (36%), Positives = 214/412 (51%), Gaps = 25/412 (6%)

Query: 31  LEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSV 90
           LE+  +A R    RD+     +    LR +   + VL   L    P     ++ +L + V
Sbjct: 6   LEH-SAAARTAEPRDRAAAHRLAATVLRHMGTANEVLAPFLKREPPEP---VRVVLLIGV 61

Query: 91  AQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI-IP 149
           AQ+L+LD   +A V  +V  A+R +    FA LVN++LRRV+    + L+ +    + +P
Sbjct: 62  AQLLFLDTPPHAAVATSVALARR-RGLVPFAGLVNAVLRRVAAGGAQALEGLDQPRLDVP 120

Query: 150 EWFKERLENFYGK-ERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKEL 208
            W    L   +G+  R +A +     PL  DLT++   E         ++P G +R    
Sbjct: 121 PW----LWQSWGRLARPIATALGHEPPL--DLTIRPGGEP---PPGGELMPGGSVRFAAG 171

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTA 268
              +  LPGFAEG WWVQD +AS+P +L        V DLCAAPGGKTAQL  +GA+V A
Sbjct: 172 TAKVADLPGFAEGAWWVQDMAASLPARLLDVKPGERVADLCAAPGGKTAQLACAGAEVFA 231

Query: 269 LDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDV 328
           ++   RR+E+LR NL RL L    +I  DA  + P+   DA+L+DAPCS+TGTIRRHPD 
Sbjct: 232 IEREGRRIERLRANLARLGLGGVHVIHADAATWRPEMPLDAILLDAPCSATGTIRRHPDA 291

Query: 329 LWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPV 388
           +W +   DI      Q +LL      ++PGG +V++ CSL  ++ E+  +       I  
Sbjct: 292 MWIKRPRDIATMTEGQDRLLAAARDMLRPGGRLVYAVCSLQPEEGEQRARAAEALGLIAD 351

Query: 389 ELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              P   A+     +  A +PEGW+R  P ML    G   GMDGFFA    R
Sbjct: 352 PFTPDELAF-----LPQARTPEGWLRTHPGML----GARGGMDGFFAARFHR 394


>gi|126736247|ref|ZP_01751990.1| rRNA methyltransferase RsmB [Roseobacter sp. CCS2]
 gi|126714413|gb|EBA11281.1| rRNA methyltransferase RsmB [Roseobacter sp. CCS2]
          Length = 424

 Score =  233 bits (594), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 154/444 (34%), Positives = 241/444 (54%), Gaps = 29/444 (6%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           ++G+ AR  + HLL  +  +   +  L+    G  A   L   D+   + +   TLR L 
Sbjct: 3   QTGLPARRSAHHLLMQITGEGRLMAELI----GGGALARLENDDRARAQRLATETLRGLD 58

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R D +L   L  + P     +   LR+ V ++   + A + VV+  VE   R+K  +   
Sbjct: 59  RADRMLKPYLKKTPPDH---VMNALRLGVIELCSGEAA-HGVVNAYVEIVARNKRTQAMK 114

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            L N++LR+++ E  E   + A I + P W ++ L   +G++ V A+  A  +   +DL+
Sbjct: 115 GLTNAVLRKIAAEGPEGWNKRA-IPLTPGWLRQPLVAAWGRDAVAAMEAAHFAGAPLDLS 173

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D    A  L+  +LPTG +RL+   + + +L G+A G WWVQDA+A+IPV+L G + 
Sbjct: 174 VKVDAAAVAKALDGTVLPTGSVRLQNAGQ-VSTLKGYATGDWWVQDAAAAIPVKLLGDVT 232

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
            L VLDLCAAPGGK  QL   GA+VTA+D+S++R+E++  NL R+ L A D +  DAF +
Sbjct: 233 GLKVLDLCAAPGGKAMQLAALGAQVTAVDISEKRMERIGENLTRVGLKA-DCVVSDAFTF 291

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
             +  FDAVL+DAPCS+TGTIRRHPD+ + +D  +       Q  ++   ++ +KPGG +
Sbjct: 292 -EQDGFDAVLLDAPCSATGTIRRHPDLPYAKDGSEFGALIDQQEAMIDHALTLLKPGGRL 350

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSP---IPVELVPLNSAY--WKSIDMAMALSPEGWIRIT 416
           VF  CSL   + E   ++ L   P   I  + + +N     W        ++ EG +R+ 
Sbjct: 351 VFCTCSLLPDEGEVQAEEALARHPGLTIDADALRINGVNPDW--------ITDEGGLRLR 402

Query: 417 PDMLEKIDGVSSGMDGFFAVALRR 440
           PD    I     GMDGF+   +R+
Sbjct: 403 PDYWADI----GGMDGFYMAVMRK 422


>gi|126727795|ref|ZP_01743625.1| ribosomal RNA small subunit methyltransferase B, putative
           [Rhodobacterales bacterium HTCC2150]
 gi|126702922|gb|EBA02025.1| ribosomal RNA small subunit methyltransferase B, putative
           [Rhodobacterales bacterium HTCC2150]
          Length = 423

 Score =  232 bits (592), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 158/439 (35%), Positives = 226/439 (51%), Gaps = 35/439 (7%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR  +  L+  V+  +  LT L       S FR L   D+     +   TLR + 
Sbjct: 8   KEGLIARRAAVRLIDEVLENQRPLTDLT------SNFRALPAADKARAMRLAMTTLRNVG 61

Query: 62  RIDAVLDFVLISSLPRKKY-SLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           R D VL    I  L +    ++  +LR++V +I +    DYAVVD AV   ++ + + HF
Sbjct: 62  RADQVL----IPYLRKPPLGTVMNILRLAVTEICHEGAQDYAVVDSAVAMTRKLRNSSHF 117

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           A LVN++LR+V+R+      +     + P+W +  L   YG + + +I  A  +P  +DL
Sbjct: 118 AGLVNAVLRKVARDGQAAWDKETDTEL-PDWIRLPLIKAYGMKGIESIEAAHAAPPPVDL 176

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           T K         L   MLP G +RL +  + I  LPGF  G WWVQDA+A+ PV      
Sbjct: 177 TFK---NAPTEGLVGEMLPNGSMRLSDSGQ-ISILPGFETGDWWVQDAAATYPVLALAAQ 232

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               VLD+CAAPGGKT Q+  SGA VTA+D S  RL+ +  NL R  L AE ++  DAFD
Sbjct: 233 KGERVLDMCAAPGGKTMQMAASGAHVTAVDQSAERLKLVHENLARTGLDAE-VVVADAFD 291

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
              +  +DA+L+DAPCS+TGT+RRHPD+ + +D  D+      Q ++L   ++ +KPGG 
Sbjct: 292 LT-EGGYDAILLDAPCSATGTLRRHPDLPFVKDGKDVGAIVALQGRMLDHALTLLKPGGR 350

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS-----AYWKSIDMAMALSPEGWIRI 415
           +V+  CSL  Q+ E  VQ  L        L P  S       W+        + EG  R+
Sbjct: 351 IVYCTCSLFPQEGEIQVQTALERHKGLKVLEPDTSIGGLDPKWR--------TSEGGYRL 402

Query: 416 TPDMLEKIDGVSSGMDGFF 434
            PD          GMDGF+
Sbjct: 403 RPDFWAD----KGGMDGFY 417


>gi|255261461|ref|ZP_05340803.1| rRNA methyltransferase RsmB [Thalassiobium sp. R2A62]
 gi|255103796|gb|EET46470.1| rRNA methyltransferase RsmB [Thalassiobium sp. R2A62]
          Length = 425

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 148/439 (33%), Positives = 231/439 (52%), Gaps = 18/439 (4%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           ++G   R  + HLL  ++ +   ++ L+    G  A + L   D    + +   TLR L 
Sbjct: 3   QTGYAPRRAAVHLLDQIIDEGRLMSELI----GGGALKHLDAGDTARAQRLTVETLRGLD 58

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R D +L   L     +   ++  +LR+   +I     A + VV+ AVE   + +      
Sbjct: 59  RADRMLKPFLKR---KPGGTVMNVLRLGTVEICAEGAAAHGVVNSAVEIVSKSQRTSAMK 115

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRRV+ +  E   R+  +  +  W +  L + YG++ V A+  A  +   +DL+
Sbjct: 116 GLVNAVLRRVAEQGSEKWNRLP-VPKLANWLRSPLVDGYGRKTVEAMEAAHFAGAPLDLS 174

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK DI   A  +  V+LPTG +RL +  + +  L GF  G WWVQDA+A+IP ++    +
Sbjct: 175 VKGDIAAVAEAVGGVVLPTGSVRLSDYGQ-VSKLAGFEAGDWWVQDAAAAIPARILAPQS 233

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              VLD+CAAPGGKT Q    GA+VTALD+S RR+ ++  NL R  L AE I+  DA D+
Sbjct: 234 GERVLDMCAAPGGKTMQAAAMGAQVTALDLSDRRMARVSENLSRTGLDAE-IVVGDALDF 292

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
             +  +DA+L+DAPCS+TGT+RRHPD+   +D  +       Q   L   +S +KPGG +
Sbjct: 293 S-EGGWDAILLDAPCSATGTLRRHPDLPLAKDGSEFGNLIDMQGAFLDHALSLLKPGGRL 351

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VF  CSL   + E  + + L   P  +  V  ++   + +D A   + EG +R+ PD   
Sbjct: 352 VFCTCSLLPDEGEVQIDEALERHPDLI--VDRDAVLVQGVDSAWQ-TQEGGLRLRPDYWA 408

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G+DGF+   LR+
Sbjct: 409 D----QGGIDGFYMACLRK 423


>gi|85375086|ref|YP_459148.1| tRNA and rRNA cytosine-C5-methylase [Erythrobacter litoralis
           HTCC2594]
 gi|84788169|gb|ABC64351.1| tRNA and rRNA cytosine-C5-methylase [Erythrobacter litoralis
           HTCC2594]
          Length = 415

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 156/440 (35%), Positives = 236/440 (53%), Gaps = 36/440 (8%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G++AR  +  +L  V+R+  +L    +   G +  ++ S  D+ L RAI N TLR+L  
Sbjct: 5   TGIHARRAALQMLDAVLRRGETL----EQAEGAALRQVRSAPDKALARAIANETLRWLTD 60

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            DA++D      LP    + + +LR+ +AQ L L+   +AV+   +             +
Sbjct: 61  FDALIDSATKQRLPDDAKA-RTVLRLMLAQWLRLETPPHAVIATGLPLLAGGPR-----R 114

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L + +   ++++++    R+     +P   +ER    +G +R   I+     P  +DLT+
Sbjct: 115 LAHGVFSTLTKKEV----RLPAAPTLPVRVRER----WG-DRADEIAAGLAEPPPLDLTL 165

Query: 183 KFDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           +   ET  WA++L A     G +RL     ++ +L GF EG WWVQD +ASIP +L G  
Sbjct: 166 RDAGETQHWANQLAADSYAPGHLRLPR-GSAVETLAGFREGAWWVQDLAASIPARLLGPG 224

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               VLDLCAAPGGKT QL  +G KVTALD+SKRRL  L+ NL R +L A   +  DA  
Sbjct: 225 EGRHVLDLCAAPGGKTLQLAAAGWKVTALDISKRRLGLLKDNLTRTNLKA-STVRADALA 283

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + PK  FDA+L+DAPC++TGT RRHPDVL       I + +  Q  LL +   ++KPGG 
Sbjct: 284 WEPKHHFDAILLDAPCTATGTCRRHPDVLHRIGPRQIGEMSELQAALLGRAQGWLKPGGT 343

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V++ CSL++++ +    KV+  +P PV    L S         +  S EGW+R  P ML
Sbjct: 344 LVYAVCSLEEEEGKVQAAKVV-LTPEPVAPGELPS--------GLMPSDEGWVRTHPGML 394

Query: 421 EKIDGVSSGMDGFFAVALRR 440
                   G+DGFF    R+
Sbjct: 395 ----CTQGGLDGFFIARWRK 410


>gi|85703964|ref|ZP_01035067.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius sp. 217]
 gi|85671284|gb|EAQ26142.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius sp. 217]
          Length = 422

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 157/444 (35%), Positives = 235/444 (52%), Gaps = 29/444 (6%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K  + AR  + HLL  V+ +   ++ L+       A   LS  D+   + +   TLR L 
Sbjct: 3   KPTLTARSAAVHLLDRVLGEGRLMSELI----AGGALDALSPPDRARAQRLATDTLRGLD 58

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R D +L   L  + P     +Q +LR++  + L      + VV+ AVE   +   +    
Sbjct: 59  RADLLLSRHLRKAPP---LPVQNVLRLATVE-LAQGGESHGVVNEAVETIGQSPRHAKLK 114

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LR+++ E       +  +  +P W +  L + +GK  V A+  A  +   +D+T
Sbjct: 115 GLVNAVLRKMTEEAPRSWNDLR-LPNLPTWLRAPLVDAWGKGPVAAMERAHFAGAPLDIT 173

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +L A +LPTG +R  + P  + +LPG+A G WWVQD +A++PV +     
Sbjct: 174 VKSDPEVWAERLGATLLPTGSLRRTD-PGQVSALPGYANGEWWVQDVAAALPVAVLAPKP 232

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              +LDLCAAPGGKT Q+  +GAKVTALD+S+RR+ ++  NLDR  L A  I+  DA D+
Sbjct: 233 GEQILDLCAAPGGKTLQMAAAGAKVTALDLSERRMARVTENLDRTGLTATCIVG-DALDH 291

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
                +DA+L+DAPCS+TGTIRRHPD+   +D  D       Q  +L   ++ +KP G +
Sbjct: 292 H-GGPYDAILLDAPCSATGTIRRHPDLPHAKDGSDFGALIALQAAMLDHALTLLKPEGRL 350

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSP-IPVE----LVPLNSAYWKSIDMAMALSPEGWIRIT 416
           VF  CSL   + E  V++ L   P + V+    L P     W        ++ EG +R+ 
Sbjct: 351 VFCTCSLLPDEGECQVEEALGRHPDLTVDRTTLLRPGIEPGW--------VTEEGGLRLR 402

Query: 417 PDMLEKIDGVSSGMDGFFAVALRR 440
           PD    +     GMDGFF   LRR
Sbjct: 403 PDYWADL----GGMDGFFIACLRR 422


>gi|83941724|ref|ZP_00954186.1| ribosomal RNA small subunit methyltransferase B, putative
           [Sulfitobacter sp. EE-36]
 gi|83847544|gb|EAP85419.1| ribosomal RNA small subunit methyltransferase B, putative
           [Sulfitobacter sp. EE-36]
          Length = 423

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 147/443 (33%), Positives = 237/443 (53%), Gaps = 30/443 (6%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR  + +LL  ++ +   ++ LL       A   L   D+   + +   TLR + R
Sbjct: 4   TGVQARRSAVYLLDMILGEERLMSELLSA----GALDKLPPDDRARAQRLAMDTLRGMER 59

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D +L   L    P    +++  LRV   ++     A + VV+  VE     K+  H   
Sbjct: 60  ADRLLQKHLSKYPP---LTVRNALRVGTVELCQGGAA-HGVVNAMVELVATHKKLGHLKG 115

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L N++LR+++ E  E    +    + P+W +  L   +G + +  I  A  +   +DLT 
Sbjct: 116 LTNAVLRKIAAEGPEAWAALRAPRL-PKWLRGPLTEAWGPDAMTGIEAAHFAGAPLDLTA 174

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D E  A  +   +LPTG +R+ +  + + ++PGFAEG WWVQDA+A++PV++      
Sbjct: 175 KRDPEGLAAAVGGTVLPTGSVRVADAGQ-VTTMPGFAEGDWWVQDAAAALPVKILAPQKG 233

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            +VLDLCAAPGGKT QL  +GA+VTA+D SK+R++++R NL R+HL A+ ++ +DA  + 
Sbjct: 234 EAVLDLCAAPGGKTMQLAAAGAQVTAVDNSKQRMQRVRENLARVHLPAK-VVVVDARRF- 291

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
            +  FDA+L+DAPCS+TGTIRRHPD+   +D  +       Q +++    S + PGG ++
Sbjct: 292 -EGTFDAILLDAPCSATGTIRRHPDLPHAKDGSEFGDLIELQSEMIDHAWSLLNPGGRLI 350

Query: 363 FSNCSLDKQDSEEVVQKVL-RSSPIPVE----LVPLNSAYWKSIDMAMALSPEGWIRITP 417
           F  CSL   + E  V + L R + + V+     VP     W +         EG +R+ P
Sbjct: 351 FCTCSLLPDEGEVQVDEALERHADMRVDRDALAVPGVDPAWTTQ--------EGGLRLRP 402

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
           D   ++     GMDGF+   LR+
Sbjct: 403 DYWPEL----GGMDGFYIACLRK 421


>gi|254486947|ref|ZP_05100152.1| rRNA methyltransferase RsmB [Roseobacter sp. GAI101]
 gi|214043816|gb|EEB84454.1| rRNA methyltransferase RsmB [Roseobacter sp. GAI101]
          Length = 423

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 151/439 (34%), Positives = 237/439 (53%), Gaps = 22/439 (5%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR  + +LL  ++ +   ++ LL     D     L   D+   + +   TLR + R
Sbjct: 4   TGVQARRSAVYLLDMILGEERLMSELLAAGVLDK----LPPDDRARAQRLALDTLRGMER 59

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D +L   L    P    +++  LRV   ++     A + VV+  VE     K+  H   
Sbjct: 60  ADRLLQKHLSKYPP---LTVRNALRVGTVELCQGGAA-HGVVNAMVELVATHKKLGHLKG 115

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L N++LR+++ E  E    +    + P+W +  L   +G E +  I  A  +   +DLT 
Sbjct: 116 LTNAVLRKIAAEGPEAWAALRSPRL-PKWLRGPLVEAWGAEAITGIEAAHFAGAPLDLTA 174

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D    A  +   +LPTG +R+ +  + + ++PGFAEG WWVQDA+A++PV++      
Sbjct: 175 KGDPAVLAEAVGGSVLPTGSVRVMDAGQ-VTAMPGFAEGDWWVQDAAAALPVKILAPQKG 233

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            +VLDLCAAPGGKT QL  +GA+VTA+D SK R+++++ NL R+HL A+ ++ MDA  + 
Sbjct: 234 EAVLDLCAAPGGKTMQLAAAGAQVTAVDSSKPRMQRVKENLARVHLPAKTVV-MDARAFE 292

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
            K  F A+L+DAPCS+TGTIRRHPD+   +D  +  +    Q +L+    S + PGG +V
Sbjct: 293 GK--FSAILLDAPCSATGTIRRHPDLPHAKDGSEFGELIELQAELIDHAWSLLNPGGRLV 350

Query: 363 FSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           F  CSL   + E  V + L R S + V+   L+      ID +  +S EG +R+ PD   
Sbjct: 351 FCTCSLLPDEGEVQVDEALERHSDMSVDQSALSV---PGIDPSW-ISSEGGLRLRPDYWA 406

Query: 422 KIDGVSSGMDGFFAVALRR 440
            +     GMDGF+   LR+
Sbjct: 407 DL----GGMDGFYIACLRK 421


>gi|114799841|ref|YP_762041.1| putative ribosomal RNA small subunit methyltransferase B
           [Hyphomonas neptunium ATCC 15444]
 gi|114740015|gb|ABI78140.1| putative ribosomal RNA small subunit methyltransferase B
           [Hyphomonas neptunium ATCC 15444]
          Length = 423

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 155/447 (34%), Positives = 228/447 (51%), Gaps = 31/447 (6%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           SG   RL +  LL+ V+ K+ +L    D    D A+  L   D+   RAI +  LR L  
Sbjct: 2   SGAPIRLAAGRLLNLVLDKKRTLD---DALATDDAYNNLDGSDRAFARAIASSALRHLGW 58

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ID  +   L   L      ++ L+R   AQI ++DV  +A V   VE A+     R    
Sbjct: 59  IDRGVSPFLSRPLSATGAEIRALIRAGAAQIWFMDVPHHAAVSETVEAARLWSPARSGGG 118

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
            +N+ LRRV+ E       I+ +++ P+W   RL + YG+E   A++ + +    + L+ 
Sbjct: 119 FLNAALRRVT-ESESPAATISPLALWPDWLASRLGSAYGREAAEALALSQLEEPSLHLSP 177

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D    A      +LP G I +  +  ++ +LPG+A G WWVQDA+A IP QL      
Sbjct: 178 KGDGARVAEATGGTLLPDGAIDI--VSGAVETLPGYAAGDWWVQDAAARIPAQLLSPQTG 235

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             +LDLCAAPGGKT QL  +GA VTALD S+ RLE+L+ NL R  L+AE II  D   + 
Sbjct: 236 ERILDLCAAPGGKTLQLAAAGADVTALDRSRPRLERLKENLARTGLHAEVII-ADGEAWA 294

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P  LF  +L+DAPCS+ GT+RRHP+  W +  DD+ +    Q +LL      + PGG +V
Sbjct: 295 PPALFPKILLDAPCSALGTLRRHPESAWIKTEDDVARFPGVQARLLAAAAGMLAPGGTLV 354

Query: 363 FSNCSLDKQDSEEVVQK-----VLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           +  C+    +  ++V+      +L  SP+  E +P             AL+P G      
Sbjct: 355 YCVCTPVPAEGVDIVEAAIGKGILTRSPVKAEEIP---------GFEAALTPAG------ 399

Query: 418 DMLEKIDGVSSGMDGFFAVALRRLIQP 444
           D+L  + G     D F+   + RLI+P
Sbjct: 400 DVL-TLPGTGGKHDAFY---IARLIKP 422


>gi|84515082|ref|ZP_01002445.1| ribosomal RNA small subunit methyltransferase B, putative
           [Loktanella vestfoldensis SKA53]
 gi|84511241|gb|EAQ07695.1| ribosomal RNA small subunit methyltransferase B, putative
           [Loktanella vestfoldensis SKA53]
          Length = 422

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 145/443 (32%), Positives = 232/443 (52%), Gaps = 29/443 (6%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           +SG+  R  + HLL  +  +   +  L+       A   L+  D+   + +    LR L 
Sbjct: 3   QSGLLPRRSAHHLLMQITTEGRLMAELI----AGGALAQLAPDDRARAQRLATDALRGLD 58

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R D +L   L    P   + +  L R+ + +++  + A + VV+  VE   R+   +   
Sbjct: 59  RADRMLKPYLKK--PPGDHVMNAL-RLGLTELMQGEAA-HGVVNAYVEIVARNTRTQSMK 114

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            L N++LRR++ E  E   + A + + P W ++ L   +G++ V  +  A  +   +DLT
Sbjct: 115 GLTNAVLRRIADEGPEAWAKRA-VPLTPGWLRQPLVAAWGRDAVTGMEAAHFAGAPLDLT 173

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
            K D    A  L  V+LPTG +RL +  + +  L G+  G WWVQDA+A++PV+L G + 
Sbjct: 174 AKGDPAGLATALGGVVLPTGTVRLAQAGQ-VSGLAGYDAGDWWVQDAAAALPVKLLGDVT 232

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
            L VLDLCAAPGGKT QL   GA VTA+D+S++R+ +L  NL R  L A  ++  DAF  
Sbjct: 233 GLRVLDLCAAPGGKTLQLAAGGADVTAVDLSEKRMTRLTENLARTGLAATTLVS-DAFAL 291

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
                +DAVL+DAPCS+TGTIRRHPD+ + +D  +       Q +L+   +S ++PGG +
Sbjct: 292 TTGG-YDAVLLDAPCSATGTIRRHPDLPYAKDGSEFGALIAQQERLIDHALSLLRPGGRL 350

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPI----PVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           V+  CSL   + E  +++ L   P     P  +  ++ A+         ++ EG +R+ P
Sbjct: 351 VYCTCSLLPDEGEVQIEEALARHPGLRVEPPMMAGVDPAW---------ITEEGGLRLRP 401

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
           D    +     GMDGF+   L +
Sbjct: 402 DYWPDL----GGMDGFYIAVLTK 420


>gi|126730443|ref|ZP_01746254.1| ribosomal RNA small subunit methyltransferase B, putative
           [Sagittula stellata E-37]
 gi|126709176|gb|EBA08231.1| ribosomal RNA small subunit methyltransferase B, putative
           [Sagittula stellata E-37]
          Length = 413

 Score =  224 bits (570), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 140/398 (35%), Positives = 218/398 (54%), Gaps = 29/398 (7%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           L+  D+   + +    LR L R D VL   L  +       +  +LR+   ++     A 
Sbjct: 34  LAAPDRAAAQRLATEVLRGLERADRVLKPHLRKA---PAGRVMNILRLGATELCTGGAA- 89

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFY 160
           + VV   VE A R K  +    L N++LR+V+        ++  +  +P+W +  L   +
Sbjct: 90  HGVVSDCVEIAARGKRTQGAKGLANAVLRKVAESGPADWAKLR-VPRLPKWLRAPLAEAW 148

Query: 161 GKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAE 220
           G + V A+  A      +DLT+K D+      L   +LPTG +RL++  + + +LPGF++
Sbjct: 149 GPQAVAAMERAHFDGAPVDLTLKGDLP---EGLPGELLPTGSVRLRDAGQ-VSALPGFSD 204

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLR 280
           G WWVQDA+A++PV+L G +  L VLD+CAAPGGKT QL   GA+VTALD+S+ RL ++R
Sbjct: 205 GAWWVQDAAAALPVKLLGEVAGLDVLDMCAAPGGKTLQLAARGARVTALDISEARLARVR 264

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            NLDR  L AE ++  DA ++  +  +DA+L+DAPCS+TGTIRRHPD+      + I + 
Sbjct: 265 ENLDRCGLEAE-LVAGDALEH--RGQYDAILLDAPCSATGTIRRHPDLPHVHMGEKISEL 321

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP----IPVELVPLNSA 396
              Q  +L   +S +KPGG +V++ CSL   + E  +++ L   P    +P E   +  A
Sbjct: 322 IGLQGWMLDHALSLLKPGGRLVYATCSLLPDEGECQIEEALERHPGLRVVPAEADWIEPA 381

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
            W+        S EG +R+ PD   +      G+DGF+
Sbjct: 382 -WR--------SEEGGLRLRPDFWAE----RGGLDGFY 406


>gi|295687552|ref|YP_003591245.1| sun protein [Caulobacter segnis ATCC 21756]
 gi|295429455|gb|ADG08627.1| sun protein [Caulobacter segnis ATCC 21756]
          Length = 431

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 149/443 (33%), Positives = 226/443 (51%), Gaps = 21/443 (4%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +  G+ AR  +  L+   + +R  L    D     + FR L  R++   RA+    LR L
Sbjct: 5   LNDGLPAREAALTLIDAALSRRGGL----DEAASANGFRFLEPRERAFARALAMAVLRHL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             ID  L   L  + P +   +  LLR+  AQ  +L+V  +A V  +VE A  +K +R F
Sbjct: 61  GPIDRALAARLQKAPPDR---VMHLLRLGAAQAFHLEVPAFAAVATSVELAGANKASRPF 117

Query: 121 AKLVNSILRRVSREKIELLQRIAGISII-PEWFKERLENFYGKERVLAISDACISPLYID 179
             LVN++LR + R+           +++ P W   R    +G+     I+         D
Sbjct: 118 KGLVNAVLRGLLRDAPTPDSLGDDPTLLAPPWLYSRWVAAFGEATAREIAGQIALEPATD 177

Query: 180 LTVKFDIETWAHKLNAV--MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           L++K + +  A        +LP G +RL+   + + + PGF +G WWVQDA+A++P +L 
Sbjct: 178 LSLKPNADAAALAEALEGEVLPGGTLRLRRKGD-VAAWPGFEDGSWWVQDAAAAVPARLL 236

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
                 +VLDLCAAPGGKT QL  +GA V ALD S  RL++L  NL R  L A+ ++  D
Sbjct: 237 DVKTGEAVLDLCAAPGGKTLQLAAAGADVVALDRSAARLKRLEENLVRTGLSAQ-VVVAD 295

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
              +   + FDA+L+DAPCS+TGT RRHPDVLW     D+   A  Q ++L      +KP
Sbjct: 296 GAAWDDARTFDAILLDAPCSATGTFRRHPDVLWAARPGDVASLANVQARILDSAAGRLKP 355

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           G  +V+  CSL+ ++ E  V+  L   P  +EL P+      + +   +L+  G +R+ P
Sbjct: 356 GARLVYCVCSLEPEEGEAQVEAFLARRPD-MELDPIQPGEAGAPE--ASLTARGTLRLLP 412

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
             L+       G DGFFA   R+
Sbjct: 413 HQLD------GGQDGFFAARFRK 429


>gi|83855202|ref|ZP_00948732.1| ribosomal RNA small subunit methyltransferase B, putative
           [Sulfitobacter sp. NAS-14.1]
 gi|83843045|gb|EAP82212.1| ribosomal RNA small subunit methyltransferase B, putative
           [Sulfitobacter sp. NAS-14.1]
          Length = 406

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 140/410 (34%), Positives = 221/410 (53%), Gaps = 26/410 (6%)

Query: 36  SAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILY 95
            A   L   D+   + +   TLR + R D +L   L    P    +++  LRV   ++  
Sbjct: 16  GALDKLPPDDRARAQRLAMDTLRGMERADRLLQKHLSKYPP---LTVRNALRVGTVELCQ 72

Query: 96  LDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKER 155
              A + VV+  VE     K+  H   L N++LR+++ E  E    +    + P+W +  
Sbjct: 73  GGAA-HGVVNAMVELVATHKKLGHLKGLTNAVLRKIAAEGPEAWAALRAPRL-PKWLRGP 130

Query: 156 LENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSL 215
           L   +G + +  I  A  +   +DLT K D E  A  +   +LPTG +R+ +  + + ++
Sbjct: 131 LTEAWGPDAMTGIEAAHFAGAPLDLTAKRDPEGLAAAVGGTVLPTGSVRVADAGQ-VTTM 189

Query: 216 PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRR 275
           PGFAEG WWVQDA+A++PV++       +VLDLCAAPGGKT QL  +GA+VTA+D SK+R
Sbjct: 190 PGFAEGDWWVQDAAAALPVKILAPQKGEAVLDLCAAPGGKTMQLAAAGAQVTAVDNSKQR 249

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           ++++R NL R+HL A+ ++ +DA  +  +  FDA+L+DAPCS+TGTIRRHPD+   +D  
Sbjct: 250 MQRVRENLARVHLPAK-VVVVDARRF--EGTFDAILLDAPCSATGTIRRHPDLPHAKDGS 306

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVE----L 390
           +       Q +++    S + PGG ++F  CSL   + E  V + L R + + V+     
Sbjct: 307 EFGDLIELQSEMIDHAWSLLNPGGRLIFCTCSLLPDEGEVQVDEALERHADMRVDRDALA 366

Query: 391 VPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           VP     W +         EG +R+ PD   ++     GMDGF+   LR+
Sbjct: 367 VPGVDPAWTTQ--------EGGLRLRPDYWPEL----GGMDGFYIACLRK 404


>gi|307296989|ref|ZP_07576805.1| Fmu (Sun) domain protein [Sphingobium chlorophenolicum L-1]
 gi|306877515|gb|EFN08743.1| Fmu (Sun) domain protein [Sphingobium chlorophenolicum L-1]
          Length = 429

 Score =  222 bits (566), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 156/439 (35%), Positives = 226/439 (51%), Gaps = 27/439 (6%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR  +  LL  V+R+   L   L       A + L   D+ LV AI   TLR LP +
Sbjct: 12  GLPARRAALRLLDAVLRRGDPLELALH-----GAGQGLPPADRALVHAIAAETLRHLPDL 66

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           DA++D      LP    + + +LR+++ Q + L  A +A +  A+     D   R   KL
Sbjct: 67  DALIDSATRQPLPHDAKA-RMVLRIALIQTIALGTAPHAAIATALPLV--DGGPR---KL 120

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           V+ +   ++R    L         +      R  + +G    LA + A      +DL+++
Sbjct: 121 VHGVFGTLTRANPTLPSPPTLPPEV----AARWGSQWGAAMPLAAATAYALRPPVDLSLR 176

Query: 184 FDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              ET  WA +L       G IRL E   +I  LPGF EG WWVQD +AS+P +L G   
Sbjct: 177 DASETAHWAEQLGGRSFAPGHIRLPEG-ANIPDLPGFGEGAWWVQDIAASVPARLLGAGE 235

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              VLDLCAAPGGKT QL  +G +VTA+D SK+RLE+L  NL R  L AE +++ D   +
Sbjct: 236 GRRVLDLCAAPGGKTMQLAAAGWRVTAVDQSKKRLERLGENLGRTGLSAE-VVQADLRAW 294

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P    DA+L+DAPC++TG  RRHPDVL       I + A  Q +LL +   ++ PGG +
Sbjct: 295 APDGPADAILLDAPCTATGIYRRHPDVLHRIGPRQIAELAELQAELLDRAAQWLTPGGTL 354

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           +++ CSL++ + EE V + L + P    L P N+A    +   +A + +GW+R  P+ L 
Sbjct: 355 IYATCSLEQAEGEEQVARFLSAHPDFAPL-PANAA---ELPEGIAPTAQGWVRTLPETLA 410

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G DGFF   L R
Sbjct: 411 N----EGGTDGFFVARLVR 425


>gi|149186386|ref|ZP_01864699.1| tRNA and rRNA cytosine-C5-methylase [Erythrobacter sp. SD-21]
 gi|148829975|gb|EDL48413.1| tRNA and rRNA cytosine-C5-methylase [Erythrobacter sp. SD-21]
          Length = 414

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 154/436 (35%), Positives = 233/436 (53%), Gaps = 38/436 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G++AR  +  LL  V R+  +L    D+ +  +   +    D+ L RAI +  LR+L  +
Sbjct: 8   GIHARRAALRLLDAVFRRGETL----DIAFNAATKDVRKFEDKALARAITSEVLRWLVDL 63

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D  +D     +LP    + + +LR+ +AQ L LD   +AV+   +             +L
Sbjct: 64  DRGIDSATKKALPDDSKA-RMVLRMMLAQWLRLDTPPHAVIATCLPLLAGGPR-----RL 117

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            + +   +++ +I L +       +PE   +R    +G ER  AI+     P  +DLT+K
Sbjct: 118 AHGVFSTLTKREIALPES----PTLPEDVAQR----WG-ERAEAIARGLAEPPPLDLTLK 168

Query: 184 F--DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
                E W  +L A  L  G +RL    E++  LPGFAEG WWVQD +AS+PV+L G   
Sbjct: 169 DPDQTEIWKTRLAADSLTPGHLRLPR-GENVEKLPGFAEGEWWVQDLAASLPVRLLGAGE 227

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              VLDLCAAPGGKT QL   G +VT+LD+SKRRL+ L+ NL R  L A   +  DA  +
Sbjct: 228 GRHVLDLCAAPGGKTLQLAAQGWQVTSLDISKRRLDLLKVNLKRTGLKAS-AVRADALAW 286

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            PK  FDA+L+DAPC++TGT RRHPDV+       I + A  Q  LL +   ++KPGG++
Sbjct: 287 EPKHQFDAILLDAPCTATGTARRHPDVIHRIGQRQIEEMAELQASLLARAAGWLKPGGVL 346

Query: 362 VFSNCSLDKQDSE-EVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           V++ CSL++++ E + +   L  +PI  + +P            +  S +G +R  P ML
Sbjct: 347 VYATCSLEREEGEGQELPSSLGIAPIAQDDLP----------DGINPSDDGTLRTDPGML 396

Query: 421 EKIDGVSSGMDGFFAV 436
            +    + G+DGFF V
Sbjct: 397 LE----NGGIDGFFIV 408


>gi|83950714|ref|ZP_00959447.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius nubinhibens ISM]
 gi|83838613|gb|EAP77909.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius nubinhibens ISM]
          Length = 410

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 140/403 (34%), Positives = 222/403 (55%), Gaps = 21/403 (5%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKK--YSLQQLLRVSVAQILYLDV 98
           L   D+   + +   TLR + R D      LIS   +KK   +++ +LR++  ++ Y   
Sbjct: 24  LDPADRARAQRLTTQTLRAMERAD-----RLISRHVKKKPPLTIRNILRLATVELAYGGD 78

Query: 99  ADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLEN 158
           A + VV  AV  A   + ++++  LVN++LR+++ E       +  +  +P W +  L +
Sbjct: 79  A-HGVVGEAVTLAGEGQRSQNYKGLVNAVLRKIAEEAPRSWNDLR-VPRLPGWLRGPLLD 136

Query: 159 FYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGF 218
            YG   V  +  A  +   +DLT K D    A      +LP+G +RL + P  + +LPG+
Sbjct: 137 AYGPGAVNGMEAAHFAGAPLDLTAKTDAAALAEATGGTLLPSGSVRLTD-PGQVSALPGY 195

Query: 219 AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEK 278
           AEG +WVQDA+A++PV++       +VLDLCAAPGGKT Q+  SGA  TALD+S +R+++
Sbjct: 196 AEGAFWVQDAAAAMPVRILDPKPGENVLDLCAAPGGKTLQIAASGASATALDLSAQRMQR 255

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           ++ NL+R  L A      DA  +     +DA+L+DAPCS+TGT+RRHPD+ + +D  DI 
Sbjct: 256 VQENLERTGLAAS-CETGDALRHTGGP-YDAILLDAPCSATGTLRRHPDLPFAKDGSDIG 313

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSE-EVVQKVLRSSPIPVELVPLNSAY 397
           +    Q ++L   +S +KPGG ++F  CSL   + E  V + +LR   + V+   L    
Sbjct: 314 RLITLQGEMLDHALSLLKPGGRLMFCTCSLLPDEGECHVEEALLRHEGLVVDREALAQ-- 371

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              ID A  ++ EG +R+ PD          GMDGF+   LR+
Sbjct: 372 -PGIDPAW-ITEEGGLRLRPDYWAD----QGGMDGFYMALLRK 408


>gi|83594989|ref|YP_428741.1| tRNA and rRNA cytosine-C5-methylase [Rhodospirillum rubrum ATCC
           11170]
 gi|83577903|gb|ABC24454.1| tRNA and rRNA cytosine-C5-methylase [Rhodospirillum rubrum ATCC
           11170]
          Length = 438

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 150/420 (35%), Positives = 226/420 (53%), Gaps = 21/420 (5%)

Query: 35  DSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQIL 94
           D+A R L  RD+   R +   TLR + R++ V+   L   LPR+    + +LR+  AQ+L
Sbjct: 31  DAATRKLEPRDRAFARLLAATTLRRMGRLEKVIKTFLDRPLPRRAVGAKHILRLGAAQML 90

Query: 95  YLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAG----ISIIPE 150
           +LD   +A V  +V+ A R +    +A L+N++LR+V+        R+AG    ++ +P 
Sbjct: 91  FLDTPPHAAVATSVDVA-RVRRLAPYAGLINAVLRKVADHGA---ARLAGFDDPLADLPR 146

Query: 151 WFKERLENFYGKERVLAISDACISPLYIDLTVK-FDIETWAHKLNAVMLPTGGIRLKELP 209
           W  +     YG E    +++AC     +DLT +  D    A  +  + LP G +RL    
Sbjct: 147 WLGQSWIAAYGAETAARLAEACGREAPLDLTPRDGDGGALAELVGGLALPGGSVRLPTA- 205

Query: 210 ESIVSLPGFAEGVWWVQDASASIPVQLFGT-LNNLSVLDLCAAPGGKTAQLIVSGAKVTA 268
            ++  L GF EG WWVQDA+A++PV L G  L    V+D CAAPGGKT QL  +GA+V A
Sbjct: 206 TAVRELAGFTEGQWWVQDAAAALPVLLAGVPLKGARVVDFCAAPGGKTLQLAAAGAQVWA 265

Query: 269 LDVSKRRLEKLRCNLDRLHLY-AEDIIEMDA--FDYCPKKLFDAVLVDAPCSSTGTIRRH 325
           +D S  RL +LR NL+R  L  A +++E DA  F     +  D VLVDAPC++TGT RRH
Sbjct: 266 VDRSATRLARLRENLERTGLGDAVNVVEGDALTFTLTDGQQADVVLVDAPCTATGTFRRH 325

Query: 326 PDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           PD  W +   D    A  Q  LL   +  V+PGG++V+  CSL  +++   ++ +L  SP
Sbjct: 326 PDAPWLKRPGDAAALAALQDSLLDAAVRLVRPGGVIVYCVCSLQPEEAAPRIEALLARSP 385

Query: 386 IPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
             +   P+ +      D    ++ EG +R+ P  L+ +     G+DGFF   L R   P+
Sbjct: 386 -EISRKPITAGEGGVSD--EMITAEGDVRLFPFHLDAV----GGLDGFFIARLVRGDAPR 438


>gi|315497067|ref|YP_004085871.1| sun protein [Asticcacaulis excentricus CB 48]
 gi|315415079|gb|ADU11720.1| sun protein [Asticcacaulis excentricus CB 48]
          Length = 464

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 150/440 (34%), Positives = 227/440 (51%), Gaps = 23/440 (5%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR+ +  L+   + KR       D     + F  LS+ ++    A+  + LR L ++
Sbjct: 42  GIAARVAAITLVEAALEKRSGF----DEAAASADFLKLSETERAFAGALALLVLRRLGQL 97

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D V+        P    +++QLLR+ +AQI ++ V D+A V   V+ A+R+ + R F  L
Sbjct: 98  DHVIHKKTQKMPPE---AVRQLLRIGMAQIFFMQVPDFAAVSTTVKIAERENKTRPFKGL 154

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           +N+ILR + R+    L  +    ++P+W  +R    YG+E    ++         DL+ +
Sbjct: 155 INAILRGLIRDG--KLSDVNPKRLVPDWLWQRWVQTYGEENAAGMASVLTEEPATDLSFR 212

Query: 184 --FDIETWAHKLNAVMLPTGGIRLKE-LPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
              D +  A  L    +  G + L+  L   +     +  G WWVQD +A+ PV L G L
Sbjct: 213 NPTDRDGLAEALQGEAV--GPVNLRSSLRGDLRQWADYDAGKWWVQDIAAATPVNLLGDL 270

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           N  + LD+CAAPGGKT QLI  GA+  A+D SK RL+++  NL R+ + AE I   DA  
Sbjct: 271 NGKTALDVCAAPGGKTLQLIAKGAQTVAIDRSKNRLKRVEDNLKRIGMSAE-IHNADAST 329

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           +   + FD VLVDAPCS+TGT RR PDVLW     D+ K A  Q +LL      VKPGG 
Sbjct: 330 FDDPRAFDVVLVDAPCSATGTYRRQPDVLWATRPADVAKLADVQHRLLDALAPRVKPGGD 389

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
            ++  CSL++++ E  +   LR +     LV   +     I  A + +PEGW+R+ P   
Sbjct: 390 FLYCTCSLEREEGETQILAFLRRNKD-FTLVKHTADQHPDI-PAASFAPEGWLRLLPHQR 447

Query: 421 EKIDGVSSGMDGFFAVALRR 440
           +       G DGFF   L+R
Sbjct: 448 K------GGQDGFFVAHLKR 461


>gi|163745468|ref|ZP_02152828.1| rRNA methyltransferase RsmB [Oceanibulbus indolifex HEL-45]
 gi|161382286|gb|EDQ06695.1| rRNA methyltransferase RsmB [Oceanibulbus indolifex HEL-45]
          Length = 423

 Score =  219 bits (559), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 145/439 (33%), Positives = 231/439 (52%), Gaps = 21/439 (4%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR  + +LL  ++     L   L       A   L   D+   + +   TLR L R
Sbjct: 4   TGVQARRSAVYLLDMILDDEPRLMSEL---LASGALDKLPPDDRARAQRLAQDTLRGLER 60

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D +L   L  + P    +++ +LRV   ++     A + VV+  V    + +   H   
Sbjct: 61  ADRLLQKHLQKAPP---LTVRNVLRVGTVELCQGGAA-HGVVNAMVNLVSQHRTLSHLKG 116

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L N++LR+++ +  E    +    + P+W +  L   +G + + A+ +A  +   +DLT 
Sbjct: 117 LTNAVLRKIAAQGPEAWDALRAPRL-PKWLRGPLAEAWGTDAIAAMEEAHFAGAPLDLTA 175

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D    A  +   +LPTG +R+    + + ++PGFAEG WWVQDA+A+IPV++      
Sbjct: 176 KGDASALAEAVGGTLLPTGSVRVMNAGQ-VSAMPGFAEGDWWVQDAAAAIPVRVLAPKEG 234

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             VLDLCAAPGGKT QL  +GA+VTA+D S  R+++++ NL R+ L A+ + + DA    
Sbjct: 235 ERVLDLCAAPGGKTMQLAAAGAEVTAVDQSHPRMQRVKENLTRVGLKAKTLTK-DA--RA 291

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
            +  FDA+L+DAPCS+TGTIRRHPD+   +D  +       Q +L+    S +KPGG +V
Sbjct: 292 VQGEFDAILLDAPCSATGTIRRHPDLPHAKDGSEFGDLIELQSELIDHAWSLLKPGGRLV 351

Query: 363 FSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           F  CSL   + E  V + L R   + V+   L+ A    ++ A  ++ EG +R+ PD   
Sbjct: 352 FCTCSLLPDEGEVQVDEALERHGDMTVDRAALDVA---GVEAAW-ITEEGGLRLRPDFWA 407

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  GMDGF+   LR+
Sbjct: 408 D----KGGMDGFYIACLRK 422


>gi|86139371|ref|ZP_01057940.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseobacter sp. MED193]
 gi|85823874|gb|EAQ44080.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseobacter sp. MED193]
          Length = 420

 Score =  219 bits (558), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 153/442 (34%), Positives = 232/442 (52%), Gaps = 26/442 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRK-RISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M  G  AR  + +LL  V+ + R+   C     Y   A   L+  D+   + +   TLR 
Sbjct: 1   MSDGTQARRTAIYLLDQVLGEGRLLAEC-----YAAGALERLTPEDRARAQRLTLQTLRS 55

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           L R D VL   L  + P    ++Q +LR+   ++ +   A + VV+  V    + + +  
Sbjct: 56  LERADRVLQKHLKKATP---LTVQNVLRLGTVELCH-GAAAHGVVNDMVAIISKHRRHGK 111

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
              LVN++LR+V+ +      ++  +  +P+W ++ L   +G E +L I  A      +D
Sbjct: 112 LKGLVNAVLRKVAEQGQAEWAKLR-VPRLPKWLRKPLVEAWGAEAMLEIEAAHYEGAPLD 170

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           +T K   +  A  L  V LPTG  RLK   + + +L G+  G WWVQDA+A++P Q+   
Sbjct: 171 ITGKRGADLTA--LGGVALPTGSHRLKNAGQ-VSALAGYEVGDWWVQDAAAALPAQMLQA 227

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
            +   +LDLCAAPGGKT Q+  SGA VTA+D S  R+E+L+ NL R  L A D++  DA 
Sbjct: 228 QSGERILDLCAAPGGKTMQMAASGASVTAVDTSASRMERLQENLTRTGLAA-DLVVGDAL 286

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           +   +  FDAVL+DAPCS+TGTIRRHPD+   +D          Q ++L    S VKPGG
Sbjct: 287 EQ--RGQFDAVLLDAPCSATGTIRRHPDLPHAKDGSAFGALIELQAQMLAHAWSLVKPGG 344

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSP-IPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
            +VF  CSL   + E  V++ L   P + V+   L +     +D A  ++ EG +R+ PD
Sbjct: 345 RMVFCTCSLLPDEGECQVEEALEMFPDMSVDRDVLAAL---GVDSAW-ITEEGGLRLRPD 400

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
              +      GMDGF+   LR+
Sbjct: 401 YWAE----QGGMDGFYMALLRK 418


>gi|332188795|ref|ZP_08390506.1| nusB family protein [Sphingomonas sp. S17]
 gi|332011194|gb|EGI53288.1| nusB family protein [Sphingomonas sp. S17]
          Length = 447

 Score =  219 bits (557), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 160/443 (36%), Positives = 232/443 (52%), Gaps = 39/443 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQR-DQILVRAIVNVTLRFLPR 62
           G   R  +  LL  V+R+   L   L      SA R LS   D+ L  AI   TLR LP 
Sbjct: 36  GTATRRAAIRLLDAVLRRGEPLEAALA-----SATRALSGGPDRGLAHAIAAETLRRLPD 90

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLA---VEQAKRDKENRH 119
           +DA++D      LP    + +  LR+++ Q+L L    +A +      V+   R      
Sbjct: 91  LDALIDSATKQRLPDDAKA-RFALRIALVQVLALGTPPHAAIATVLPLVDGGPR------ 143

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
             KLV+ +   +++  + L +    I  +PE  + R E  +G+E V A + A  +P  +D
Sbjct: 144 --KLVHGVFSTITKSGVLLPE----IPALPEATEARWEENWGEEMVEAAAHAIAAPPPLD 197

Query: 180 LTVKFDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           LT+     T  WA KL  + L  G +RL     S++ L GF EG WWVQD +ASIP +L 
Sbjct: 198 LTLADPAATGEWAEKLGGISLLPGHVRLPSG-NSVMELQGFDEGAWWVQDLAASIPARLL 256

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G      VLDLCAAPGGKT QL  +G  VTA+D S+ RL +L  NL+R +  AE ++  D
Sbjct: 257 GEGRG-HVLDLCAAPGGKTLQLAAAGWTVTAIDQSESRLARLAENLERTNQSAE-VVTAD 314

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
             ++ PK+  DA+LVDAPCS++G  RRHPDVL+      I + A  QR +L +  +++KP
Sbjct: 315 LREWEPKEAADAILVDAPCSASGIFRRHPDVLYRVRPAIIAEMAELQRVILTRAANWLKP 374

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG +V++ CSL+ ++ E  ++  L   P    LVP+   +         L+ EG IR  P
Sbjct: 375 GGKMVYATCSLEPEEGERQIESFLAERPD-YALVPITGDW-------PGLTAEGTIRTLP 426

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
            +L K       +DGFF   L+R
Sbjct: 427 TLLAK----EGRLDGFFIAMLQR 445


>gi|89056531|ref|YP_511982.1| Fmu (Sun) [Jannaschia sp. CCS1]
 gi|88866080|gb|ABD56957.1| Fmu (Sun) [Jannaschia sp. CCS1]
          Length = 410

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 157/445 (35%), Positives = 230/445 (51%), Gaps = 45/445 (10%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M AR  +  LL+ V+R+R  L  +     G  A R               + L  L  +D
Sbjct: 1   MKARPAALILLNAVLRERQILGQVDVPATGAEAAR------------ANRLALSVLRNLD 48

Query: 65  AVLDFVLISSLPRK-KYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           AV D V+     RK +  +  LLR+   ++L      + VV   V  AK     R  + +
Sbjct: 49  AV-DAVIKPYTTRKPQIGVHNLLRLGAVELLVNGEDAHGVVSDIVGIAKTQPHTRKASGM 107

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN+ILR+++ E  E   + A    +P W  + L    G + + AI  A      +DLT +
Sbjct: 108 VNAILRKIAVEGAEAFAK-APPQRLPPWIDKALRKRIGADGIRAIEQAQAQVPPMDLTPR 166

Query: 184 ---FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
              F +E      NA +LPTG +RL   P+ + +LPG+++G +WVQDA+A++PV+L G +
Sbjct: 167 DDGFMLE------NAEVLPTGSLRLNNHPQ-VSALPGYSDGAFWVQDAAAALPVKLLGDV 219

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
              SVLDLCAAPGGKT QL  +GA+VTALD+S  RL ++  NL R  L A  + E DAF 
Sbjct: 220 RGKSVLDLCAAPGGKTMQLAAAGAEVTALDISGPRLRRVEENLARTGLSATLVTE-DAFQ 278

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           +     +DA+L+DAPCS+TGTIRRHPD+ + +D  ++      Q +L+   ++ +KPGG 
Sbjct: 279 HSGS--YDAILLDAPCSATGTIRRHPDLPFVKDGREVEPLTRLQMQLIDHALTLLKPGGT 336

Query: 361 VVFSNCSLDKQDSEEVVQKVLRS----SPIPVELVPLNS-AYWKSIDMAMALSPEGWIRI 415
           +V+  CSL   + E  ++  L+     S IP + V L   A W S +  + L P  W   
Sbjct: 337 LVYCTCSLLPVEGEFQIKAALKRHDGLSIIPADPVALGGDAEWASAEGGLRLWPFYWAE- 395

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRR 440
                        GMDGF+  AL R
Sbjct: 396 -----------RGGMDGFYMAALTR 409


>gi|254461752|ref|ZP_05075168.1| rRNA methyltransferase RsmB [Rhodobacterales bacterium HTCC2083]
 gi|206678341|gb|EDZ42828.1| rRNA methyltransferase RsmB [Rhodobacteraceae bacterium HTCC2083]
          Length = 423

 Score =  216 bits (551), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 135/400 (33%), Positives = 218/400 (54%), Gaps = 16/400 (4%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           L+  D+   + + + TLR L R+D ++   L    P    ++  +LR++  ++     A 
Sbjct: 38  LAYDDRARAQRLASETLRSLERVDRIMKPFLRKPPP---LAVHNVLRIATYELCTGGAA- 93

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFY 160
           + VV+ AV     +K       L N++LR+V  +  E   ++  +  +P+W +  L   Y
Sbjct: 94  HGVVNDAVSSVGANKRTEKLKGLTNAVLRKVVDKGPEEWAKLR-VPRLPKWLRAPLAQAY 152

Query: 161 GKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAE 220
           G E +  I     +   +DLT K D +  +  +  V+LPTG +R+K+  + + +L G+  
Sbjct: 153 GHEGIGDIERMHFTGAPLDLTPKGDAKALSEAVAGVVLPTGSVRIKDAVQ-VSALAGYDA 211

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLR 280
           G WWVQDA+A++PVQ+       +++DLC APGGKT QL  SGA VTA+D S RR++++R
Sbjct: 212 GDWWVQDAAAALPVQILHPQKGEAIIDLCCAPGGKTMQLAASGANVTAVDSSDRRMQRVR 271

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            NL+R  L AE ++  DA +   +  +DAVL+DAPCS+TGTIRRHPD+   +D  +  + 
Sbjct: 272 ENLERAKLSAE-LVVGDALETSGR--YDAVLLDAPCSATGTIRRHPDLPLVKDGSEFGEL 328

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L   I+ +KPGG +VF  CSL   + E  ++ +L   P   EL     A  + 
Sbjct: 329 IELQAQMLSHAITLLKPGGRLVFCTCSLLPDEGECQIEDLLAIHP---ELEIDRDALKRD 385

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                 ++ EG +R+ PD   +      GMDGF+   LR+
Sbjct: 386 GIEDAWITEEGGLRLRPDYWAE----QGGMDGFYIALLRK 421


>gi|87201108|ref|YP_498365.1| Fmu (Sun) [Novosphingobium aromaticivorans DSM 12444]
 gi|87136789|gb|ABD27531.1| Fmu (Sun) [Novosphingobium aromaticivorans DSM 12444]
          Length = 419

 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 148/440 (33%), Positives = 221/440 (50%), Gaps = 44/440 (10%)

Query: 4   GMNARLVSSHLLSCVMRK-----RISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLR 58
           G+ +R  +  LL  V+R+     + +   L  +E G          D+ L  AI    LR
Sbjct: 12  GVASRRAALRLLDAVLRRGDPLDQAAPPVLRGIERG---------ADRALALAIAQEALR 62

Query: 59  FLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENR 118
           ++  +DA++D      LP    + + +LR+ +AQ L LD+  +AVV   +          
Sbjct: 63  WMADLDALIDGATRQILPEDAKA-RSVLRIMLAQALRLDMPGHAVVATGLPLLMGGPR-- 119

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
              +L + +   V++    L +       +P     R +  +  +RV  I+     P  +
Sbjct: 120 ---RLAHGVFSAVTKGDARLPE----APTLPPAVAARWQAAW-PDRVDGIARGLAEPPPL 171

Query: 179 DLTVKFDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
           DLT++   ET  WA +L  + L  G +R+     +I +LPGFAEG WWVQD +AS+P +L
Sbjct: 172 DLTLRDPAETAQWAERLGGMSLAPGHVRIARA-GAIEALPGFAEGAWWVQDLAASVPARL 230

Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEM 296
            G       LDLCAAPGGKT QL  +G  VTALD S RR+E+L  NL R  L AE ++  
Sbjct: 231 LGAGEGRRALDLCAAPGGKTLQLAAAGWSVTALDKSARRVERLEDNLKRSQLEAE-VVVA 289

Query: 297 DAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVK 356
           DA  + P+  FDA+L+DAPCS+TGT RRHPDVL       I +    Q+ +L +   ++ 
Sbjct: 290 DALKWQPEVKFDAILLDAPCSATGTCRRHPDVL--HRNPGIDELVALQKAMLERAAGWLA 347

Query: 357 PGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRIT 416
           PGG +V++ CSL+ ++ E         +P+P+    L     K+ D        GW R  
Sbjct: 348 PGGRLVYAVCSLEPEEGEAQAAAFTGLAPLPIGDDELPGGL-KAAD--------GWFRSD 398

Query: 417 PDMLEKIDGVSSGMDGFFAV 436
           P ML      + G+DGFFA 
Sbjct: 399 PGMLAD----AGGIDGFFAA 414


>gi|94498065|ref|ZP_01304628.1| Fmu (Sun) [Sphingomonas sp. SKA58]
 gi|94422500|gb|EAT07538.1| Fmu (Sun) [Sphingomonas sp. SKA58]
          Length = 414

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 150/433 (34%), Positives = 220/433 (50%), Gaps = 30/433 (6%)

Query: 14  LLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLIS 73
           LL  V+R+   L   L       A + L + D+ L  AI    LR LP +DA++D     
Sbjct: 3   LLDAVLRRGEPLELALH-----GAAQGLPREDRALTHAIAAEVLRHLPDLDALIDGATRQ 57

Query: 74  SLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSR 133
            LP    + + +LR+++AQ L +D   +A +  A+     D   R   KLV+ +   V+R
Sbjct: 58  ILPDDAKA-RMVLRIALAQTLRMDTPPHAAIATALPLV--DGGPR---KLVHGVFGTVTR 111

Query: 134 EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET--WAH 191
            +  L         +P     R  + +G     A + A      +D+T++   ET  W  
Sbjct: 112 GQPALPD----PPTLPAEVLARWSDQWGAAMPQAAAHAYAVRPPVDVTLRDASETARWTD 167

Query: 192 KLNAVMLPTGGIRLKELP----ESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLD 247
            L+      G +RL   P     +I +LPGFAEG WWVQD +A+ P +L G  +    LD
Sbjct: 168 ALDGASFAPGHVRLPTHPVDGNGAIPALPGFAEGAWWVQDIAAACPARLLGKGDGRQALD 227

Query: 248 LCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLF 307
           LCAAPGGKT Q+  +G +V A+D SK+RLE+L  NL R  L A DI+  D   + P    
Sbjct: 228 LCAAPGGKTMQMAAAGWRVIAVDQSKKRLERLSENLARTGL-AADIVAADLRQWQPLAPV 286

Query: 308 DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS 367
           DA+L+DAPCS+TG  RRHPDVL       I   A  Q +LL +   ++ PGG +V++ CS
Sbjct: 287 DAILLDAPCSATGIYRRHPDVLHRIGLRQIADLAELQAQLLARAADWLTPGGRLVYATCS 346

Query: 368 LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
           L++ + E+ + + L + P    L P+ ++    +   MA  P+GW+R  PD L      +
Sbjct: 347 LEQAEGEDQIARFLDARPD-FALDPIATS---ELPEGMAPDPQGWLRTLPDTLAS----A 398

Query: 428 SGMDGFFAVALRR 440
            G DGFF   L R
Sbjct: 399 GGTDGFFIARLVR 411


>gi|260426788|ref|ZP_05780767.1| Fmu [Citreicella sp. SE45]
 gi|260421280|gb|EEX14531.1| Fmu [Citreicella sp. SE45]
          Length = 420

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 140/417 (33%), Positives = 224/417 (53%), Gaps = 26/417 (6%)

Query: 28  LLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLR 87
           LL       A+  L+  ++   + +    LR L R D VL   L  + P     ++ +LR
Sbjct: 24  LLSEAMSGGAWDSLAPAERAAAQRLAQEVLRNLERCDRVLKPHLRKAPP---LFVKNVLR 80

Query: 88  VSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI 147
           +   ++     A + VV+ AV+    D++      +VN++LR+++ E      ++  +  
Sbjct: 81  LGAWELCTGGAA-HGVVNEAVQLVGADRKAHSMKGMVNAVLRKLAAEGPAQWTKLR-VPR 138

Query: 148 IPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKE 207
           +P W ++ L + +G + V A+  A ++   +DLT K D    A +L   +LPTG +RL +
Sbjct: 139 LPRWLRDPLASAWGGKPVAAMEAAHLAGAPLDLTAKGDPAALAERLGGELLPTGSVRLLD 198

Query: 208 LPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT 267
             + + +LPG+ EG WWVQDA+A++P +L G +  L VLD+CAAPGGKT QL  +GAKVT
Sbjct: 199 AGQ-VSALPGYDEGAWWVQDAAAALPARLLGDVAGLEVLDMCAAPGGKTMQLAAAGAKVT 257

Query: 268 ALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPD 327
           ALD+S+ R+ ++  NL R  L A  +   DA ++  +  +DA+L+DAPCS+TGTIRRHPD
Sbjct: 258 ALDLSESRMARVTENLARTGLSATTVTG-DAMEH--EGSYDAILLDAPCSATGTIRRHPD 314

Query: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-- 385
           +   +  + I +    Q  +    +  ++PGG +VF  CSL   + E  V++ L   P  
Sbjct: 315 LPHAKHGEGITELIGLQEAMFDHALRLLRPGGRLVFCTCSLIPDEGECHVEEALARHPGL 374

Query: 386 --IPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +P E  P     W+S         EG +R+ PD   +      GMDGF+   LR+
Sbjct: 375 EVLPAE-APGIEDRWRSA--------EGGLRLRPDFWAE----RGGMDGFYMAHLRK 418


>gi|294084660|ref|YP_003551418.1| tRNA and rRNA cytosine-C5-methylase [Candidatus Puniceispirillum
           marinum IMCC1322]
 gi|292664233|gb|ADE39334.1| tRNA and rRNA cytosine-C5-methylase [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 446

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 134/403 (33%), Positives = 223/403 (55%), Gaps = 11/403 (2%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLP-RKKYSLQQLLRVSVAQILYLDVA 99
           L  RD+  VR +    LR   +I+ V+   +IS  P   + +   +L +   Q+L L   
Sbjct: 54  LDDRDRRFVRLLATTCLRRRGQIEKVI-APMISRRPFGAQANANLILLMGAVQLLILKTG 112

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENF 159
            +A VD  VE  ++   +R    + N+++RR++RE     +    I  +P+W  +     
Sbjct: 113 AHAAVDSTVELMRQSGFDR-LCGMANAVMRRLTREGDTRFETTTPIDNLPDWLLQSWNEH 171

Query: 160 YGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFA 219
           +G++    +++  ++P  +D++ K + E  A  L   ++    IR +        L GFA
Sbjct: 172 WGQDATSKLAEIAMNPPPLDISAKANPEAMASTLEGTLIDNYTIR-RAFDGDPSRLAGFA 230

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKL 279
           +G WWVQDA+A++P +L G + +  V+DLCAAPGGKTAQLI +GA VTA+D  ++R+++L
Sbjct: 231 DGEWWVQDAAAALPARLLGDVKSKDVIDLCAAPGGKTAQLIAAGATVTAIDSGRKRIDRL 290

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           R NL RL + A  + ++D   + P    DA+L+DAPCS+TGT+RR PD+L  R  +DI  
Sbjct: 291 RRNLGRLGMKAS-LKQVDGRQFVPDMPVDAILLDAPCSATGTLRRRPDILGRRQPEDIES 349

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
               Q +L    + ++K GG +V++ CSL  ++ EE++  ++ +    V + P+     +
Sbjct: 350 LQNLQWELATTALGWLKAGGQLVYATCSLQPEEGEEMISAIIDAGEDKVVIDPITPD--Q 407

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +   A +L+ EG +RI P   + I GV    DGFFA  L  L+
Sbjct: 408 AGIFARSLTKEGTLRILPHQYDDIGGV----DGFFAARLIALV 446


>gi|254509818|ref|ZP_05121885.1| Fmu (Sun) [Rhodobacteraceae bacterium KLH11]
 gi|221533529|gb|EEE36517.1| Fmu (Sun) [Rhodobacteraceae bacterium KLH11]
          Length = 419

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 137/409 (33%), Positives = 221/409 (54%), Gaps = 28/409 (6%)

Query: 36  SAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILY 95
            A   L+  D+   + +   TLR L R D +L   L  +      ++   LR+   ++  
Sbjct: 33  GALDRLAPEDRARAQRLTIETLRGLERADRLLADHLRQT---PALTVHNALRLGTVELCQ 89

Query: 96  LDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKER 155
            + A + VV+  VE   R +++     LVN++LR+++ +  +   ++  +  +P+W ++ 
Sbjct: 90  GEAA-HGVVNAMVEIVGRSRKHGRLKGLVNAVLRKIAADGPDAWPKMR-VPRLPDWLRDP 147

Query: 156 LENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSL 215
           L   +G+E V ++  A      +D+T+K   E+     +   LPTG +RL+E  + + +L
Sbjct: 148 LIMAWGQEAVKSMEQAHFLGAPLDITLKPGAES----PDGTNLPTGSVRLQEAGQ-VSAL 202

Query: 216 PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRR 275
           PG+  G WWVQDA+A++PVQ+        VLDLCAAPGGKT QL  +GA VTALD+S+ R
Sbjct: 203 PGYKAGGWWVQDAAAALPVQVLAPKPGEKVLDLCAAPGGKTLQLAAAGADVTALDISEAR 262

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           L ++  NL R  L A  +I  DA D+     +DA+L+DAPCS+TGTIRRHPD+ + +D  
Sbjct: 263 LARVHDNLQRTGLKAT-VIAADALDH--HGQYDAILLDAPCSATGTIRRHPDLPFAKDGS 319

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           +       Q ++L    S +KPGG +V+  CSL   + E  V++ L   P     + +N 
Sbjct: 320 EFGGLIALQAQMLAHAWSLLKPGGRLVYCTCSLLPDEGEVQVEEALAQHPD----MQINR 375

Query: 396 AYWKSIDMAMA----LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           A   ++D+A      ++ EG +R+ PD          GMDGF+   L +
Sbjct: 376 A---ALDIAGVERDWVTQEGGLRLRPDYWSG----KGGMDGFYIACLNK 417


>gi|149912797|ref|ZP_01901331.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseobacter sp. AzwK-3b]
 gi|149813203|gb|EDM73029.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseobacter sp. AzwK-3b]
          Length = 427

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 144/435 (33%), Positives = 230/435 (52%), Gaps = 20/435 (4%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           +AR  + HLL  V+ +   ++ L+       A   L   D+   + +   TLR + R D 
Sbjct: 7   SARRSAVHLLDQVLGEGRLMSDLIS----SGALDRLDPADRARAQRLATDTLRGIERADR 62

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +L   L    P   +++   LR+   ++     A   V DL V      +   +   L+N
Sbjct: 63  LLKRHLRKPPPLHVFNI---LRLGTVELCMGGDAHGVVNDL-VALVGSHRRYGNLKGLIN 118

Query: 126 SILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFD 185
           ++LR+++ +       +  +  +P W +E L + +G   V  +  A  +   +DLT + D
Sbjct: 119 AVLRKMAADGPGTWNDLR-VPRLPRWLREPLVSAWGAGAVAQMEQAQFAGAPLDLTARGD 177

Query: 186 IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSV 245
               A +L   +LPTG +RL +  + + +LPG+  G WWVQDA+A++PV++     + +V
Sbjct: 178 AVALAERLQGTLLPTGSVRLSDAGQ-VSALPGYTSGDWWVQDAAAALPVRVLDPQPHEAV 236

Query: 246 LDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKK 305
           LDLCAAPGGKT QL  +GA VTALD+S++R+ ++R NL+R   Y+ + I  DA ++    
Sbjct: 237 LDLCAAPGGKTLQLCAAGANVTALDLSEKRMARVRENLERCG-YSANCITGDALEHA-GG 294

Query: 306 LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN 365
            +DAVL+DAPCS+TGTIRRHPD+ + +D  +       Q  +L   +S +KPGG +VF  
Sbjct: 295 PYDAVLLDAPCSATGTIRRHPDLPFAKDGSEFGALIALQAAMLDHALSLLKPGGRLVFCT 354

Query: 366 CSLDKQDSEEVVQKVLRSSP-IPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKID 424
           CSL   + E  V + L   P + V+   +  A    ID A  ++ EG +R+ PD    + 
Sbjct: 355 CSLLPDEGECQVDEALGRHPGLSVDRGAV--AGLPGIDPAW-ITDEGGLRLRPDHWPDL- 410

Query: 425 GVSSGMDGFFAVALR 439
               GMDGF+   LR
Sbjct: 411 ---GGMDGFYIACLR 422


>gi|241762323|ref|ZP_04760403.1| Fmu (Sun) domain protein [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241373117|gb|EER62756.1| Fmu (Sun) domain protein [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 468

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 138/373 (36%), Positives = 202/373 (54%), Gaps = 21/373 (5%)

Query: 80  YSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA-----KLVNSILRRVSRE 134
           + L QL+  + A+ L  DV    V+ +A+ Q    K+  H A      LV+   RR+   
Sbjct: 98  HDLDQLIDSATAKPLAPDVKARMVLRMALAQKLVLKQPAHVAIATVLPLVDGGPRRLVHG 157

Query: 135 KIELLQRIAGISI-----IPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET- 188
               L R  G+++     +P+    R E  +G+  + A S A      +DLT+K   ET 
Sbjct: 158 VYGSLDRREGVALPEYPTLPDETAYRWEKAWGEPMLAAASRALADQPPVDLTLKNPEETA 217

Query: 189 -WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLD 247
            W  KL+   L  G IRL E    I  L G+ EG WWVQD SAS+  +L G   N ++LD
Sbjct: 218 FWQEKLSGESLFLGHIRLPEGHPPIAELAGYQEGAWWVQDISASLAARLLGKGKNRTILD 277

Query: 248 LCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLF 307
           LCAAPGGKT QL   G +VTA+D++ +RL +L  NL R+ L AE ++  D  DY PK+  
Sbjct: 278 LCAAPGGKTMQLASQGWQVTAVDIAAKRLTRLHDNLKRMGLSAE-VVTADLADYTPKEAV 336

Query: 308 DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS 367
           DA+L+DAPCS++G  RRHPDVL+   +  I+  A  Q+KLL +   +VK GG +V++ CS
Sbjct: 337 DAILLDAPCSASGIFRRHPDVLYRVSSRIIIDMAEQQKKLLHRASQWVKKGGKLVYAVCS 396

Query: 368 LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
           L+ ++ E V++  L           ++S   +++   ++ S EGW+RI P+ L +     
Sbjct: 397 LEPEEGEAVIRDFLAHH----SDYRIDSLEKETLPAGLSPSEEGWLRILPENLAE----K 448

Query: 428 SGMDGFFAVALRR 440
            G DGFF     R
Sbjct: 449 GGNDGFFIAYFTR 461


>gi|56698200|ref|YP_168572.1| ribosomal RNA small subunit methyltransferase B, putative [Ruegeria
           pomeroyi DSS-3]
 gi|56679937|gb|AAV96603.1| ribosomal RNA small subunit methyltransferase B, putative [Ruegeria
           pomeroyi DSS-3]
          Length = 423

 Score =  213 bits (541), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 153/440 (34%), Positives = 233/440 (52%), Gaps = 28/440 (6%)

Query: 3   SGMNARLVSSHLLSCVMRK-RISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           S   AR  +  LL  ++ + R+   CL     G  A   L   ++   + +   TLR L 
Sbjct: 4   SATQARQSAIDLLDQILGEGRLLSECL-----GAGALDRLPPEERARAQRLTLDTLRGLE 58

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R D +L   L  + P    S++  LR+   ++ + + A + VV   VE   R + +    
Sbjct: 59  RADRLLKPHLQKAPP---LSVRNALRLGTVELAHGEAA-HGVVHSMVEIVGRSRRHGRLK 114

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LR+V+ +      R+  +  +P W ++ L   +G   V A+  A      +DLT
Sbjct: 115 GLVNAVLRKVAADAPSAWGRLR-VPRLPRWLRDPLVQAWGAPAVAAMEAAHFVGAPLDLT 173

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           +K    + A      +LPTG +RL +  + + +LPGFA G WWVQDA+A++PVQL     
Sbjct: 174 LK----SGASAPGGEVLPTGSVRLHDAGQ-VSALPGFAAGDWWVQDAAAALPVQLLDPQP 228

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             SVLDLCAAPGGKT QL  +GA+VTALD+S+ R+ ++R NL R  L AE ++  DA + 
Sbjct: 229 GESVLDLCAAPGGKTMQLAAAGARVTALDISEGRMARVRENLARTGLSAETVVG-DALEQ 287

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
             +  +DAVL+DAPCS+TGTIRRHPD+   +D  +       Q +++    + V+PGG +
Sbjct: 288 GGQ--YDAVLLDAPCSATGTIRRHPDLPLAKDGSEFGALIELQAQMIAHAWTLVRPGGRM 345

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSP-IPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VF  CSL   + E  V++ L   P +  +   L       ID A  ++ EG +R+ PD  
Sbjct: 346 VFCTCSLLPDEGEVQVEEALTLYPDMSTDRAALG---LPGIDPAW-ITEEGGLRLRPDYW 401

Query: 421 EKIDGVSSGMDGFFAVALRR 440
            +      GMDGF+   LR+
Sbjct: 402 SE----RGGMDGFYMAVLRK 417


>gi|56550913|ref|YP_161752.1| Fmu (Sun) domain-containing protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|56542487|gb|AAV88641.1| Fmu (Sun) domain protein [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 468

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 138/373 (36%), Positives = 202/373 (54%), Gaps = 21/373 (5%)

Query: 80  YSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA-----KLVNSILRRVSRE 134
           + L QL+  + A+ L  DV    V+ +A+ Q    K+  H A      LV+   RR+   
Sbjct: 98  HDLDQLIDSATAKPLAPDVKARMVLRMALAQKLVLKQPAHVAIATVLPLVDGGPRRLVHG 157

Query: 135 KIELLQRIAGISI-----IPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET- 188
               L R  G+++     +P+    R E  +G+  + A S A      +DLT+K   ET 
Sbjct: 158 VYGSLDRREGVALPEYPTLPDETAYRWEKAWGEPMLAAASRALAEQPPVDLTLKNPEETA 217

Query: 189 -WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLD 247
            W  KL+   L  G IRL E    I  L G+ EG WWVQD SAS+  +L G   N ++LD
Sbjct: 218 FWQEKLSGESLFLGHIRLPEGHPPIAELAGYQEGSWWVQDISASLAARLLGKGENRTILD 277

Query: 248 LCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLF 307
           LCAAPGGKT QL   G +VTA+D++ +RL +L  NL R+ L AE ++  D  DY PK+  
Sbjct: 278 LCAAPGGKTMQLASQGWQVTAVDIAAKRLTRLHDNLKRMGLSAE-VVTADLADYTPKEAV 336

Query: 308 DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS 367
           DA+L+DAPCS++G  RRHPDVL+   +  I+  A  Q+KLL +   +VK GG +V++ CS
Sbjct: 337 DAILLDAPCSASGIFRRHPDVLYRVSSRIIIDMAEQQKKLLHRASQWVKKGGKLVYAVCS 396

Query: 368 LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
           L+ ++ E V++  L           ++S   +++   ++ S EGW+RI P+ L +     
Sbjct: 397 LEPEEGEAVIRDFLAHH----SDYRIDSLEKETLPAGLSPSEEGWLRILPENLAE----K 448

Query: 428 SGMDGFFAVALRR 440
            G DGFF     R
Sbjct: 449 GGNDGFFIAYFTR 461


>gi|260574499|ref|ZP_05842503.1| Fmu (Sun) domain protein [Rhodobacter sp. SW2]
 gi|259023395|gb|EEW26687.1| Fmu (Sun) domain protein [Rhodobacter sp. SW2]
          Length = 427

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 153/405 (37%), Positives = 218/405 (53%), Gaps = 30/405 (7%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           LS  D+   + +    LR +   D VL   L    P    +++  LR++V ++     A 
Sbjct: 44  LSPSDRARAQRLALAVLRHIEPADRVLKPHLRKEPPE---AVRIALRLAVVELAVEHAAA 100

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI--IPEWFKERLEN 158
           + VV+ AV   +  K   H A LVN++LR+V+    E+ +  AG+    +P W ++ L +
Sbjct: 101 HGVVNAAVSLMRLGKRTTHMAGLVNAVLRKVA----EVPEPFAGLPPQRLPFWLRKPLVD 156

Query: 159 FYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVS-LPG 217
            YG+E+V A+         ID++VK   E       A  LPTG +RL   P+  VS LPG
Sbjct: 157 TYGREQVAAMEAVQALAPPIDISVKPGAEVAIPGAEA--LPTGSLRLP--PQVQVSNLPG 212

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLE 277
           FAEG WWVQDA+A++ V L        VLDLCAAPGGKT QL  +GA+V ALD+S  RL 
Sbjct: 213 FAEGQWWVQDAAAALAVGLLAPRPGERVLDLCAAPGGKTLQLAAAGAQVLALDISAPRLV 272

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           +LR NL R  L AE ++  DA  + P   FDA+L+DAPCS+TGTIRRHPD+ + +D  D+
Sbjct: 273 RLRDNLARCGLAAE-VVAADALVWQPAAAFDAILLDAPCSATGTIRRHPDLPFVKDGSDL 331

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-IPVEL--VPLN 394
            +    Q  L+ + + ++KPGG +VF  CSL   + E  +   L   P + VE   +P  
Sbjct: 332 PQVLALQAALIDRALGWLKPGGRLVFCTCSLLPDEGEAQLAGALARHPGLVVERPDLPGV 391

Query: 395 SAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
              W        ++  G +R+ PD   +      GMDGFF   LR
Sbjct: 392 EPAW--------ITETGGLRLRPDYWAE----RGGMDGFFMARLR 424


>gi|163744097|ref|ZP_02151463.1| ribosomal RNA small subunit methyltransferase B, putative
           [Phaeobacter gallaeciensis 2.10]
 gi|161382644|gb|EDQ07047.1| ribosomal RNA small subunit methyltransferase B, putative
           [Phaeobacter gallaeciensis 2.10]
          Length = 443

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 148/444 (33%), Positives = 225/444 (50%), Gaps = 30/444 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +   AR  + HLL  V+ +      LL   Y   A   L   ++   + +   TLR L
Sbjct: 23  MSNATQARRRAIHLLDQVLGE----GKLLSECYAAGALDKLPAEERARTQRLATDTLRNL 78

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            R D +L   L  + P    ++   LR+   ++     A + VV+  V+   R + +   
Sbjct: 79  ERADRILQKHLKKATP---LTVHNALRIGTVELCQGGAA-HGVVNEMVDIIARHRRHGKL 134

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             LVN++LR+V+ +      ++  +  +P+W +  L   +G   +L I  A ++   +DL
Sbjct: 135 KGLVNAVLRKVAEQGPTEWAKLR-VPRLPKWLRSPLSQAWGAPAMLQIEAAHLAGAPLDL 193

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           + K   +  A  L AV+LPTG  R+    + +  LPGFA G WWVQDA+A++P Q+    
Sbjct: 194 SPKPGADLSA--LEAVLLPTGSYRIHNSVQ-VSGLPGFATGDWWVQDAAAALPAQILAAK 250

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
              SVLDLCAAPGGKT Q+  SGA VTA+D S  R+ +L  NL+R  L A  ++  DA +
Sbjct: 251 PGESVLDLCAAPGGKTMQMAASGANVTAVDQSAGRMARLSENLERTGLKAT-VVVGDALE 309

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
              +  +DAVL+DAPCS+TGTIRRHPD+   +D          Q ++L    S VKPGG 
Sbjct: 310 QTGQ--YDAVLLDAPCSATGTIRRHPDLPHAKDGSGFGALIELQAQMLAHAWSLVKPGGR 367

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA----LSPEGWIRIT 416
           +++  CSL   + E  V+  L       E+ P  S   +  D+       ++ EG +R+ 
Sbjct: 368 LIYCTCSLLPDEGECQVEDAL-------EMFPDMSVGDRIRDIEGIDPDWITEEGGVRLR 420

Query: 417 PDMLEKIDGVSSGMDGFFAVALRR 440
           PD    +     GMDGF+   LR+
Sbjct: 421 PDYWSDL----GGMDGFYMAELRK 440


>gi|260753395|ref|YP_003226288.1| Fmu (Sun) domain protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
 gi|258552758|gb|ACV75704.1| Fmu (Sun) domain protein [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 468

 Score =  211 bits (538), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 137/373 (36%), Positives = 201/373 (53%), Gaps = 21/373 (5%)

Query: 80  YSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA-----KLVNSILRRVSRE 134
           + L QL+  + A+ L  DV    V+ +A+ Q    K+  H A      LV+   RR+   
Sbjct: 98  HDLDQLIDSATAKPLAPDVKARMVLRMALAQKLVLKQPAHVAIATVLPLVDGGPRRLVHG 157

Query: 135 KIELLQRIAGISI-----IPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET- 188
               L R  G+++     +P+    R E  +G+  + A S A      +DLT+K   ET 
Sbjct: 158 VYGSLDRREGVALPEYPTLPDETAYRWEKAWGEPMLAAASRALAEQPPVDLTLKNPEETA 217

Query: 189 -WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLD 247
            W  KL+   L  G IRL E    I  L G+ +G WWVQD SAS+  +L G   N ++LD
Sbjct: 218 FWQEKLSGESLFAGHIRLPEGHPPIAELAGYQDGAWWVQDISASLAARLLGKGENRTILD 277

Query: 248 LCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLF 307
           LCAAPGGKT QL   G +VTA+D++ +RL +L  NL R+ L AE ++  D  DY PK+  
Sbjct: 278 LCAAPGGKTMQLASQGWQVTAVDIAAKRLTRLHDNLKRMGLSAE-VVTADLADYTPKEAV 336

Query: 308 DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS 367
           DA+L+DAPCS++G  RRHPDVL+   +  I   A  Q+KLL +   +VK GG +V++ CS
Sbjct: 337 DAILLDAPCSASGIFRRHPDVLYRVSSRIITDMAEQQKKLLHRASQWVKKGGKLVYAVCS 396

Query: 368 LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
           L+ ++ E V++  L           ++S   +++   ++ S EGW+RI P+ L +     
Sbjct: 397 LEPEEGEAVIRDFLAHH----SDYRIDSLEKETLPAGLSPSEEGWLRILPENLAE----K 448

Query: 428 SGMDGFFAVALRR 440
            G DGFF     R
Sbjct: 449 GGNDGFFIAYFTR 461


>gi|296285189|ref|ZP_06863187.1| tRNA and rRNA cytosine-C5-methylase [Citromicrobium bathyomarinum
           JL354]
          Length = 418

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 159/440 (36%), Positives = 227/440 (51%), Gaps = 47/440 (10%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR  +  LL  V+R+  +L      +   +A R L   D  L RAI   TLR+L   
Sbjct: 10  GLPARRAALRLLDGVLRRGETLE-----QNETAALRGLPASDAGLARAIAAETLRWLVDF 64

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           DA++D      LP      + +LR+ +AQ L LD   +AVV  A+       +     +L
Sbjct: 65  DALIDSATREVLPEDAKP-RTVLRLMLAQWLRLDTPPHAVVATALPLLSGGPK-----RL 118

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            + +   +++  +EL         +PE   ER    +G ER  AI+     P  +DLT++
Sbjct: 119 AHGVFGALTKRGVEL----PAAPTLPEAVAER----WG-ERAEAIAAGLAEPPPLDLTLR 169

Query: 184 FDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +T  W  KL A  L  G +RL    +++  L GF +G WWVQD +AS+P +L G   
Sbjct: 170 DPAQTAEWTVKLGADSLMPGHLRLSRG-QAVHGLEGFEDGAWWVQDLAASLPARLLGDGQ 228

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
               LDLCAAPGGKT QL   G +VTALD+S +RL+ L  NL+R  L AE +I  DAF +
Sbjct: 229 GRRALDLCAAPGGKTLQLAAQGWQVTALDISAKRLKLLEENLERTGLEAE-VIAADAFKW 287

Query: 302 CPK----KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
            P       FDA+L+DAPC++TGT RRHPDVL       I + A  Q +L+ +   ++ P
Sbjct: 288 EPPAENGAKFDAILIDAPCTATGTARRHPDVLHRIGPRQIEQMAEVQARLIERASGWLTP 347

Query: 358 GGIVVFSNCSLDKQDSEEVVQKV-LRSSPIPVELVPLNSAYWKSIDMAMALSP--EGWIR 414
           GG +V++ CSL+ ++ EE  +KV L   P+  E +P              LSP   G +R
Sbjct: 348 GGALVYAVCSLESEEGEEQAEKVWLPREPVSAEELP------------AGLSPTAHGTLR 395

Query: 415 ITPDMLEKIDGVSSGMDGFF 434
             P ML +      G+DGFF
Sbjct: 396 TDPGMLPE----HGGLDGFF 411


>gi|218509188|ref|ZP_03507066.1| probable RNA methyltransferase - sun protein [Rhizobium etli Brasil
           5]
          Length = 250

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 147/222 (66%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +K G+ AR  ++ +L+ V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR L
Sbjct: 29  VKPGLQARAAAAKILAAVVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHL 88

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDA +  +L S LP    +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR F
Sbjct: 89  PRIDAAIASLLESPLPEGARALHHVLSIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRF 148

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVN++LRR+ REK  +L  I  ++ +P WF  RLE  YG++  LAIS + + P  IDL
Sbjct: 149 AKLVNAVLRRLGREKDAVLAEIGKVAPMPSWFLARLEKAYGRDAALAISRSQLEPAAIDL 208

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
           TVK D E WA +LN V LPTGG+RL      I SL GF EG 
Sbjct: 209 TVKSDAEGWAKRLNGVALPTGGVRLAAFDGGIPSLEGFDEGA 250


>gi|85710227|ref|ZP_01041292.1| tRNA and rRNA methylase [Erythrobacter sp. NAP1]
 gi|85688937|gb|EAQ28941.1| tRNA and rRNA methylase [Erythrobacter sp. NAP1]
          Length = 414

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 146/445 (32%), Positives = 225/445 (50%), Gaps = 43/445 (9%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFR-LLSQRDQILVRAIVNVTLRFLP 61
           +G++AR  +  +L  V+R+  +L      +    A R +    DQ L RAI    LR+L 
Sbjct: 5   TGIHARRAALKMLDAVLRRGETLE-----QAAPGALRDVRDANDQALARAIAGEALRWLT 59

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +DA++D      LP      + +LR+ +AQ L L+   +AV+   +             
Sbjct: 60  DLDALIDSATRQRLP-DDAKPRSVLRLMLAQALRLETPPHAVIATGL------------- 105

Query: 122 KLVNSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            L++   RR++      L +    +  +  +PE  +ER    +G +R + I+   + P  
Sbjct: 106 PLLSGGPRRLAHGVFSTLMKREVALPDVPTLPENVRER----WG-DRAVEIAPGLVHPPE 160

Query: 178 IDLTVKFDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
           +DL +K   +T  W  KL    L  G +R+      I SL G+ +G WWVQD +A IP  
Sbjct: 161 VDLHIKDAKQTPQWQAKLGGESLAPGHVRIPRG-SRIESLDGYKDGAWWVQDLAAMIPSM 219

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
           + G       LDLCAAPGGKT  L  +G  VTALD+SKRRL  L+ NL R  L A  +  
Sbjct: 220 VIGEGKG-HALDLCAAPGGKTMALASAGWDVTALDISKRRLGTLKENLKRTGLKASPV-R 277

Query: 296 MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
            DA  + PK  FDA+L+D PC++TGT RRHPDVL       I +    QR L+ +    +
Sbjct: 278 ADAMQWEPKHHFDAILLDTPCTATGTCRRHPDVLHRIGARQIAEMVEIQRGLVARAAELL 337

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           KPGG +V++ CSL++++ EE  Q     S + ++ +P+ +     +   +A + +G +R 
Sbjct: 338 KPGGTLVYAVCSLEREEGEE--QATWIDSELGLQPMPIAA---DELPAGLAPTAQGHVRT 392

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRR 440
            P ML +      G+DGFF    R+
Sbjct: 393 HPGMLPE----QGGLDGFFVARWRK 413


>gi|163739806|ref|ZP_02147213.1| Fmu (Sun) [Phaeobacter gallaeciensis BS107]
 gi|161386840|gb|EDQ11202.1| Fmu (Sun) [Phaeobacter gallaeciensis BS107]
          Length = 421

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 147/444 (33%), Positives = 225/444 (50%), Gaps = 30/444 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +   AR  + HLL  V+ +      LL   Y   A   L   ++   + +   TLR L
Sbjct: 1   MSNATQARRRAIHLLDEVLGE----GKLLSECYAAGALDKLPAEERARTQRLATDTLRNL 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            R D +L   L  + P    ++   LR+   ++     A + VV+  V+   R + +   
Sbjct: 57  ERADRILQKHLKKATP---LTVHNALRIGTVELCQGGAA-HGVVNEMVDIVSRHRRHGKL 112

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
             LVN++LR+V+        ++  +  +P+W +  L   +G   +L I  A ++   +DL
Sbjct: 113 KGLVNAVLRKVADHGPAEWAKLR-VPRLPKWLRSPLSQAWGAPAMLQIEAAHLAGAPLDL 171

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           + K   +  A  L AV+LPTG  R+    + +  LPGFA G WWVQDA+A++P Q+    
Sbjct: 172 SPKPGADLSA--LEAVLLPTGSYRIHNSVQ-VSGLPGFATGDWWVQDAAAALPAQILAAK 228

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
              SVLDLCAAPGGKT Q+  +GA VTA+D S  R+ +L  NL+R  L A  ++  DA +
Sbjct: 229 PGESVLDLCAAPGGKTMQIAAAGANVTAVDQSAGRMARLSENLERTGLEAT-VVVGDALE 287

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
              +  +DAVL+D+PCS+TGTIRRHPD+   +D          Q ++L    S VKPGG 
Sbjct: 288 QTGQ--YDAVLLDSPCSATGTIRRHPDLPHAKDGSGFGALIELQAQMLAHAWSLVKPGGR 345

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA----LSPEGWIRIT 416
           +++  CSL   + E  V+  L       E+ P  S   +  D+A      ++ EG +R+ 
Sbjct: 346 LIYCTCSLLPDEGECQVEDAL-------EMFPDMSVGDRIRDIAGIDPDWITEEGGLRLR 398

Query: 417 PDMLEKIDGVSSGMDGFFAVALRR 440
           PD    +     GMDGF+   LR+
Sbjct: 399 PDYWADL----GGMDGFYMAELRK 418


>gi|209542805|ref|YP_002275034.1| Fmu (Sun) domain-containing protein [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|209530482|gb|ACI50419.1| Fmu (Sun) domain protein [Gluconacetobacter diazotrophicus PAl 5]
          Length = 438

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 143/391 (36%), Positives = 212/391 (54%), Gaps = 31/391 (7%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
           LR +     VL+  L    P     ++ +L + VAQIL+LD   +A V  AV  A+R + 
Sbjct: 71  LRHMGTAGMVLEPFLKKEPP---LPVRTVLLIGVAQILFLDTPAHAAVGTAVSLARR-RG 126

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLA--ISDACI 173
              FA LVN++LRRV++     L+ +    + +P W        +G    LA  +++A  
Sbjct: 127 LVPFAGLVNAVLRRVAQAGAGALEGLDQARLDVPPWL-------WGAWGSLARPVAEALG 179

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLT++  +         VMLPTG +RL      +  LPG+A+G +WVQDA+A++P
Sbjct: 180 QEAPLDLTLRPGLPEAERPPGGVMLPTGTLRLPAG-TRVADLPGYAQGAFWVQDAAAALP 238

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE-D 292
            +L        + DLCAAPGGKTAQL V+GA+VTA++    RL +L+ NLDRL L     
Sbjct: 239 ARLLAPRAGERIADLCAAPGGKTAQLAVAGAEVTAIEREPGRLARLKENLDRLGLADRVQ 298

Query: 293 IIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
           +++ DA  + P    DAVL+DAPCS+TGT RRHPDVLW +   D+      Q +LL    
Sbjct: 299 LVQGDAATWRPDAPLDAVLLDAPCSATGTARRHPDVLWIKRPRDLTALTEGQDRLLAAAR 358

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM---ALSP 409
             ++PGG +V++ CSL  ++  E V+          E + L    + + ++A+   AL+ 
Sbjct: 359 DMLRPGGRLVYAVCSLQPEEGPERVRA--------AEAMGLEPDPFTAEELAVLPEALTK 410

Query: 410 EGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           EGW+R  P +  +      GMDGFFA   RR
Sbjct: 411 EGWLRTHPGLWTE----QGGMDGFFAARFRR 437


>gi|221640599|ref|YP_002526861.1| Fmu (Sun) domain-containing protein [Rhodobacter sphaeroides KD131]
 gi|221161380|gb|ACM02360.1| Fmu (Sun) domain protein [Rhodobacter sphaeroides KD131]
          Length = 410

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 137/392 (34%), Positives = 210/392 (53%), Gaps = 30/392 (7%)

Query: 52  IVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQA 111
           + +  LR L   D +L   L  + P    +++ +LR++  ++     A + VV  AV+ A
Sbjct: 45  LASSVLRHLGPADRLLAPHLRKAPP---LTVRNILRLATVEMAADGAAPHGVVSSAVDLA 101

Query: 112 KRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
           +R +  +H A LVN++LRR++      L        +P W ++ L   +G+  V AI   
Sbjct: 102 RRGRRTQHLAGLVNAVLRRIAPASFAGLP----AQHLPMWLRQPLVRRWGRAVVTAIEAV 157

Query: 172 CISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
             +P  +DLT +  +      L     PTG  RL+  P  + +LPG+  G WWVQDA+A+
Sbjct: 158 QAAPPPLDLTARPGLSAPGEPL-----PTGSFRLRA-PGQVSALPGYEAGEWWVQDAAAA 211

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE 291
           + V+L       SV DLCAAPGGKT QL  +GA+VTALD+S+ RL +LR NL R  L AE
Sbjct: 212 LAVKLLDPQPGESVADLCAAPGGKTLQLAAAGARVTALDISEARLGRLRENLARTGLQAE 271

Query: 292 DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQG 351
            ++  D   +     F+A+L+DAPCS+TGTIRRHPD+ + +D  ++      Q  +L   
Sbjct: 272 -VVAADLLTWQ-GGPFEAILLDAPCSATGTIRRHPDLPFVKDGSELPGLVALQAAMLDHA 329

Query: 352 ISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-IPVE--LVPLNSAYWKSIDMAMALS 408
           +  + PGG +VF  CSL +++ E  +  +L   P + VE   +P     W        + 
Sbjct: 330 LHLLAPGGRLVFCTCSLLEEEGEAQLAALLGRHPELTVERPALPGVEPGW--------IG 381

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            EG +R+ PD+  +    + GMDGFF   +RR
Sbjct: 382 AEGGLRLRPDLWAE----AGGMDGFFMARVRR 409


>gi|146278958|ref|YP_001169117.1| Fmu (Sun) domain-containing protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145557199|gb|ABP71812.1| Fmu (Sun) domain protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 422

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 233/442 (52%), Gaps = 44/442 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLT-CLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            AR ++  LL  V+ +R  L+  + +L     A R  +QR       +    LR L   D
Sbjct: 17  EARGMAVALLDAVLGERRLLSQAVGELPSAGPAERARAQR-------LALTALRHLDPAD 69

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            +L   L  + P    +++ +LR++V ++     A + VV+ AV+ A+R +  +H A LV
Sbjct: 70  RLLSPHLRKAPP---LTVRNILRLAVVEMAVEGAAPHGVVNAAVDLARRGRRTQHLAGLV 126

Query: 125 NSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF 184
           N++LR+++      L        +P W ++ L   +G+  V AI     +   +DLT K 
Sbjct: 127 NAVLRKIAPASFAGLP----AQRMPMWLRQPLVRRWGRGVVAAIEAVQAAAPPLDLTAKP 182

Query: 185 DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLS 244
                        LPTG  RL+E P  + +LPGF  G WWVQDA+A++ V+L        
Sbjct: 183 -----GRIAPGEPLPTGSFRLRE-PGQVSALPGFEAGDWWVQDAAAALAVRLLDPQPGER 236

Query: 245 VLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD--AFDYC 302
           + DLCAAPGGKT QL  +GA+VTALD+S+ RL +LR NL R  L AE ++  D  A++  
Sbjct: 237 IADLCAAPGGKTLQLAAAGAEVTALDLSEPRLVRLRENLARTGLQAE-VVAADLLAWEGG 295

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P   FDAVL+DAPCS+TGTIRRHPD+ + +D  ++      Q  +L + +  +KPGG +V
Sbjct: 296 P---FDAVLLDAPCSATGTIRRHPDLPFVKDGSELPALVALQSAMLDRALGMLKPGGRLV 352

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPI----PVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           F  CSL +++ E  +  +L   P     P  L  +   +         + PEG +R+ PD
Sbjct: 353 FCTCSLLEEEGEAQLSALLERHPALRVEPPSLAGIEPGW---------VGPEGGLRLRPD 403

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
              +    + GMDGF+ V +R+
Sbjct: 404 HWAE----AGGMDGFYMVRVRK 421


>gi|332559578|ref|ZP_08413900.1| Fmu (Sun) domain-containing protein [Rhodobacter sphaeroides WS8N]
 gi|332277290|gb|EGJ22605.1| Fmu (Sun) domain-containing protein [Rhodobacter sphaeroides WS8N]
          Length = 410

 Score =  207 bits (527), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 136/391 (34%), Positives = 209/391 (53%), Gaps = 28/391 (7%)

Query: 52  IVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQA 111
           + +  LR L   D +L   L  + P    +++ +LR++  ++     A + VV  AV+ A
Sbjct: 45  LASSVLRHLGPADRLLAPHLRKAPP---LTVRNILRLATVEMAADGAAPHGVVSSAVDLA 101

Query: 112 KRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
           +R +  +H A LVN++LRR++      L        +P W ++ L   +G+  V AI   
Sbjct: 102 RRGRRTQHLAGLVNAVLRRIAPASFAGLP----AQHLPMWLRQPLVRRWGRAVVTAIEAV 157

Query: 172 CISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
             +P  +DLT +  +      L     PTG  RL+  P  + +LPG+  G WWVQDA+A+
Sbjct: 158 QAAPPPLDLTARPGLSAPGEPL-----PTGSFRLRA-PGQVSALPGYEAGEWWVQDAAAA 211

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE 291
           + V+L       SV DLCAAPGGKT QL  +GA+VTALD+S+ RL +LR NL R  L AE
Sbjct: 212 LAVKLLDPQPGESVADLCAAPGGKTLQLAAAGARVTALDISEARLGRLRENLARTGLQAE 271

Query: 292 DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQG 351
            ++  D   +     F+A+L+DAPCS+TGTIRRHPD+ + +D  ++      Q  +L   
Sbjct: 272 -VVAADLLTWQ-GGPFEAILLDAPCSATGTIRRHPDLPFVKDGSELPGLVALQAAMLDHA 329

Query: 352 ISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA--LSP 409
           +  + PGG +VF  CSL +++ E  +  +L   P   EL    +  W ++       +  
Sbjct: 330 LHLLAPGGRLVFCTCSLLEEEGEAQLAALLERHP---EL----TVEWPTLPGVEPDWIGA 382

Query: 410 EGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           EG +R+ PD   +    + GMDGFF   +RR
Sbjct: 383 EGGLRLRPDFWAE----AGGMDGFFMARVRR 409


>gi|126463525|ref|YP_001044639.1| Fmu (Sun) domain-containing protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105189|gb|ABN77867.1| Fmu (Sun) domain protein [Rhodobacter sphaeroides ATCC 17029]
          Length = 410

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 137/392 (34%), Positives = 209/392 (53%), Gaps = 30/392 (7%)

Query: 52  IVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQA 111
           + +  LR L   D +L   L  + P    +++ +LR++  ++     A + VV  AV+ A
Sbjct: 45  LASSVLRHLGPADRLLAPHLRKAPP---LTVRNILRLATVEMAADGAAPHGVVSSAVDLA 101

Query: 112 KRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
           +R +  +H A LVN++LRR++      L        +P W ++ L   +G+  V AI   
Sbjct: 102 RRGRRTQHLAGLVNAVLRRIAPASFAGLP----AQHLPMWLRQPLVRRWGRAVVTAIEAV 157

Query: 172 CISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
             +P  +DLT +  +      L     PTG  RL+  P  + +LPG+  G WWVQDA+A+
Sbjct: 158 QAAPPPLDLTARPGLSAPGEPL-----PTGSFRLRA-PGQVSALPGYEAGEWWVQDAAAA 211

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE 291
           + V+L       SV DLCAAPGGKT QL  +GA+VTALD+S+ RL +LR NL R  L AE
Sbjct: 212 LAVKLLDPQPGESVADLCAAPGGKTLQLAAAGARVTALDISEARLGRLRENLARTGLQAE 271

Query: 292 DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQG 351
            ++  D   +     F+A+L+DAPCS+TGTIRRHPD+ + +D  ++      Q  +L   
Sbjct: 272 -VVAADLLTWQ-GGPFEAILLDAPCSATGTIRRHPDLPFVKDGSELPGLVALQAAMLDHA 329

Query: 352 ISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-IPVE--LVPLNSAYWKSIDMAMALS 408
           +  + PGG +VF  CSL +++ E  +  +L   P + VE   +P     W        + 
Sbjct: 330 LGLLAPGGRLVFCTCSLLEEEGEAQLAALLERHPELTVERPTLPGVEPDW--------IG 381

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            EG +R+ PD   +    + GMDGFF   +RR
Sbjct: 382 AEGGLRLRPDFWAE----AGGMDGFFMARVRR 409


>gi|110678030|ref|YP_681037.1| rRNA methyltransferase RsmB [Roseobacter denitrificans OCh 114]
 gi|109454146|gb|ABG30351.1| rRNA methyltransferase RsmB [Roseobacter denitrificans OCh 114]
          Length = 423

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 145/443 (32%), Positives = 223/443 (50%), Gaps = 30/443 (6%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR  + +LL  ++ +   ++ LL     D     L   D+     +   TLR L R
Sbjct: 4   TGLPARRSAVYLLDQILGEGRLMSELLTAGTLDK----LEPEDRARAARLAQDTLRGLER 59

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D +L   L    P    +++  LRV   + L    A + VV+  VE   R K   H   
Sbjct: 60  ADRILQKHLSKYPP---LTVRNALRVGAVE-LCTGTAAHGVVNAMVELVSRHKHYSHLKG 115

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L N++LR+V+ +       +    + P+W +  L   +G + +  +  A  +   +DLT 
Sbjct: 116 LTNAVLRKVAADGPAAWDALRAPRL-PKWLRGPLVEAWGADAMARMEIAHFAGAPLDLTA 174

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D    A      +LPTG +R++   + + ++PGF++G WWVQDA+A++PV++      
Sbjct: 175 KSDASAIAALTGGTVLPTGSVRVENAGQ-VSAMPGFSDGTWWVQDAAAALPVRILAPQPG 233

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            +VLDLCAAPGGKT QL  +GA+VTA+D S  R+ ++  NL R  L AE +++ DA    
Sbjct: 234 ETVLDLCAAPGGKTMQLAAAGARVTAVDDSSVRMGRVAENLARTGLKAEVLVQ-DA--RA 290

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
               FDAVL+DAPCS+TGTIRRHPD+   +D  +       Q +L+      VKPGG +V
Sbjct: 291 TSGTFDAVLLDAPCSATGTIRRHPDLPHAKDGSEFGDLIAMQSELIDHAWDRVKPGGRLV 350

Query: 363 FSNCSLDKQDSEEVVQKVL-RSSPIPVEL----VPLNSAYWKSIDMAMALSPEGWIRITP 417
           F  CSL   + E  V + L R   +  +     VP     W+        + EG +R+ P
Sbjct: 351 FCTCSLLPDEGEVQVDEALERHEDMRTDADALGVPGVDPAWR--------TSEGGLRLRP 402

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
           D    +     G+DGF+   LR+
Sbjct: 403 DYWSDL----GGLDGFYIAVLRK 421


>gi|126738334|ref|ZP_01754055.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseobacter sp. SK209-2-6]
 gi|126720831|gb|EBA17536.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseobacter sp. SK209-2-6]
          Length = 432

 Score =  206 bits (525), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 150/444 (33%), Positives = 224/444 (50%), Gaps = 36/444 (8%)

Query: 4   GMNARLVSSHLLSCVMRK-RISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           G+ AR    +LL  V+ + R+   C     Y   A   L+  ++   + +   TLR L R
Sbjct: 16  GIPARRTVIYLLDQVLGEGRLLSEC-----YAAGALERLAPDERARAQRLAAETLRSLER 70

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D +L   L  S P    ++   LR+   ++     A + VV+  V    + + +     
Sbjct: 71  ADRILQKHLKKSTP---LTVHNALRLGTVELCQGGAA-HGVVNAMVTIISKHRRHGKLKG 126

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN++LR+V+ +     Q++  +  +P+W +  L   +G E ++AI  A  +   IDLT 
Sbjct: 127 LVNAVLRKVAEQGPAEWQKLR-VPRLPKWLRSPLAEAWGNEAMMAIEAAHFTGAPIDLTG 185

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K   +  A  L    L TG  RL E  + + +LPG+  G WWVQDA+A++P Q+      
Sbjct: 186 KRGADLSA--LPGKRLATGSFRLAEAGQ-VSALPGYEAGDWWVQDAAAALPAQMLDAKPG 242

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             VLDLCAAPGGKT Q+  +GA+V A+D S  R+E+L+ NL R  L A D+I  DA +  
Sbjct: 243 ERVLDLCAAPGGKTMQMAEAGAQVLAVDTSASRMERLQENLTRTGLNA-DLIVGDALEQT 301

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
            +  +DAVL+DAPCS+TGTIRRHPD+   +D          Q ++L    S VKPGG +V
Sbjct: 302 GQ--YDAVLLDAPCSATGTIRRHPDLPHAKDGSGFGALIELQAQMLAHAWSLVKPGGRLV 359

Query: 363 FSNCSLDKQDSEEVVQKVLRSSP------IPVELVPLNSAYWKSIDMAMALSPEGWIRIT 416
           +  CSL   + E  V++ L   P        VEL P     W        ++ EG +R+ 
Sbjct: 360 YCTCSLLPDEGECQVEEALDMFPDMTVDRSAVEL-PGVEPDW--------ITEEGGLRLR 410

Query: 417 PDMLEKIDGVSSGMDGFFAVALRR 440
           PD          G+DGF+   LR+
Sbjct: 411 PDYWSD----RGGIDGFYMALLRK 430


>gi|260432196|ref|ZP_05786167.1| Fmu [Silicibacter lacuscaerulensis ITI-1157]
 gi|260416024|gb|EEX09283.1| Fmu [Silicibacter lacuscaerulensis ITI-1157]
          Length = 387

 Score =  206 bits (523), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 121/350 (34%), Positives = 197/350 (56%), Gaps = 13/350 (3%)

Query: 36  SAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILY 95
            A   L+  D+   + +   TLR L R D +L+  L  +      ++Q  LR+   ++  
Sbjct: 33  GALDRLAPEDRARAQRLTLETLRGLERADRLLEGHLRRT---PALTVQNALRLGTVELCQ 89

Query: 96  LDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKER 155
            + A + VV+  VE   R +++     LVN++LR+++ E  E   ++  +  +P+W +E 
Sbjct: 90  GEAA-HGVVNAMVEIVGRSRKHGRLKGLVNAVLRKIAAEGPEAWPKMR-VPRLPDWLREP 147

Query: 156 LENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSL 215
           L   +G E V  +  A  +   +DLT K    + A       LPTG +R+ +  + + +L
Sbjct: 148 LIAAWGAEAVKGMEQAHFAGAPLDLTPK----SGATIPMGTELPTGSVRVTDAGQ-VSAL 202

Query: 216 PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRR 275
           PG+A G WWVQDA+A++P ++        VLD+CAAPGGKT QL  +GA VTALD+S+ R
Sbjct: 203 PGYAAGDWWVQDAAAALPGRILAARPGERVLDMCAAPGGKTLQLAAAGAVVTALDISEAR 262

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           L ++R NL+R  L A+ ++  DA D+  +  +DA+L+DAPCS+TGTIRRHPD+ + +D  
Sbjct: 263 LARVRENLERTGLSAQ-VVAGDALDH--QGQYDAILLDAPCSATGTIRRHPDLPFAKDGS 319

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           +       Q ++L    + +KPGG +V+  CSL   + E  +++ L   P
Sbjct: 320 EFGGLIALQARMLAHAWTLLKPGGRLVYCTCSLLPDEGEVQIEEALPQHP 369


>gi|163734256|ref|ZP_02141696.1| rRNA methyltransferase RsmB [Roseobacter litoralis Och 149]
 gi|161392264|gb|EDQ16593.1| rRNA methyltransferase RsmB [Roseobacter litoralis Och 149]
          Length = 423

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 144/444 (32%), Positives = 221/444 (49%), Gaps = 32/444 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ AR  + +LL  ++ +   ++ LL     D     L   D+     +   TLR L R
Sbjct: 4   TGLPARRSAVYLLDQILGEGRLMSELLTAGTLDK----LEPEDRARAARLAQDTLRGLER 59

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D +L   L    P    +++  LRV   + L    A + VV+  VE   R K   H   
Sbjct: 60  ADRILQKHLSKYPP---LTVRNALRVGAFE-LCTGTAAHGVVNAMVELVSRHKHYSHLKG 115

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L N++LR+V+ +       +     +P+W +  L   +G + +  +  A  +   +DLT 
Sbjct: 116 LTNAVLRKVAADGPTAWDALR-PPRLPKWLRGPLVEAWGADAMARMDIAHFAGAPLDLTA 174

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D    A      +LPTG +R+    + + ++PGF++G WWVQDA+A++PV++      
Sbjct: 175 KSDAPAVAALTGGTLLPTGSVRIANAGQ-VSAMPGFSDGTWWVQDAAAALPVRILAPQPG 233

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
            +VLDLCAAPGGKT QL  +GA VTA+D S  R+ ++  NL R  L A+ +++ DA    
Sbjct: 234 ETVLDLCAAPGGKTMQLAAAGAMVTAVDDSSVRMGRVEENLARTGLKAKTLVQ-DA--QI 290

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
               FDAVL+DAPCS+TGTIRRHPD+   +D  +       Q  L+      VKPGG +V
Sbjct: 291 TTGTFDAVLLDAPCSATGTIRRHPDLPHAKDGSEFGDLIAMQADLIDHAWGCVKPGGRLV 350

Query: 363 FSNCSLDKQDSEEVVQKVL------RSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRIT 416
           F  CSL   + E  +   L      R+    +E+  ++ A+  S         EG +R+ 
Sbjct: 351 FCTCSLLPDEGEVQIDDALERHADMRTDADALEIPGVDPAWRTS---------EGGLRLR 401

Query: 417 PDMLEKIDGVSSGMDGFFAVALRR 440
           PD    +     GMDGF+   LR+
Sbjct: 402 PDYWSDL----GGMDGFYIAVLRK 421


>gi|58040030|ref|YP_191994.1| rRNA methyltransferase RsmB [Gluconobacter oxydans 621H]
 gi|58002444|gb|AAW61338.1| rRNA methyltransferase RsmB [Gluconobacter oxydans 621H]
          Length = 447

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/400 (35%), Positives = 216/400 (54%), Gaps = 25/400 (6%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           +  RD+     +   TLR L  +  +L  +L    P     ++  L + VAQ+L+L+   
Sbjct: 68  MDARDRASAHRLAATTLRHLGSMTELLQPLLRREPPE---PVRCALLMGVAQLLHLETPP 124

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENF 159
           +A V   V+  +R +    FA L N++LRRV+RE  ELL  +    + +P W    L + 
Sbjct: 125 HAAVGTIVDLLRR-RGLAPFAGLANAVLRRVAREGQELLDGLDEDRLDVPPW----LWSA 179

Query: 160 YGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFA 219
           +GK R  AIS        +DLT++             +LPTG +R       I +L GF 
Sbjct: 180 WGK-RARAISRGLHREAPLDLTLRPGA---VAPEGGEVLPTGSVRYPAG-TRITTLEGFE 234

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKL 279
           +G +W QD +A++PV+L G +   +V+DLCAAPGGKTAQL  +GA V A++  + R ++L
Sbjct: 235 DGAFWAQDVAATMPVKLMGDVAGKTVVDLCAAPGGKTAQLATAGAHVVAVEREEARAKRL 294

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
             N+ RL L A+ ++  DA  + P+   D VL+DAPCS+TGT+RRHPDVLW +   D+  
Sbjct: 295 EENIVRLKLSAKTVV-ADAATWRPQTPVDMVLLDAPCSATGTLRRHPDVLWIKRPRDVTA 353

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSL-DKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
            A  Q  L+      +KPGG+++++ CSL D++  E +   + R      +  P + A  
Sbjct: 354 LAEGQDALIDAAHEMLKPGGVLLYAVCSLQDEEGPERIKAAIARGG---WKFDPFSEA-- 408

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +  DMA+A + +G  R  P +  ++     GMDGFFA  L
Sbjct: 409 ELADMAVARTWDGMFRTHPGLWSEL----GGMDGFFAARL 444


>gi|114328418|ref|YP_745575.1| 16S rRNA m(5)C 967 methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
 gi|114316592|gb|ABI62652.1| 16S rRNA m(5)C 967 methyltransferase [Granulibacter bethesdensis
           CGDNIH1]
          Length = 452

 Score =  204 bits (518), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 144/391 (36%), Positives = 220/391 (56%), Gaps = 27/391 (6%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           TLR L  IDAVL+  L    P     ++ +LR+  A +L+LD   +A V  AV+ A++ +
Sbjct: 78  TLRRLGTIDAVLEPFLRREPP---APVRDILRLGAAGLLFLDTPPHAAVGTAVDLARQLR 134

Query: 116 ENRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKE-RVLAISDACI 173
               F  L+N++LR+V+    E+L  +    +  P W    L   +G++ R +A++    
Sbjct: 135 LA-PFTGLINAVLRKVATGGQEMLNGLDSPRLDTPGW----LWTAWGRDARAIALAHQTE 189

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVS-LPGFAEGVWWVQDASASI 232
           +PL  DLT++  I   A     ++LP G IRL   P + VS LPGF EG +WVQDA+AS+
Sbjct: 190 APL--DLTLRPGITPPA---EGILLPNGTIRLP--PGTRVSILPGFEEGAFWVQDAAASL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAED 292
           P +L        ++DLCAAPGGKTAQL +SGA+V A++    R+ +LR NL RL L  + 
Sbjct: 243 PARLLAAREGEKIVDLCAAPGGKTAQLAMSGAEVIAVEREAVRVPRLRENLARLRLDVQ- 301

Query: 293 IIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
           +   DA ++ P   F  DA+L+DAPCS+TGTIRRHPDV   +   DI      Q +LL  
Sbjct: 302 VAVADAAEWTPPAGFVPDAILLDAPCSATGTIRRHPDVPHLKRQRDITALTAQQDRLLAA 361

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
            ++ ++PGG ++++ CS+  ++  + ++  L++ P  V L P        +  A   + E
Sbjct: 362 ALAMLRPGGRLIYAVCSMQPEEGRQRIEHALKTLPS-VTLSPFTVEELAFLPGAR--TAE 418

Query: 411 GWIRITPDM-LEKIDGVS--SGMDGFFAVAL 438
           G++R  P +     +G    +GMDGFFA  L
Sbjct: 419 GYLRTHPGLAFAGPEGSPPITGMDGFFAARL 449


>gi|254476801|ref|ZP_05090187.1| Fmu [Ruegeria sp. R11]
 gi|214031044|gb|EEB71879.1| Fmu [Ruegeria sp. R11]
          Length = 420

 Score =  203 bits (517), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 156/441 (35%), Positives = 228/441 (51%), Gaps = 24/441 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRK-RISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M +G +AR  + +LL  V+ + R+   C     Y   A   L+  D+   + +   TLR 
Sbjct: 1   MSNGTHARRRAIYLLDQVLGEGRLLSEC-----YAAGALDKLAPEDRARAQRLAADTLRN 55

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           L R D VL   L  S P     +   LR+   ++     A + VV+  V      K +  
Sbjct: 56  LERADRVLQKHLKKSTP---LMVHNALRIGTVELCQGGAA-HGVVNEMVNIVAAHKRHGK 111

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
              LVN++LR+V+ +      ++  +  +P+W +  L   +G   +L I  A  +   +D
Sbjct: 112 LKGLVNAVLRKVADQGPTEWAKLR-VPRLPKWLRSPLSQAWGAPAMLEIEAAHAAGAPLD 170

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           LT K  ++  A  L+AV LPTG  RL    + + +LPGFAEG WWVQDA+A++P QL   
Sbjct: 171 LTAKPGVDLSA--LDAVKLPTGSYRLHGSVQ-VSNLPGFAEGNWWVQDAAAALPAQLLAA 227

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
                VLDLCAAPGGKT Q+  SGA VTA+D S+ R+ +LR NL+R  L A  ++  DA 
Sbjct: 228 KPGEKVLDLCAAPGGKTMQMAASGADVTAVDQSEGRMARLRENLERTGLSAT-VVVGDAL 286

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           +   +  +DAVL+DAPCS+TGTIRRHPD+   +D     +    Q ++L    S VKPGG
Sbjct: 287 EETGQ--YDAVLLDAPCSATGTIRRHPDLPHAKDGSGFGELIELQAQMLAHAWSLVKPGG 344

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL   + E  ++  L     P   V         ID A  ++ EG +R+ PD 
Sbjct: 345 RLVYCTCSLLPDEGECQIEDALDM--FPDMQVGEGLRNLAGIDPAW-ITDEGGLRLRPDY 401

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
              +     GMDGF+   LR+
Sbjct: 402 WPDL----GGMDGFYLAELRK 418


>gi|258541970|ref|YP_003187403.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633048|dbj|BAH99023.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256636105|dbj|BAI02074.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256639160|dbj|BAI05122.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256642214|dbj|BAI08169.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256645269|dbj|BAI11217.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256648324|dbj|BAI14265.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256651377|dbj|BAI17311.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256654368|dbj|BAI20295.1| tRNA/rRNA cytosine-C5-methylase Nol1/Nop2/Sun [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 440

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 129/390 (33%), Positives = 200/390 (51%), Gaps = 22/390 (5%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           TLR +  +  VL+  L    P     ++  L +  AQ+L+L+   +A V   V   +R K
Sbjct: 72  TLRHMGTLRTVLEPFLRKEPPE---PVRVALMIGCAQLLFLETPPHAAVGTTVSLLRRRK 128

Query: 116 ENRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACIS 174
               FA L N++LR+V+ E   +L+ +    + IP W      +  G+    AI++    
Sbjct: 129 LA-PFAGLANAVLRKVAAEGQNVLEGLDQARLNIPAWLWSSW-SVLGRGVPRAIAEGISH 186

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
              +D+T++            ++LP G +R       +  L G+ EG +WVQDA+A++P 
Sbjct: 187 EAPLDITLRPGATA---PEGGIVLPNGSVRYPAG-TRVADLAGYEEGAFWVQDAAATLPA 242

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
           +L        V DLCAAPGGKTAQL V+GA+V A++ +  R+ +L+ NL RL L     +
Sbjct: 243 RLLNVKEGEKVADLCAAPGGKTAQLAVTGAQVAAIENNPNRMARLKENLARLGLGNVITL 302

Query: 295 EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISF 354
           + DA  + P    DA+L+DAPCS+TGT RRHPDVLW +   D+      Q +LL    + 
Sbjct: 303 QADAGTWQPDAPLDAILLDAPCSATGTARRHPDVLWVKRPRDLTTLTAGQDRLLEAAKNM 362

Query: 355 VKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIR 414
           ++PGG +V++ CSL +++  +  +       +P    P   A+     +  A +PEGW+R
Sbjct: 363 LRPGGRLVYAVCSLQQEEGPDRARAAEAMGLVPDPFTPEELAF-----LPEARTPEGWLR 417

Query: 415 ITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
             P M          MDGFFA    R I+P
Sbjct: 418 THPGMWAD----KGSMDGFFAA---RFIRP 440


>gi|103486536|ref|YP_616097.1| Fmu (Sun) [Sphingopyxis alaskensis RB2256]
 gi|98976613|gb|ABF52764.1| Fmu (Sun) [Sphingopyxis alaskensis RB2256]
          Length = 437

 Score =  202 bits (514), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 153/442 (34%), Positives = 235/442 (53%), Gaps = 38/442 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R  +  LL  ++R+   L   +      +A + L   D+    AI +  LR++  I
Sbjct: 24  GLAPRRAALRLLDAIVRRGDPLDVAMH-----AAAQGLVGADRAFAVAIASEALRWMTDI 78

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           DA++D      LP    S + +LR+++AQ+L L    +AVV  A+     D   R   +L
Sbjct: 79  DALVDGATAQPLPDDVKS-RAVLRIALAQLLVLKSPGHAVVATALPLV--DGGPR---RL 132

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           V++IL R  +EK EL  R +    +P    ER    +G   + A +++   P  IDL+  
Sbjct: 133 VHAILSRAQKEKWELPARAS----LPPAAAERWTAQWGATMIEAAAESWSVPPPIDLSFA 188

Query: 184 FDI--ETWAHKLNAVMLPTGGIRLKELP--ESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            +   + W    +AV L     R + LP  +++ ++PGFAEG WWVQD +AS+P +L G 
Sbjct: 189 AEPAPDEWP---DAVAL---APRHRRLPRGQAVEAMPGFAEGGWWVQDLAASLPARLLGA 242

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
               ++LDLCAAPGGKT QL  +   VTA+D S RRLE+LR NL R  L A  I++ D  
Sbjct: 243 GAGRTILDLCAAPGGKTMQLAAANWAVTAVDSSARRLERLRANLTRTGLAAT-IVQGDIR 301

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
            + P    DAVL+DAPCS+TG  RRHPDV+   +   I + A  Q  LL +   +VKPGG
Sbjct: 302 TWEPDAAADAVLLDAPCSATGIFRRHPDVIHRIEPRQIEEMATLQAGLLARAAKWVKPGG 361

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPE--GWIRITP 417
            +V++ CSL++ + E+ V   L +         +++A  +  ++A  ++P+  G +R  P
Sbjct: 362 TLVYATCSLERAEGEDQVAAFLDAH----RGWAIDAA--RPDELATGITPDINGCVRTLP 415

Query: 418 DMLEKIDGVSSGMDGFFAVALR 439
             +      + G+DGFF   LR
Sbjct: 416 GQIAD----AGGLDGFFIARLR 433


>gi|329114269|ref|ZP_08243031.1| Ribosomal RNA small subunit methyltransferase B [Acetobacter
           pomorum DM001]
 gi|326696345|gb|EGE48024.1| Ribosomal RNA small subunit methyltransferase B [Acetobacter
           pomorum DM001]
          Length = 462

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 126/386 (32%), Positives = 194/386 (50%), Gaps = 19/386 (4%)

Query: 56  TLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDK 115
           TLR L  +  VL+  L    P     ++  L +  AQ+L+L+   +A V   V   +R K
Sbjct: 94  TLRHLGTLRTVLEPFLRKEPPEP---VRVALMIGCAQLLFLETPPHAAVGTTVSLLRRRK 150

Query: 116 ENRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACIS 174
               FA L N++LR+V+ E   +L+ +    + IP W      +  G+    AI++    
Sbjct: 151 LA-PFAGLANAVLRKVAAEGQNVLEGLDQARLNIPAWLWSSW-SVLGRGVPRAIAEGISH 208

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
              +D+T++            ++LP G +R       +  L G+ EG +WVQDA+A+ P 
Sbjct: 209 EAPLDITMRPGATA---PEGGIVLPNGSVRYPAG-TRVAELAGYEEGAFWVQDAAATFPA 264

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
           +L        V DLCAAPGGKTAQL  +GA V+A++ +  R+ +L+ NL RL       +
Sbjct: 265 RLLNVQAGEKVADLCAAPGGKTAQLAATGAHVSAIENNPNRMARLKENLARLGFTNVTTL 324

Query: 295 EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISF 354
           + DA  + P    DA+L+DAPCS+TGT RRHPDVLW +   D+      Q +LL    + 
Sbjct: 325 QADAGTWQPDAPLDAILLDAPCSATGTARRHPDVLWVKRPRDLTTLTAGQDRLLEAAKNM 384

Query: 355 VKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIR 414
           ++PGG +V++ CSL +++  +  +       +P    P   A+     +  A +PEGW+R
Sbjct: 385 LRPGGRLVYAVCSLQQEEGPDRARAAEAMGLVPDPFTPEELAF-----LPEARTPEGWLR 439

Query: 415 ITPDMLEKIDGVSSGMDGFFAVALRR 440
             P M          MDGFFA    R
Sbjct: 440 THPGMWAD----KGSMDGFFAARFTR 461


>gi|296114826|ref|ZP_06833475.1| Fmu (Sun) domain protein [Gluconacetobacter hansenii ATCC 23769]
 gi|295978640|gb|EFG85369.1| Fmu (Sun) domain protein [Gluconacetobacter hansenii ATCC 23769]
          Length = 438

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 141/405 (34%), Positives = 206/405 (50%), Gaps = 26/405 (6%)

Query: 39  RLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDV 98
           R    RD+     +    LR +     VL   L    P     ++ +L + VAQ+L+L  
Sbjct: 56  RQAEPRDRAAAHRLGASVLRHMGTATEVLSPFLKKEPPE---PVRAVLLIGVAQLLFLGT 112

Query: 99  ADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLE 157
             +A V  +V  A+R +    FA LVN++LRR++++    L  +    + +P W    L 
Sbjct: 113 PVHAAVATSVALARR-RGLAPFAGLVNAVLRRIAQKGDGCLDGLDQERLDVPPW----LW 167

Query: 158 NFYGK-ERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLP 216
             +G+  R +A +     PL  DL+++             +LP G +R       +  LP
Sbjct: 168 ASWGRMARPIAAALGTEPPL--DLSMRPGC---LPPPGGELLPNGTVRFAAG-TRVTELP 221

Query: 217 GFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRL 276
           GFAEG +WVQDA+AS+P +L        V DLCAAPGGKTAQL ++GA VTA++   RRL
Sbjct: 222 GFAEGAFWVQDAAASLPARLLDAKAGERVADLCAAPGGKTAQLALAGADVTAVERDPRRL 281

Query: 277 EKLRCNLDRLHLY-AEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           E+L  NL RL L     +++ DA  + P    DAVL+DAPCS+TGT+RRHPD LW +   
Sbjct: 282 ERLGANLARLQLGDVVKVVQADATQWRPDAPLDAVLLDAPCSATGTVRRHPDALWIKRPR 341

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D+   A  Q+ LL      ++PGG +V++ CSL  ++     +       I     P   
Sbjct: 342 DLAALAAGQQALLKAAGDMLRPGGRLVYAVCSLQPEEGPACARAAEEMGLIADPFTPEEL 401

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           A+     +  A +PEGW+R  P M  +      GMDGFFA   R+
Sbjct: 402 AF-----LPQARTPEGWVRTHPGMWAE----QGGMDGFFAARFRK 437


>gi|326388835|ref|ZP_08210417.1| Fmu (Sun) [Novosphingobium nitrogenifigens DSM 19370]
 gi|326206435|gb|EGD57270.1| Fmu (Sun) [Novosphingobium nitrogenifigens DSM 19370]
          Length = 406

 Score =  199 bits (505), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 139/404 (34%), Positives = 211/404 (52%), Gaps = 34/404 (8%)

Query: 45  DQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVV 104
           D+ L  AI    LR+L  +DA++D     +LP    + + +LR+ + Q+L L +  +AV+
Sbjct: 28  DRALALAIAQEALRWLADLDALIDGATRLTLPEDAKA-RTVLRLMLVQVLRLGLPPHAVI 86

Query: 105 DLAVE---QAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYG 161
              +       R   +  F+ +V S     + +  +LL  +     +PE    R    +G
Sbjct: 87  ATGLPLLVGGPRRLAHGVFSTIVGS-----ADKGADLLPPV---PSLPEAVAARWGLAWG 138

Query: 162 KERVLAISDACISPLYIDLTVKFDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFA 219
            ER  AI+     P  +DLT+     T  WA +L    L  G +RL    +++ +L G+ 
Sbjct: 139 -ERAQAIAAGIAVPPPLDLTLADSEATGQWAERLGGTSLMPGHVRLPRG-QAVETLAGYE 196

Query: 220 EGVWWVQDASASIPVQLFGTLNNLS-VLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEK 278
           EG WWVQD +A++P +L G        LDLCAAPGGKT Q+  +G +VTALD S RRLE+
Sbjct: 197 EGAWWVQDLAAALPARLLGQPQGAGRALDLCAAPGGKTLQIAAAGWQVTALDKSARRLER 256

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           L  NL+R  L A  ++  DA  + P+  FDA+LVDAPCS+TGT RRHPDVL       I 
Sbjct: 257 LSANLERTGLAAT-VVAADALTWEPEAPFDAILVDAPCSATGTCRRHPDVL--HRMPAIE 313

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS--SPIPVELVPLNSA 396
           + +  Q  LL +   ++ PGG +V++ CSL+ ++ E   +++     +P+PV        
Sbjct: 314 ELSVLQASLLERAAGWLAPGGTLVYAVCSLEPEEGEAQARRLAGQGLTPVPVTA------ 367

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
               +   +  + EGW+R  P M  +      G+DGFFA   RR
Sbjct: 368 --DELPAGLVPTAEGWLRTDPGMFPE----QGGLDGFFAARWRR 405


>gi|84500523|ref|ZP_00998772.1| ribosomal RNA small subunit methyltransferase B, putative
           [Oceanicola batsensis HTCC2597]
 gi|84391476|gb|EAQ03808.1| ribosomal RNA small subunit methyltransferase B, putative
           [Oceanicola batsensis HTCC2597]
          Length = 465

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 150/442 (33%), Positives = 225/442 (50%), Gaps = 38/442 (8%)

Query: 10  VSSHLLSCVMRKRISLTCLLD----LEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
            +  L+S V+ ++ +L  LL     L   D A R  +QR       +   TLR L R+D 
Sbjct: 49  AAHQLVSSVIDEQKTLADLLGRTGPLGRFDPADRARAQR-------LATETLRHLGRLDT 101

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +L   L S +P     +   LR++  ++   + A + VV+ AV        +     + N
Sbjct: 102 LLAEHL-SHMP--PLPVLITLRIATYELATSEAA-HGVVNSAVTHVAAMPRHNRLKGMTN 157

Query: 126 SILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK-- 183
           ++LR+V+         +    +  +W +  L   +G+  V+A+  A      +DLT +  
Sbjct: 158 AVLRKVAATAPSRWPDLPPSPLP-DWLRAPLVMAWGEAGVVAMEAAHARGAPLDLTPRDP 216

Query: 184 FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
                 A +L A +LPTG +R+ + P  +  L GF  G WWVQDA+A+IP +L G     
Sbjct: 217 SAAADMAQRLEARVLPTGNLRI-DRPVQVSRLEGFDAGEWWVQDAAAAIPARLLGARPGE 275

Query: 244 SVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP 303
            VLD+CAAPGGKT QL  +GA+VTALD+S  R E++  NL R  L AE I+  DA D+  
Sbjct: 276 KVLDMCAAPGGKTLQLAAAGAEVTALDISAARTERITENLARTGLGAE-IVVADALDFD- 333

Query: 304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVF 363
           +  +DA+L+DAPCS+TGTIRRHPD+   +D   I      Q  L+   +S ++PGG +VF
Sbjct: 334 RTGWDAILLDAPCSATGTIRRHPDLPHAQDGSRIGDLIALQSGLIDHALSLLRPGGRLVF 393

Query: 364 SNCSLDKQDSEEVVQKVLRSSPI----PVEL-VPLNSAYWKSIDMAMALSPEGWIRITPD 418
             CSL   + E  V + L   P     P +L +P   A W        ++ EG +R+ PD
Sbjct: 394 CTCSLIPDEGEVQVAEALARHPGLSTDPADLDLPGLEADW--------ITQEGGLRLRPD 445

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
               +     GMDGF+   LR+
Sbjct: 446 HWAGL----GGMDGFYIAMLRK 463


>gi|119385444|ref|YP_916500.1| Fmu (Sun) domain-containing protein [Paracoccus denitrificans
           PD1222]
 gi|119375211|gb|ABL70804.1| Fmu (Sun) domain protein [Paracoccus denitrificans PD1222]
          Length = 535

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 131/388 (33%), Positives = 209/388 (53%), Gaps = 29/388 (7%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAK-RDK 115
           LR   R+D +L  +L     R +  + ++LR++  ++L L  A +  V+ AV  A+   +
Sbjct: 168 LRRADRVDLLLAPMLAR---RPRPEIMRILRLAAVEMLALGEAPHGAVNAAVALARASGR 224

Query: 116 ENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           + +  A +VN++LR+++    E   R++    +P W +  +   +G++   AI  A  + 
Sbjct: 225 KGQAAAGMVNAVLRKIA-GAAEAWARLS-PQKMPFWLRAPVVAAWGEDAARAIEAAHEAG 282

Query: 176 LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
             +DLT K              LPTG  RL      + +LPG+AEG WWVQDA+A++ V+
Sbjct: 283 AVLDLTPK------GADCPGEALPTGSHRLPAG-TRVSALPGYAEGDWWVQDAAAALAVR 335

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
           +        V DLCAAPGGKT QL  +GA+VTA+D+S+ RL ++  NL R  L A  ++ 
Sbjct: 336 VLDPQPGERVADLCAAPGGKTLQLAAAGAEVTAVDISELRLARVAENLARCGLQAR-LVA 394

Query: 296 MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
            DA D+ P +  DAVL+DAPCS+TGTIRRHP++   RD   + +    Q +L+   +  +
Sbjct: 395 ADALDWRPDQPLDAVLLDAPCSATGTIRRHPELPRIRDGAGLAELTGLQARLIDHALDLL 454

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSP---IPVELVPLNSAYWKSIDMAMALSPEGW 412
           KPGG ++++ CSL   + E+ +  VL   P   +     P     W        ++P+G 
Sbjct: 455 KPGGRLIYATCSLLPAEGEDQLAAVLARHPGLVVEPPRAPGVEPDW--------ITPQGG 506

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +R+ PD+  +      GMDGFF   LR+
Sbjct: 507 LRLRPDLWPE----RGGMDGFFIARLRK 530


>gi|261214775|ref|ZP_05929056.1| fmu domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|260916382|gb|EEX83243.1| fmu domain-containing protein [Brucella abortus bv. 3 str. Tulya]
          Length = 252

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 147/225 (65%), Gaps = 9/225 (4%)

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLR 280
           G   VQD +AS+P +L G +    V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L 
Sbjct: 33  GRMVVQDVAASLPARLMGDIKGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLN 92

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            NL+RL   A+  +  +  D+ P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K 
Sbjct: 93  ANLERLGFEAK-TVATNLMDFKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKL 151

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
           A  Q KLL    + VKPGG++VFSNCSL   + EE+ +K    +P+ +E  P+       
Sbjct: 152 AELQGKLLAHAATLVKPGGVIVFSNCSLHPLEGEEMARKA-PENPL-LEPFPITEQDCPG 209

Query: 401 IDMAMALSPEGWIRITPDML--EKIDGVS--SGMDGFFAVALRRL 441
           ++    ++ EG++R TP  L  +++DG    +GMDGFFA   +R+
Sbjct: 210 LE--GLVTAEGFLRSTPADLPPDRLDGNPHMAGMDGFFAARFKRV 252


>gi|148554856|ref|YP_001262438.1| Fmu (Sun) domain-containing protein [Sphingomonas wittichii RW1]
 gi|148500046|gb|ABQ68300.1| Fmu (Sun) domain protein [Sphingomonas wittichii RW1]
          Length = 422

 Score =  194 bits (494), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 145/449 (32%), Positives = 214/449 (47%), Gaps = 44/449 (9%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G  AR  +  LL  V+R+ + L   +D    D    L    D+    AI    LR    
Sbjct: 6   TGTPARRAALRLLDAVLRRGLPLEAAMDGACAD----LDRADDRGFAHAIAAEVLRRTAD 61

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLA---VEQAKRDKENRH 119
           +DA++D      LP    + + +LR+++AQ L L    +A +      V+   R      
Sbjct: 62  LDALIDGATERPLPADAKA-RMVLRIALAQALALGTPGHAAITTVLPLVDGGPR------ 114

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
             KLV+++   V R+   L         +P    +R    +GK+   A   +   P  +D
Sbjct: 115 --KLVHAVFGAVMRDGAALPD----PPHLPPAVADRWAASWGKDAAEAARASLGGPPPVD 168

Query: 180 LTVKFDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           LT+K D +T  WA +L+   L  G +R+      IV LPG+ EG WWVQD +A+IP +L 
Sbjct: 169 LTLKPDADTADWAARLDGESLAPGHVRIAAG-RRIVDLPGYDEGAWWVQDIAAAIPARLL 227

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G       LDLCAAPGGKT QL  +G  VTA+D+S+ R+ +L  NL+R  L AE  I   
Sbjct: 228 GAGEGRRALDLCAAPGGKTMQLAAAGWAVTAVDLSEARMARLAENLERTGLAAEARIADA 287

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A        +DAVL+DAPCS+TG  RRHPDVL       + ++A  Q +L+      V P
Sbjct: 288 AAFAE-GAPYDAVLLDAPCSATGIFRRHPDVLHRAGPRIVAEAAELQARLIDHAAGLVAP 346

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSP----IPVELVPLNSAYWKSIDMAMALSPE--G 411
           GG +V++ CSL+  + E++ +      P     PV           + ++    +P+  G
Sbjct: 347 GGRLVYAVCSLEADEGEQIAKGFAARHPDWAIDPV----------ATDELPQGFAPDKVG 396

Query: 412 WIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +R+ P  L        G DGFF    RR
Sbjct: 397 RVRVRPGTLAD----RGGADGFFVARFRR 421


>gi|114767262|ref|ZP_01446112.1| ribosomal RNA small subunit methyltransferase B, putative
           [Pelagibaca bermudensis HTCC2601]
 gi|114540615|gb|EAU43687.1| ribosomal RNA small subunit methyltransferase B, putative
           [Roseovarius sp. HTCC2601]
          Length = 420

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 136/408 (33%), Positives = 215/408 (52%), Gaps = 24/408 (5%)

Query: 36  SAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILY 95
           SA+  +   D+   + +    LR L R D +L   L  S P     ++ +LR+   + L 
Sbjct: 32  SAWEAMPAPDRAAAQRMAQEVLRNLERCDRLLKPHLRKSPP---LFVRNVLRLGAWE-LA 87

Query: 96  LDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKER 155
              A + VV+  V+    D++ +    LVN++LR+++ E       +  +  +P W +E 
Sbjct: 88  TGGAAHGVVNDCVQIVAGDRKTQSMKGLVNAVLRKLTEEAPAKWSTLR-VPRLPRWLREP 146

Query: 156 LENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSL 215
           L   +G + V A+  A ++   +DL+ K D    A  +   +LPTG +RL    + + +L
Sbjct: 147 LTIAWGNKAVAAMEAAHLAGAPLDLSAKADAAALAAAVGGSLLPTGSVRLASAGQ-VSAL 205

Query: 216 PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRR 275
           PG+  G WWVQDA+A++P +L G +  L++LD+CAAPGGKT QL  +GA VTALD+S+ R
Sbjct: 206 PGYDTGDWWVQDAAAALPARLLGDVTGLNILDMCAAPGGKTMQLAAAGANVTALDLSEAR 265

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           + ++R NL R  L A  +   DA  +     +DA+L+DAPCS+TGTIRRHPD+   +  +
Sbjct: 266 MGRVRENLARTGLEAATVTG-DALAH--DGTYDAILLDAPCSATGTIRRHPDLPQAKQGE 322

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            I +    Q  ++   +  + PGG +VF  CSL   + E  V++ L   P    L P  +
Sbjct: 323 GISELIGLQAAMIDHALRLLAPGGRLVFCTCSLIPDEGECQVEEALARHPGLEVLRPEAA 382

Query: 396 A---YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                W+        S EG +R+ PD   +      GMDGF+   LR+
Sbjct: 383 GVEEAWR--------SEEGGLRLRPDFWAE----RGGMDGFYVAILRK 418


>gi|254466360|ref|ZP_05079771.1| Fmu [Rhodobacterales bacterium Y4I]
 gi|206687268|gb|EDZ47750.1| Fmu [Rhodobacterales bacterium Y4I]
          Length = 420

 Score =  193 bits (490), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 142/446 (31%), Positives = 225/446 (50%), Gaps = 34/446 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRK-RISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M    +AR  + +LL  V+ + R+   C     Y   A   L+  D+   + +   TLR 
Sbjct: 1   MSDANHARRTAVYLLDQVLGEGRLLAEC-----YAAGALEKLAPEDRARAQRLAVETLRS 55

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           L R D +L   L  + P     +   LR+   ++     A + VV+  V    + + +  
Sbjct: 56  LERADRLLKKHLKKTPP---LMVMNALRLGTVELCSGGAA-HGVVNAMVAIVSKHRRHGQ 111

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
              LVN++LR+V+ E      ++  +  +P W ++ L   +G + +L +  A  +   +D
Sbjct: 112 LKGLVNAVLRKVAEEGPAEWAKLR-VPRLPNWLRKPLVQAWGADAILGMEAAHYAGAPLD 170

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           +T K  ++  A  L  V LPTG +R+    + + +LPG+  G WWVQDA+A++P  +   
Sbjct: 171 ITGKPGVDLQA--LGGVPLPTGSLRISSAGQ-VSALPGYQAGDWWVQDAAAALPALILNA 227

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
                 LDLCAAPGGKT Q+  +GA VTA+DVS+ R+ +LR NL+R  L A  ++  DA 
Sbjct: 228 QPGEHALDLCAAPGGKTMQMAAAGASVTAVDVSESRVARLRENLERTGLVAHLVVG-DAL 286

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           +   +  +DAVL+DAPCS+TGTIRRHPD+   +D  +       Q ++L    + VKPGG
Sbjct: 287 EQTGQ--YDAVLLDAPCSATGTIRRHPDLPQAKDGSEFGALIELQAQMLAHAWTLVKPGG 344

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVE-----LVPLNSAYWKSIDMAMALSPEGWIR 414
            +++  CSL   + E  V++ L   P          VP   A W        ++ EG +R
Sbjct: 345 RLMYCTCSLLPDEGECQVEEALDMFPDMAADREALKVPGVEADW--------ITEEGGLR 396

Query: 415 ITPDMLEKIDGVSSGMDGFFAVALRR 440
           + PD   +      GMDGF+   LR+
Sbjct: 397 LRPDYWPE----RGGMDGFYMALLRK 418


>gi|259417637|ref|ZP_05741556.1| Fmu [Silicibacter sp. TrichCH4B]
 gi|259346543|gb|EEW58357.1| Fmu [Silicibacter sp. TrichCH4B]
          Length = 436

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 132/388 (34%), Positives = 201/388 (51%), Gaps = 30/388 (7%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQ--QLLRVSVAQILYLDVADYAVVDLAVEQAKRD 114
           LR L R D VL   L     RK  +L     LR+   ++     A + VV+  V    R 
Sbjct: 68  LRSLERADRVLAKHL-----RKPPALHVRNALRLGTVELCSGGAA-HGVVNDIVNLVARH 121

Query: 115 KENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           + +     LVN++LR+V+ +      ++  +  +P+W +  L   +G + +LAI  A + 
Sbjct: 122 RRHAQLKGLVNAVLRKVATDGPTEWAKLR-VPRLPKWLRSPLAQAWGSDAMLAIEAAHLK 180

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
              +DL+ K   +  A  L     PTG +RL +  + + +LPG+ +G WWVQDA+A++P 
Sbjct: 181 GAPLDLSFKPGADLSA--LGGKPTPTGSLRLDDAGQ-VSALPGYEQGDWWVQDAAAALPA 237

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRL----HLYA 290
           +L        VLDLCAAPGGKT Q+  +GA VTA+D+S+ RL +L+ NL R     H+ A
Sbjct: 238 RLIHAQAGERVLDLCAAPGGKTLQMAAAGADVTAVDISEGRLARLQENLTRTGFSAHVIA 297

Query: 291 EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
            D++         K  +DAVL+DAPCS+TGTIRRHPD+   +D          Q ++L  
Sbjct: 298 GDVLAQ-------KGQYDAVLLDAPCSATGTIRRHPDLPHAKDGAGFGALIELQAQMLAH 350

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
             + V+PGG +V+  CSL   + E  ++  L     P   +       + ID A  ++ E
Sbjct: 351 AWTLVRPGGRLVYCTCSLLPDEGECQIEDALEM--FPEARIGDRIQTLEGIDPAW-ITEE 407

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           G +R+ PD   +I     GMDGF+   L
Sbjct: 408 GGLRLRPDYWPEI----GGMDGFYMAEL 431


>gi|89067213|ref|ZP_01154726.1| ribosomal RNA small subunit methyltransferase B, putative
           [Oceanicola granulosus HTCC2516]
 gi|89046782|gb|EAR52836.1| ribosomal RNA small subunit methyltransferase B, putative
           [Oceanicola granulosus HTCC2516]
          Length = 432

 Score =  191 bits (485), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 197/363 (54%), Gaps = 23/363 (6%)

Query: 77  RKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKI 136
           R   +++  LR++  +I     A + VVD  V+   R      +  LVN++LR+++    
Sbjct: 80  RPPDAVRNALRLATLEIGE-GAAAHGVVDAWVDLVGRHPHTSRYRGLVNAVLRKIAEAGP 138

Query: 137 ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
           E   ++  +  +P W +  L   +G   V  +  A  +   +DLT + D    A      
Sbjct: 139 EAWSKLP-VPNLPRWLRRPLAEAWGDRPVQQMERAHFAGAPLDLTARTDPAALAEATGGA 197

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +RL +  + + +LPGFAEG +WVQDA+A++P +L G      VLDLCAAPGGKT
Sbjct: 198 LLPTGSVRLAQAGQ-VTALPGFAEGAFWVQDAAAALPARLLGARPGERVLDLCAAPGGKT 256

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII-EMDAFDYCPKKLFDAVLVDAP 315
            Q+  +GA VTALD+S  RL ++  NL R  L A  +  +  AFD   +  +DA+L+DAP
Sbjct: 257 LQVAATGADVTALDISPDRLARVEENLARCGLAARTLAGDALAFD---EGGWDAILLDAP 313

Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375
           CS+TGTIRRHPD+   +D  +  +    Q +LL   ++ ++PGG +VF  CSL   + E 
Sbjct: 314 CSATGTIRRHPDLPHAKDGAEFGRLIELQARLLDHALTLLRPGGRLVFCTCSLLPDEGEV 373

Query: 376 VVQKVLRS----SPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMD 431
            V++ L +    + +P+  +P  +  W++         EG +R+ PD   +      GMD
Sbjct: 374 QVEEALAARDDIAVLPLPDLPGLAPEWRTE--------EGGLRLRPDYWPE----RGGMD 421

Query: 432 GFF 434
           GF+
Sbjct: 422 GFY 424


>gi|99079930|ref|YP_612084.1| Fmu (Sun) [Ruegeria sp. TM1040]
 gi|99036210|gb|ABF62822.1| Fmu (Sun) [Ruegeria sp. TM1040]
          Length = 424

 Score =  189 bits (480), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 139/387 (35%), Positives = 206/387 (53%), Gaps = 28/387 (7%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQ--QLLRVSVAQILYLDVADYAVVDLAVEQAKRD 114
           LR L R D VL   L     RK  +L     LR+   ++     A + VV+  V    R 
Sbjct: 56  LRALERADRVLAKHL-----RKPPALHVRNALRLGTVELCSGGAA-HGVVNDIVNLVARH 109

Query: 115 KENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           + +     LVN++LR+V+ E      ++  +  +P+W +  L   +G + +LAI  A   
Sbjct: 110 RRHGQLKGLVNAVLRKVATEGPGEWAKLR-VPRLPKWLRAPLVQAWGSDAMLAIEAAHFK 168

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
              +DL+ K   +  A  L   M PTG +RL++  + + +LPG+ +G WWVQDA+A++P 
Sbjct: 169 GAPLDLSAKPGADLAA--LEGAMTPTGSLRLQDAGQ-VSALPGYEQGAWWVQDAAAALPA 225

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
           QL        VLDLCAAPGGKT Q+  +GA+VTA+D+S+ RL +L+ NL R  L A  ++
Sbjct: 226 QLLNAARGERVLDLCAAPGGKTLQMAAAGAQVTAVDISENRLARLQENLTRTGLSAT-VV 284

Query: 295 EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISF 354
             D F+   K  +DAVL+DAPCS+TGTIRRHPD+   +D          Q ++L      
Sbjct: 285 AGDVFEQ--KGQYDAVLLDAPCSATGTIRRHPDLPHAKDGAGFGGLIELQAQMLAHAWGL 342

Query: 355 VKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP---IPVELVPLNSAYWKSIDMAMALSPEG 411
           V+PGG +V+  CSL   + E  V+ +L   P   I   L  L+      ID +  ++ EG
Sbjct: 343 VRPGGRLVYCTCSLLPDEGECQVEDMLEMFPGARIGDRLKSLS-----GIDPSW-ITEEG 396

Query: 412 WIRITPDMLEKIDGVSSGMDGFFAVAL 438
            +R+ PD   +I     GMDGF+   L
Sbjct: 397 GLRLRPDYWAEI----GGMDGFYMAEL 419


>gi|261823202|ref|YP_003261308.1| 16S rRNA methyltransferase B [Pectobacterium wasabiae WPP163]
 gi|261607215|gb|ACX89701.1| sun protein [Pectobacterium wasabiae WPP163]
          Length = 429

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 129/404 (31%), Positives = 212/404 (52%), Gaps = 37/404 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +   D     +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVHQRD-----VSDKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDA------ 171
             L+N +LR+  R++ EL+QR A  S   + P W   R+E+ Y  +   ++ DA      
Sbjct: 115 KGLINGVLRQFQRQQEELMQREATNSSHYLHPSWLLARIEHAY-PDHWQSVVDANNQRPP 173

Query: 172 ---------CISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
                         Y+DL  +  IE +AH   A       IRL   P ++  LPGFA+G 
Sbjct: 174 MWLRVNRLHHTQEAYLDLLAQEGIEAFAHPDYA-----DAIRLAS-PCAVDLLPGFAQGW 227

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLR 280
             +QDASA   V      +   +LDLCAAPGGKT  ++ +  K  V A+D+ + RL ++R
Sbjct: 228 ATIQDASAQGCVYWLEPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDIDETRLGRVR 287

Query: 281 CNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
            NL RL ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI
Sbjct: 288 ENLLRLQMHAE-VKQGDGRYPDSWCAGRMFDRILLDAPCSATGVIRRHPDIKWLRRDRDI 346

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            +    Q++++      +KPGG +V++ CS+  Q++ + V   L
Sbjct: 347 EELVALQKEIIDAIWPHLKPGGTMVYATCSILPQENAQQVTDFL 390


>gi|238921411|ref|YP_002934926.1| 16S rRNA methyltransferase B [Edwardsiella ictaluri 93-146]
 gi|238870980|gb|ACR70691.1| ribosomal RNA small subunit methyltransferase B, putative
           [Edwardsiella ictaluri 93-146]
          Length = 430

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 134/407 (32%), Positives = 216/407 (53%), Gaps = 39/407 (9%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +  N R +++  LS V+ +  SL+ +L      SA + LS++D+ L++ +   TLR LP+
Sbjct: 4   TSYNLRAIAARTLSAVLDQGQSLSSVLP-----SAAQSLSEKDRALLQELCFGTLRVLPQ 58

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ +L  ++   L  K+ +L  LL V + Q++Y  +  +A +   V+ A   K  +    
Sbjct: 59  LEWILQQLMAKVLTGKQRTLHYLLMVGLYQLVYTRIPPHAALAETVDGATALKRPQ-LKG 117

Query: 123 LVNSILRRVSREKIELL---QRIAGISIIPEWFKERLENFYGKERVLAISDACIS--PL- 176
           L+N +LR+  R++  LL   Q+ A   + P W  +RL++ Y  E+  AI +A     P+ 
Sbjct: 118 LINGVLRQFQRQQEALLLQSQQHASHWLHPSWLLKRLQHAY-PEQWPAIVEANNQRPPMW 176

Query: 177 ------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                       Y+ L  +  IE  AH       P   IRL  + + +  LPGF  G   
Sbjct: 177 LRVNRRHHTRDAYLTLLQQAGIEAVAHD----YFPDA-IRLL-VAQPVTRLPGFEHGWVT 230

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCN 282
           VQDASA   V L    ++  +LDLC APGGKT  ++ +   A V A+DV + RL+++R N
Sbjct: 231 VQDASAQHSVDLLDPQDSEQILDLCCAPGGKTTHILEAAPKAHVLAVDVDETRLKRVREN 290

Query: 283 LDRLHLYAE----DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           L RL  +AE    D    D  ++   + FD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 291 LQRLQQHAEIRCGDGRTPD--EWASGRQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIT 348

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           + A  QR+++     F+K GG++V++ CS+  Q+++E +   L   P
Sbjct: 349 ELAALQREIIDAVWPFLKSGGVMVYATCSILPQENQEQILTFLSRHP 395


>gi|304313374|ref|YP_003812972.1| Ribosomal RNA small subunit methyltransferase B [gamma
           proteobacterium HdN1]
 gi|301799107|emb|CBL47350.1| Ribosomal RNA small subunit methyltransferase B [gamma
           proteobacterium HdN1]
          Length = 492

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 147/460 (31%), Positives = 229/460 (49%), Gaps = 35/460 (7%)

Query: 1   MKSGMNARLVSSHLLSCVM----RKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVT 56
           M    + R   + +LS V+    ++  SL  L DL    SA   L + ++ L + I    
Sbjct: 1   MTQAAHVRATLAQVLSQVLPLGRQQAESLRALNDLL--PSAQERLPEAERKLAQEIAYGV 58

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
            R+  R+D +L+ +L   L  +   L  LL V + Q+ Y  + D+A +   VE A R  E
Sbjct: 59  CRWFTRLDKLLNPLLEHPLKARDRDLHALLLVGLYQLYYTRIPDHAAISETVE-ATRQLE 117

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKERVLAI-SDA 171
               ++LVN ILRRV REK +L   +     I    P+W  ++L+  +       + ++ 
Sbjct: 118 KPWASRLVNGILRRVQREKSQLETALPDSDAIRSAHPQWLVDKLKAAWPDHYAAMLEANN 177

Query: 172 CISPLYIDLTVK------FDIETWAHKLNA--VMLPTGGIRLKELPESIVSLPGFAEGVW 223
             +PL + + ++      +  E  A  +NA    L   GIRL E   ++V LPG+AEG +
Sbjct: 178 QQAPLTLRVNLRKQSREQYLTELRAKNINASPCSLSPAGIRL-ERSANVVELPGYAEGWF 236

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG-AKVTALDVSKRRLEKLRCN 282
            VQD +A +  QL        VLD CAAPGGKT  L+        A+D   RR E++  N
Sbjct: 237 SVQDEAAQLAAQLLAPHTGERVLDACAAPGGKTTHLLEHADIHCVAIDADPRRCERIHQN 296

Query: 283 LDRLHLYAE-DIIEMDAFDYCPKKL-FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
           L+RL L AE   +++ ++   P+ + FD +L+DAPCS+TG IRRHPD+ W R   DI   
Sbjct: 297 LERLQLSAEVHALDLQSYATQPEVMPFDRILLDAPCSATGIIRRHPDIKWLRRQSDINAL 356

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
           A  Q  LL    + +K GG ++++ CS+  Q+++ +V + L  +P         +A  ++
Sbjct: 357 AEQQLSLLKTAFALLKEGGTLLYATCSVLPQENDRIVARFLAETP---------AAILQA 407

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +     + P   I  TP   + +  V  G DGFF   LRR
Sbjct: 408 LQFPSQIPPANGI-PTPTGFQLLPTV-QGHDGFFYAMLRR 445


>gi|294638022|ref|ZP_06716282.1| ribosomal RNA small subunit methyltransferase B [Edwardsiella tarda
           ATCC 23685]
 gi|291088814|gb|EFE21375.1| ribosomal RNA small subunit methyltransferase B [Edwardsiella tarda
           ATCC 23685]
          Length = 430

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 133/399 (33%), Positives = 212/399 (53%), Gaps = 39/399 (9%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +  N R +++  LS V+ +  SL+ +L      SA + LS++D+ L++ +   TLR LP+
Sbjct: 4   TSYNLRAIAARTLSAVLDQGQSLSSVLP-----SAAQSLSEKDRALLQELCFGTLRVLPQ 58

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ +L  ++  +L  K+  L  LL V + Q++Y  +  +A +   V+ A   K  +    
Sbjct: 59  LEWILQQLMAKALTGKQRPLHYLLMVGLYQLVYTRIPPHAALAETVDGATALKRPQ-LKG 117

Query: 123 LVNSILRRVSREKIELL---QRIAGISIIPEWFKERLENFYGKERVLAISDACIS--PL- 176
           L+N +LR+  R++  LL   Q+ A   + P W  +RL++ Y  E+  AI +A     P+ 
Sbjct: 118 LINGVLRQFQRQQEALLLQSQQHASHWLHPSWLLKRLQHAY-PEQWPAIVEANNQRPPMW 176

Query: 177 ------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                       Y+ L  +  IE  AH       P   IRL  + + +  LPGF  G   
Sbjct: 177 LRVNRRHHTRDAYLTLLQQAGIEAVAHD----HFPDA-IRLL-VAQPVTRLPGFEHGWVT 230

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCN 282
           VQDASA   V L    +   +LDLC APGGKT  ++ +   A+V A+D  ++RL+++R N
Sbjct: 231 VQDASAQHCVDLLDPHDGEQILDLCCAPGGKTTHILEAAPKAQVLAVDADEQRLKRVREN 290

Query: 283 LDRLHLYAE----DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           L RL   AE    D    DA  +   + FD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 291 LQRLQQQAEVRCGDGRTPDA--WANGRQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIA 348

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           + A  QR++L      +KPGG++V++ CS+  Q++ E +
Sbjct: 349 ELAALQREILEAVWPLLKPGGVMVYATCSVLPQENREQI 387


>gi|212709010|ref|ZP_03317138.1| hypothetical protein PROVALCAL_00042 [Providencia alcalifaciens DSM
           30120]
 gi|212688376|gb|EEB47904.1| hypothetical protein PROVALCAL_00042 [Providencia alcalifaciens DSM
           30120]
          Length = 428

 Score =  179 bits (455), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 136/467 (29%), Positives = 233/467 (49%), Gaps = 63/467 (13%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+    SL+ +L DL+      R ++ +D+ L++ I    LR+
Sbjct: 1   MKNKYNLRSIAATAISQVLDNGQSLSTVLPDLQ------RNINDKDKALLQEICFGVLRY 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   L  K+ +L  L+ V + Q+LY  +  +A +   V+ A   K  + 
Sbjct: 55  LPKLEWFISQLMEKPLTGKQRTLHYLIMVGIYQLLYTRIPAHAALAETVDGAVALKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDAC---- 172
              L+N +LR   R++++L +R    +   + P W  +R++  Y  E    I DA     
Sbjct: 114 LKGLINGVLRSFLRQQVQLEERNTNNNSQYLHPSWLLKRIQTAY-PETWQNIVDANNQRP 172

Query: 173 -----------ISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEG 221
                       +  Y+ L  + DI  + H  +        IRL+E   S+  LPGF +G
Sbjct: 173 PMWLRVNSQHHTAEQYLALLEQADITAYLHPSHP-----SAIRLEE-ATSVTRLPGFEDG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKL 279
              VQD SA    +L   +N  ++LDLCAAPGGKT  ++     A V A+D+   RL+++
Sbjct: 227 WSTVQDVSAQGCAELLSPINGENILDLCAAPGGKTTHILELAPKAHVLAVDIDDARLKRV 286

Query: 280 RCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           + NL RL  +A  +I+ D     ++   +LFD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 287 KENLQRLKQHAT-VIQGDGTKPEEWAKDQLFDRILLDAPCSATGVIRRHPDIKWLRRDSD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           I + +  Q ++L    S++KPGG +V++ CS+  +++ + ++  L               
Sbjct: 346 IQELSQLQAQILEAVWSYLKPGGTLVYATCSIMPEENSQQIKHFLS-------------- 391

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
             K +D  +    E  ++I P         ++G DGFF   L +  Q
Sbjct: 392 --KHVDARINDGTELGLQILPS--------ATGGDGFFYARLLKQAQ 428


>gi|50122921|ref|YP_052088.1| 16S rRNA methyltransferase B [Pectobacterium atrosepticum SCRI1043]
 gi|81643776|sp|Q6D000|RSMB_ERWCT RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|49613447|emb|CAG76898.1| Sun protein [Pectobacterium atrosepticum SCRI1043]
          Length = 429

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 127/403 (31%), Positives = 212/403 (52%), Gaps = 35/403 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +   D     +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPIHQRD-----VSDKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELLQR A  S   + P W   R+E+ Y    R +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLQREATHSSHYLHPSWLLARIEHAYPNNWRGIVEANNQRPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y++L ++  IE + H        +  IRL   P ++  LPGF++G  
Sbjct: 175 WLRVNRLHHTREAYLNLLMQGGIEAFPHTEY-----SDAIRLAS-PCAVDQLPGFSQGWA 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRC 281
            VQDASA   V      +   +LDLCAAPGGKT  ++ +  K  V A+DV + RL +++ 
Sbjct: 229 TVQDASAQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDVDETRLGRVKE 288

Query: 282 NLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL RL ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLLRLQMHAE-VKQGDGRYPDSWCEARVFDRILLDAPCSATGVIRRHPDIKWLRRDRDIE 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           +    Q+++L      +K GG +V++ CS+  Q++ + V   L
Sbjct: 348 ELVALQKEILDAIWPHLKTGGTMVYATCSILPQENTQQVTGFL 390


>gi|322831104|ref|YP_004211131.1| sun protein [Rahnella sp. Y9602]
 gi|321166305|gb|ADW72004.1| sun protein [Rahnella sp. Y9602]
          Length = 429

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 125/385 (32%), Positives = 209/385 (54%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ K +SL+ +L         + +S++D+ L++ +   TLR L
Sbjct: 1   MKTAYNLRSIAAQAISQVLDKGLSLSTVLP-----GLQKNVSEKDRGLLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  L  ++   L  K+ +L  LL V + Q+++  +  +AV+   V+ A   K  +  
Sbjct: 56  PQLEWCLQQLMAKPLTGKQRTLHYLLMVGLYQLIHTRIPAHAVLAETVDGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGI---SIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELLQR+A      + P W   RL+  Y  +   +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLQRMANNDSRHLHPSWLLNRLKKAYPTDWESIVDANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLPT-------GGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  +    + + H LN V +           +RL   P  +  LPGF EG   VQDA
Sbjct: 175 WLRVNRQHHTRDEYLHLLNEVHIEAVPHPEYRDALRLN-TPCQVNLLPGFTEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    N   +LDLC APGGKT  ++ +   A V A+DV ++RL+++  NL RL
Sbjct: 234 SAQGSVDLLDPQNGELILDLCCAPGGKTTHILEAAPKAHVLAVDVDEQRLKRVHENLQRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE + + D  +   +   ++FD +L+DAPCS+TG IRRHPD+ W R   DIV+ A  
Sbjct: 294 KLSAE-VKQGDGREPQMWAGDRIFDRILLDAPCSATGVIRRHPDIKWLRRDSDIVELASL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q+++L      +K  GI+V++ CS+
Sbjct: 353 QKEILDAVWPRLKSKGIMVYATCSI 377


>gi|157372746|ref|YP_001480735.1| 16S rRNA methyltransferase B [Serratia proteamaculans 568]
 gi|224493268|sp|A8GKG7|RSMB_SERP5 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|157324510|gb|ABV43607.1| sun protein [Serratia proteamaculans 568]
          Length = 429

 Score =  178 bits (452), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 129/406 (31%), Positives = 210/406 (51%), Gaps = 39/406 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ +  SL+ +L      S  + +S +D+ L++ +   TLR L
Sbjct: 1   MKNNYNLRSIAAIAIGQVLDQGQSLSTVLP-----SLQKTISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+ +L  LL V + Q+LY  +  +AV+   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPMTGKQRTLHYLLMVGLYQLLYTRIPAHAVLAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDACISPL- 176
             L+N +LR+  R++ ELLQR A      + P W  +R++  Y  +    I      P  
Sbjct: 115 KGLINGVLRQFQRQQEELLQRAANNDSRYLHPSWLLKRIQQAYPAQWEQIIDANNQKPPM 174

Query: 177 -------------YIDLTVKFDI--ETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y+ L  +  I  E  A   +AV L          P ++  LPGFA+G
Sbjct: 175 WLRVNRLHHTREDYLQLMEQAGIAAEPHAEYRDAVRLLA--------PCAVTDLPGFADG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKL 279
              VQDASA   V L    +   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL+++
Sbjct: 227 WVTVQDASAQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLKRV 286

Query: 280 RCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           + NL RL L+AE + + D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 287 KENLQRLRLHAE-VKQGDGRTPQQWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDSD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           I + A  Q +++      +K GG++V++ CS+   ++ E V   L+
Sbjct: 346 IAELAALQAEIIEAIWPHLKSGGVMVYATCSILPAENAEQVSAFLQ 391


>gi|242237890|ref|YP_002986071.1| 16S rRNA methyltransferase B [Dickeya dadantii Ech703]
 gi|242129947|gb|ACS84249.1| sun protein [Dickeya dadantii Ech703]
          Length = 431

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 128/395 (32%), Positives = 211/395 (53%), Gaps = 27/395 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ +++ V+    SL+  L      +  R ++++D+ L++ +    LR L
Sbjct: 1   MKSKYNLRSIAAAVIAQVLDHGQSLSQSLP-----AVQRDIAEKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  +  ++   L  K+  L  LL V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  PQLDWCIGQLMAKPLTGKQRVLHYLLMVGLYQLLYTRIPPHATLAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISII---PEWFKERLENFYGKERVLAISDACIS--P 175
             L+N +LR+  R++ EL+Q++   S +   PEW   RL+  Y  E    I DA     P
Sbjct: 115 KGLINGVLRQFQRQQEELVQKMQKTSALHAHPEWLLTRLKKAY-PETWQDIIDANNQHPP 173

Query: 176 LYIDLTVKFDI-ETWAHKLNAVMLPTG-------GIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +  + +  + +   L    +P          I+L + P  + SLPGF +G   VQD
Sbjct: 174 MWLRVNRQHNERDGYIALLQEQGIPASKHPDYQDAIKL-DTPSPVTSLPGFEQGWITVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          NN  +LDLCAAPGGKT  +  I   A+V A+DV + RL +++ NL R
Sbjct: 233 ASAQGCAYWLDPQNNEDILDLCAAPGGKTTHILEIAPKARVLAVDVDEHRLARVKENLQR 292

Query: 286 LHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L  +A D+ + D     ++C    FD +L+DAPCS+TG IRRHPD+ W R   DIV+ A 
Sbjct: 293 LRQHA-DVRQGDGRVPEEWCGDSQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIVELAN 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
            QR++L      +K GG +V++ CS+  +++++ +
Sbjct: 352 LQREILDAIWPRLKIGGTLVYATCSILPEENQQQI 386


>gi|157373174|ref|YP_001471774.1| sun protein [Shewanella sediminis HAW-EB3]
 gi|157315548|gb|ABV34646.1| sun protein [Shewanella sediminis HAW-EB3]
          Length = 426

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 137/455 (30%), Positives = 218/455 (47%), Gaps = 53/455 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L     D    L S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALP----DQQRHLESGKDKALMAELCYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  L QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KLVSDCMSKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R++  L      +++  P W  +RL+  Y +     +  +   P        
Sbjct: 116 NGVLRNIQRQEKPLPTDNETLALNTPAWIIKRLKAAYPESWKEIVEQSHQRPPMWLRSNK 175

Query: 176 ------LYIDLTVKFDIETWAHKL-NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + +I+  A K  +A++L        E P+ ++ LPGF EG   VQD 
Sbjct: 176 LSQTRDEYLASLAEVEIQASAGKSSDAILL--------ESPKDVLQLPGFEEGTASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--TALDVSKRRLEKLRCNLDRL 286
           +A     L   ++   VLD CAAPGGKT  L+     +   A+D    RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPIDGELVLDACAAPGGKTCHLLEQAPNIELVAVDFDANRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L A+ +I  DA D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLNAK-LIHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIEELASL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q K+L     ++KPGG ++++ CS+  Q++E+ ++  L  +         N A    ID 
Sbjct: 347 QSKILDHCWQWLKPGGTLLYATCSILPQENEQQIRAFLERA---------NDATLVPIDE 397

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
                  GW +ITP +          MDGF+   L
Sbjct: 398 QNHPDDIGW-QITPGL--------ENMDGFYYARL 423


>gi|227328919|ref|ZP_03832943.1| 16S rRNA methyltransferase B [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 429

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 126/403 (31%), Positives = 209/403 (51%), Gaps = 35/403 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +       R +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVHQ-----REVSDKDRALLQELCFGLLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K+ +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLQYTRIPPHAALAETVEGAVTLKKPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDACISP-- 175
             L+N +LR+  R++ EL+QR A  S   + P W   R+E  Y       +      P  
Sbjct: 115 KGLINGVLRQFQRQQEELIQREATHSSHYLHPSWLLARIERAYPNHWQGIVEANNQRPPM 174

Query: 176 ------------LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y++L V+  IE + H        +  IRL   P ++  LPGF++G  
Sbjct: 175 WLRVNRLHHTREAYLNLLVQEGIEAFPHAEY-----SDAIRLAS-PCAVDQLPGFSQGWA 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRC 281
            VQDASA   V      +   +LDLCAAPGGKT  ++ +  K  V A+DV + RL +++ 
Sbjct: 229 TVQDASAQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDVDETRLSRVKE 288

Query: 282 NLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL RL ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLLRLQMHAE-VKQGDGRYPDSWCEGRVFDRILLDAPCSATGVIRRHPDIKWLRRDRDIE 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           +    Q+++L     ++K GG +V++ CS+  Q++ + V   L
Sbjct: 348 ELVALQKEILDAIWPYLKTGGTMVYATCSILPQENAQQVTDFL 390


>gi|268593572|ref|ZP_06127793.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rettgeri DSM 1131]
 gi|291310849|gb|EFE51302.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rettgeri DSM 1131]
          Length = 427

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 235/458 (51%), Gaps = 55/458 (12%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +  V+    SL+ +L DL+      R ++ +D+ L++ I    LR+
Sbjct: 1   MKNTYNLRSIAATAIFQVLDNGQSLSTVLPDLQ------RNINDKDKALLQEICFGVLRY 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   L  K+ +L  L+ V + Q+LY  +  +A +   V+ A   K+ + 
Sbjct: 55  LPKLEWFISQLMEKPLTGKQRTLHYLIMVGIYQLLYTRIPPHAALAETVDGAVALKKPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR   R++++L +RIA  +   + P W  +RL+  Y ++ + +  ++    P
Sbjct: 114 LKGLINGVLRSFQRQQVQLEERIANNTSQYLHPSWLLKRLQTAYPEDWQSIIEANNQRPP 173

Query: 176 LYIDLTVKFDIETWAHKLN--------AVMLPT--GGIRLKELPESIVSLPGFAEGVWWV 225
           ++  L V     T A  LN        A + P+    IRL E P ++  LPGF +G   V
Sbjct: 174 MW--LRVNSQHHTAAQYLNLLEQSEITAHLHPSHPNAIRLDE-PTAVSRLPGFEDGWSTV 230

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNL 283
           QD SA    +L    N  S+LDLCAAPGGKT  ++     A V A+D+ + RL++++ NL
Sbjct: 231 QDVSAQGCAELLEPQNGESILDLCAAPGGKTTHILELAPRANVIAVDIDEYRLKRVKENL 290

Query: 284 DRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            RL  +A  +I+ D      +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + 
Sbjct: 291 IRLKQHAV-VIQGDGTQPEKWAKDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDINEL 349

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
           A  Q ++L     ++KPGG ++++ CS+  +++ + +Q  L                 K 
Sbjct: 350 AQLQAQILEAIWPYLKPGGTLLYATCSIMPEENGKQIQNFLS----------------KH 393

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
            D ++    +  +++ P         ++G DGFF   L
Sbjct: 394 NDASLNDGTDAGLQVLPS--------TNGGDGFFYARL 423


>gi|270264342|ref|ZP_06192608.1| hypothetical protein SOD_h00090 [Serratia odorifera 4Rx13]
 gi|270041478|gb|EFA14576.1| hypothetical protein SOD_h00090 [Serratia odorifera 4Rx13]
          Length = 429

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 125/401 (31%), Positives = 210/401 (52%), Gaps = 23/401 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R  ++  +  V+ +  SL+ +L      S  + +S +D+ L++ +   TLR L
Sbjct: 1   MKNNYNLRSHAAKAIGQVLDQGQSLSTVLP-----SLQKTISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+ +L  LL V + Q+LY  +  +AV+   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPMTGKQRTLHYLLMVGLYQLLYTRIPAHAVLAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++ ELLQR A      + P W  +R++  Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLQRAANNDSRYLHPSWLLKRIQQAYPAQWEQIIDANNQKPPM 174

Query: 177 YIDLT----VKFDIETWAHKLNAVMLPTG----GIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +      + D      +      P       +RL  +P ++  LPGFA+G   VQDA
Sbjct: 175 WLRVNRLHHTREDYLRLMEQAGIAAEPHAEYPDALRLL-VPCAVTDLPGFADGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +++ NL RL
Sbjct: 234 SAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLGRVKENLQRL 293

Query: 287 HLYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
            L+AE  +        +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 RLHAEVKLGDGRTPQQWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAKLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            +++      +K GG++V++ CS+   ++ E +   L+  P
Sbjct: 354 AEIIDAIWPHLKSGGVMVYATCSILPTENAEQITAFLQRHP 394


>gi|323493837|ref|ZP_08098955.1| 16S rRNA methyltransferase B [Vibrio brasiliensis LMG 20546]
 gi|323311971|gb|EGA65117.1| 16S rRNA methyltransferase B [Vibrio brasiliensis LMG 20546]
          Length = 426

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 126/402 (31%), Positives = 208/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSNALP-----AAQQTIKPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  SIANELMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL    +   AG    P W  + L+  Y ++ + +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDAMAVSHNAGKYGHPGWLLKLLQESYPQQWQEIVEANNSKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y++L    +I+   H    +AV L          P  +  LPGF +G   
Sbjct: 175 VNHQHHSRDEYLELLKNENIDNTIHSEAEDAVKLAA--------PCDVTKLPGFEKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++    G++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLTPQDGELILDCCAAPGGKTAHILERTQGSEVVAIDCDDTRLKRVHDN 286

Query: 283 LDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LQRLNLKAK-VICGDARNPQDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  QR++L      +KPGG +V++ CS+  Q+++E V+  L
Sbjct: 346 LAELQREILDAMWQQLKPGGTLVYATCSITPQENKEQVKAFL 387


>gi|253690152|ref|YP_003019342.1| sun protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259495486|sp|C6DFR7|RSMB_PECCP RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|251756730|gb|ACT14806.1| sun protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 429

 Score =  176 bits (445), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 211/403 (52%), Gaps = 35/403 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +       R +S++D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVHQ-----REVSEKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+QR A  S   + P W   R+E+ Y    + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELIQREANHSSHYLHPSWLLARIEHAYPNHWQTIVEANNQRPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y++L  +  IE + H        T  IRL   P ++  LPGF++G  
Sbjct: 175 WLRVNRLHHTREAYLNLLAQEGIEAFPHTEF-----TDAIRLAS-PCAVDQLPGFSQGWA 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRC 281
            VQDASA   V      +   +LDLCAAPGGKT  ++ +   + V A+D+ + RL +++ 
Sbjct: 229 TVQDASAQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPQSHVLAVDIDETRLGRVKE 288

Query: 282 NLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL RL ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLLRLQMHAE-VKQGDGRYPDSWCEGRMFDRILLDAPCSATGVIRRHPDIKWLRRDRDIE 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           +    Q+++       +K GG +V++ CS+  Q++ + V   L
Sbjct: 348 ELVALQKEIFDAIWPHLKVGGTMVYATCSILPQENAQQVTDFL 390


>gi|325294320|ref|YP_004280834.1| sun protein [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|325064768|gb|ADY72775.1| sun protein [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 442

 Score =  176 bits (445), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 129/464 (27%), Positives = 231/464 (49%), Gaps = 61/464 (13%)

Query: 3   SGMNARLVSSHLLSCVMR-KRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           +G N RL++  +L+   + K++        E+ +     L  +D+  +R IV+ T+RFL 
Sbjct: 2   TGWNERLIAIKILNRFEKDKKLK-------EHIEKFTSRLHPQDRAFIREIVSGTVRFLR 54

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +D  ++     +L R+K +++  LRV   QI + +V  YA ++  VE  K+    +  A
Sbjct: 55  LLDFSIEKATGKNLKRQKNTVRNSLRVIAYQIFFTNVPPYAALNETVEAVKKIL-GKKAA 113

Query: 122 KLVNSILRRV----SREKIE----LLQRIAGISIIPEWFKERLENFYGKERVLAISDAC- 172
             VN+I +++     +++IE      +R++ +     W  +R  NFYGKE +  +     
Sbjct: 114 GFVNAISKKIIGFDYKKEIERISDYFERLSILYSFETWMVKRWSNFYGKEEIEKLLKGLN 173

Query: 173 -ISPLYI-------------DLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGF 218
            ++PL+I             +L  K  I+   H     M+   G     +P  I S+PG+
Sbjct: 174 RVAPLFIRVNTIKISQQELLNLLEKTKIDAEPHPFIPYMIRIKG----RVP--IESIPGY 227

Query: 219 AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRR 275
            EG +++QD ++ +   L        +LD+ AAPGGKT   + L +  A++ A+D++K R
Sbjct: 228 KEGFFYIQDPASFLSAYLLDPKQGEIILDVGAAPGGKTTALSSLTIDKARIIAVDINKER 287

Query: 276 LEKLRCNLDRL-----HLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLW 330
           ++ L+ NL RL      L   DI +   F    +  FD +L+DAPCS+TG IRRHP+  W
Sbjct: 288 MKLLKNNLKRLGISNVELVLTDIQKDKNFIEKHENSFDKILIDAPCSATGVIRRHPEGKW 347

Query: 331 TRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVEL 390
            +    I  +   QR LL      +KPGG++++S CSL+K++ E++++          E+
Sbjct: 348 NKSLKLIKYNQTIQRNLLSSCYKLLKPGGVLLYSVCSLEKEEGEDILK-------FAQEI 400

Query: 391 VPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
               S+ +   ++  + + + ++R+ P          + MDGFF
Sbjct: 401 GFKESSLYNLPELLKSFAKKHFLRVFPH--------KNNMDGFF 436


>gi|307132808|ref|YP_003884824.1| Ribosomal RNA small subunit methyltransferase B [Dickeya dadantii
           3937]
 gi|306530337|gb|ADN00268.1| Ribosomal RNA small subunit methyltransferase B [Dickeya dadantii
           3937]
          Length = 431

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 129/409 (31%), Positives = 212/409 (51%), Gaps = 39/409 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++  L  V+ +  SL+ LL      +  R +S++D+ L++ I    LR L
Sbjct: 1   MKSKYNLRSIAATALVQVVEQGQSLSHLLP-----ALQRDISEKDRGLLQEICFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  L  ++   L  K+  L  LL V + Q+++  +  +A +   V  A   K  +  
Sbjct: 56  PQLDWHLRQLMAKPLTGKQKVLHYLLMVGLYQLIHTRIPPHAALAETVNGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFYGK--ERVLAISDACISP 175
             L+N +LR+  R++ EL QR+         P+W  +RL+  Y +  ER++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQDELQQRLQNNPARYAHPDWLLQRLKKAYPQQWERIVEANNQH-PP 173

Query: 176 L-------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
           +             Y+ L  + +I  + H    +A+ L T        P ++  LPGF +
Sbjct: 174 MWLRVNRQHHTRAAYLALLQEKEITAYPHAFYPDAIRLGT--------PCAVNQLPGFEQ 225

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   +      ++  +LDLCAAPGGKT  ++ +   A V A+DV ++RL++
Sbjct: 226 GWVTVQDASAQGCIHWLAPQDHEEILDLCAAPGGKTTHILEAAPHAHVLAVDVDEQRLKR 285

Query: 279 LRCNLDRLHLYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +R NL RL  +AE          ++C  KLFD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 286 VRENLQRLGQHAEVKCGDGRTPTEWCGDKLFDRILLDAPCSATGVIRRHPDIKWLRRDSD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           I + A  Q+ +L      +K GG +V++ CS+  +++ + V   L+  P
Sbjct: 346 IAELASLQQAILEAIWPRLKSGGTLVYATCSILPEENHQQVAAFLQRHP 394


>gi|153837662|ref|ZP_01990329.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ3810]
 gi|149748952|gb|EDM59779.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ3810]
          Length = 427

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 124/402 (30%), Positives = 208/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+C L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSCALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAA--------PCDVMKLPGFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|238752659|ref|ZP_04614130.1| Ribosomal RNA small subunit methyltransferase B [Yersinia rohdei
           ATCC 43380]
 gi|238709086|gb|EEQ01333.1| Ribosomal RNA small subunit methyltransferase B [Yersinia rohdei
           ATCC 43380]
          Length = 429

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 125/406 (30%), Positives = 216/406 (53%), Gaps = 39/406 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLNKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDAC--- 172
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +  ++L  ++     
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNESHYLHPSWLLARIKQAYPDQWQQILEANNQKPPM 174

Query: 173 ---ISPL------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEG 221
              +S L      Y++L  + DIE   H +  +AV L T        P S+  LPGF  G
Sbjct: 175 WLRVSRLHHSRSEYLELLKQADIEALPHDVYPDAVRLIT--------PCSVNDLPGFDLG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKL 279
              VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL ++
Sbjct: 227 WVTVQDASAQGCVDLLSPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRV 286

Query: 280 RCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           + NL RL L+A D+   D     ++C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 287 KENLQRLKLHA-DVRVGDGRTPDEWCGNQQFDRILLDAPCSATGVIRRHPDIKWLRRNSD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           I + A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 346 IAELAQLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQIAAFLQ 391


>gi|291619144|ref|YP_003521886.1| RsmB [Pantoea ananatis LMG 20103]
 gi|291154174|gb|ADD78758.1| RsmB [Pantoea ananatis LMG 20103]
          Length = 433

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 137/465 (29%), Positives = 228/465 (49%), Gaps = 54/465 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSTNLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDAALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+ +L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALIGKLMERPLTGKQRTLHFLIMVGLYQLLYTRVPAHAALAETVAGAEVLKRA-NL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGI---SIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL  I       + P W   RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLASIQDGPQRHLHPGWLLNRLQQAWPEQWQQIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLPTG-------GIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  +    ++W  +L A              +RL   P  +  LPGF +G + VQD 
Sbjct: 175 WLRVNRQHHSRDSWLARLTAEEKSAAVAQDVPEALRLTA-PAPVTLLPGFEQGWFTVQDL 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LDLCAAPGGKT  +  I   A+V A+DV  +RL+++  NL RL
Sbjct: 234 SAQRCALLLEPKNGEQILDLCAAPGGKTTHILEIAPEAQVLAVDVDAQRLKRVNENLTRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMTAE-VKQGDGRTPQQWCDQRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAAL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL----DKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
           QR++L      +KPGG ++++ CS+    +++   E +++   +  + +   PLN     
Sbjct: 353 QREILDATWPLLKPGGTMIYATCSVLPDENQRQISEFIERHADAEAVSLSGAPLN----- 407

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
                      GW ++ P+        + G DGFF   L +   P
Sbjct: 408 -----------GW-QVFPE--------AEGGDGFFYAKLVKRTGP 432


>gi|260775013|ref|ZP_05883913.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260609103|gb|EEX35262.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 426

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 124/409 (30%), Positives = 215/409 (52%), Gaps = 25/409 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RDQ L++ I   +LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGQSLSNALP-----AAQQQVKPRDQALLQEICYGSLRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  SIANELMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R + EL    +   AG    P W  + L++ Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDAHAMSHNAGKYGHPSWLLKLLQDAYPQQWQDIIEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL------NAVMLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +        +L      ++ +       LK   P  +  LPGF +G   VQDA+A +
Sbjct: 175 VNQQHHSRDEYQQLLKNENIDSSIHSEASDALKLAAPCDVTKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA ++     A++ A+D    RL+++  NL RL L A
Sbjct: 235 SINYLTPKDGELILDCCAAPGGKTAHILERTQDAQIVAIDCDDSRLKRVHDNLQRLQLKA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++
Sbjct: 295 Q-VICGDARKPKDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRGDDIAALAKLQSEI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNS 395
           L      +KPGG +V++ CS+  Q++ E V+  L R++   +E  P+++
Sbjct: 354 LDAMWQQLKPGGTLVYATCSITPQENSEQVKAFLARTANAQLEGSPVDN 402


>gi|238754203|ref|ZP_04615561.1| Ribosomal RNA small subunit methyltransferase B [Yersinia ruckeri
           ATCC 29473]
 gi|238707699|gb|EEQ00059.1| Ribosomal RNA small subunit methyltransferase B [Yersinia ruckeri
           ATCC 29473]
          Length = 429

 Score =  173 bits (439), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 213/408 (52%), Gaps = 37/408 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ K  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDKGQSLSTVLP-----GLQKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q+LY  +  +A +   VE     K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLLYTRIPPHAALAETVEGTVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFY-GKERVLAISDACISPL 176
             LVN +LR+  R++++LL+R A      + P W   R++  Y  K + +  ++    P+
Sbjct: 115 KGLVNGVLRQFQRQQVDLLERAANNESRYLHPSWLLARIKKAYPDKWQQIIDANNQKPPM 174

Query: 177 -------------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y++L  +  IE   H    +AV L T        P ++  LPGF +G
Sbjct: 175 WLRVSRLHHSRADYLELMKQAGIEAEPHTEYSDAVRLIT--------PCAVNDLPGFTQG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKL 279
              VQDASA   V L    N   +LDLCAAPGGKT  ++ +  K  V A+D+ ++RL ++
Sbjct: 227 WVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKSHVLAVDIDEQRLSRV 286

Query: 280 RCNLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           + NL RL L+A   + +  A D +C  +LFD +L+DAPCS+TG IRRHPD+ W R   DI
Sbjct: 287 KENLQRLQLHATVTVGDGRAPDKWCGNQLFDRILLDAPCSATGVIRRHPDIKWLRRDSDI 346

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            + A  Q ++L      +K  G++V++ CS+  +++++ +   L+  P
Sbjct: 347 AELAQLQSEILEAIWPKLKKDGVMVYATCSILPEENQQQIANFLQRHP 394


>gi|227354905|ref|ZP_03839319.1| ribosomal RNA small subunit methyltransferase B [Proteus mirabilis
           ATCC 29906]
 gi|227164987|gb|EEI49826.1| ribosomal RNA small subunit methyltransferase B [Proteus mirabilis
           ATCC 29906]
          Length = 422

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 212/408 (51%), Gaps = 41/408 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  ++ V+ + +SL+ ++ +L+      + +S +D+ L++ +   TLR 
Sbjct: 1   MKTSYNLRSIAAKAIAQVLDQGLSLSSVIPELQ------KNISDKDKALLQELCFGTLRT 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++ ++  ++   L  K+  L  L+ V + Q+LY  V  +A +   V  A   K+ + 
Sbjct: 55  LPQLEWIIQQLMDKPLKGKQRILHYLIMVGLYQLLYTRVPAHAALAETVNGAIALKKPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDACISP- 175
              L+N +LR+  R++  L++R        + P W   R++N Y +     I      P 
Sbjct: 114 LKGLINGVLRQFQRQQDVLMERFQNNDSRYLHPSWLLTRIKNAYPELWESIIEGNNQKPP 173

Query: 176 -------------LYIDLTVKFDIETWA--HKLNAVMLPTGGIRLKELPESIVSLPGFAE 220
                         Y+ L  K  I  ++  H  NA+ L        E P ++  LPGF+E
Sbjct: 174 MWLRVNQIHHSREQYLALLEKEGISAFSDDHHPNAIRL--------ETPCNVHLLPGFSE 225

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEK 278
           G   VQD SA    +L    NN  +LDLCAAPGGKT  +  I   A V A+D+ ++RL +
Sbjct: 226 GWITVQDRSAQRCAELLAPQNNEQILDLCAAPGGKTTHILEIAPKAHVLAIDIDEQRLAR 285

Query: 279 LRCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           ++ NL+RL L+A  +   D      +C    FD +L+DAPCS+TG IRRHPD+ W R  +
Sbjct: 286 VKENLNRLKLHA-TVKSGDGRYPEQWCANMQFDRILLDAPCSATGVIRRHPDIKWLRRNE 344

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS 383
           DI + A  Q+++L     ++K GG +V++ CS+  +++ + +   L S
Sbjct: 345 DIAQLAQIQKEILHAIWPYLKSGGTLVYATCSILPEENSQQIAAFLSS 392


>gi|327395473|dbj|BAK12895.1| ribosomal RNA small subunit methyltransferase B RsmB [Pantoea
           ananatis AJ13355]
          Length = 433

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 137/465 (29%), Positives = 228/465 (49%), Gaps = 54/465 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSTNLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDAALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+ +L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALIGKLMERPLTGKQRTLHFLIMVGLYQLLYTRVPAHAALAETVAGAEVLKRA-NL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGI---SIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL  I       + P W   RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLASIQDGPQRHLHPGWLLNRLQQAWPEQWQQIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLPTG-------GIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  +    ++W  +L A              +RL   P  +  LPGF +G + VQD 
Sbjct: 175 WLRVNRQHHSRDSWLARLIAEEKSAAVAQDVPEALRLTA-PAPVTLLPGFEQGWFTVQDL 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LDLCAAPGGKT  +  I   A+V A+DV  +RL+++  NL RL
Sbjct: 234 SAQRCALLLEPKNGEQILDLCAAPGGKTTHILEIAPEAQVLAVDVDAQRLKRVNENLTRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMTAE-VKQGDGRTPQQWCDQRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAAL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL----DKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
           QR++L      +KPGG ++++ CS+    +++   E +++   +  + +   PLN     
Sbjct: 353 QREILDATWPLLKPGGTMIYATCSVLPDENQRQISEFIERHADAEAVSLSGAPLN----- 407

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
                      GW ++ P+        + G DGFF   L +   P
Sbjct: 408 -----------GW-QVFPE--------AEGGDGFFYAKLVKRTGP 432


>gi|328471169|gb|EGF42071.1| 16S rRNA methyltransferase B [Vibrio parahaemolyticus 10329]
          Length = 427

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 124/400 (31%), Positives = 206/400 (51%), Gaps = 36/400 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y+ L    +I++  H         G I+L   P  ++ LPGF +G   VQ
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPH-----TEAMGAIKLAA-PCDVMKLPGFDKGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  NL 
Sbjct: 229 DAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLK 288

Query: 285 RLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A
Sbjct: 289 RLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
             Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 348 ELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|261214774|ref|ZP_05929055.1| fmu domain-containing protein [Brucella abortus bv. 3 str. Tulya]
 gi|260916381|gb|EEX83242.1| fmu domain-containing protein [Brucella abortus bv. 3 str. Tulya]
          Length = 252

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 92/227 (40%), Positives = 129/227 (56%), Gaps = 1/227 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           ++ G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR  
Sbjct: 25  LRPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNR 84

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
             I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +
Sbjct: 85  GSIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKY 144

Query: 121 AKLVNSILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           A LVN++LRR++R K   L       + +PEWF + + + YG E+   I         ID
Sbjct: 145 AGLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPID 204

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
            TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WW +
Sbjct: 205 FTVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWCR 251


>gi|255525650|ref|ZP_05392583.1| sun protein [Clostridium carboxidivorans P7]
 gi|296185410|ref|ZP_06853820.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           carboxidivorans P7]
 gi|255510636|gb|EET86943.1| sun protein [Clostridium carboxidivorans P7]
 gi|296050244|gb|EFG89668.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           carboxidivorans P7]
          Length = 442

 Score =  172 bits (437), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 132/458 (28%), Positives = 226/458 (49%), Gaps = 59/458 (12%)

Query: 21  KRISLTCLLDLEYGDSAFRL----------LSQRDQILVRAIVNVTLRFLPRIDAVLDFV 70
           ++ ++  L ++ YG+S   +          ++ +D+ LV  IV  TL++   ID +L++ 
Sbjct: 5   RKTAVKILKEVFYGNSYSNMVIGKELNRSDMNDKDKALVTEIVYGTLKYKYTIDTILNYY 64

Query: 71  LISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILR 129
           + S L +    +  +LR+S+ QI YLD + ++AVV+ AVE AKR  +    A+LVN +LR
Sbjct: 65  IKSGLKKLDVDILNILRISIYQIRYLDKIPEFAVVNEAVELAKR--KAVKTARLVNGVLR 122

Query: 130 RVSR-EKIELLQRIAGISII------PEWFKERLENFYGKERVLAISDA-----CISPLY 177
              R   I+   + + I  +      P+W      N YGKE    I         I+   
Sbjct: 123 SYLRSNNIDYYNKNSDIEKMCFDYSFPKWMVSLFSNQYGKEETKKILQGLNEVPAITVRV 182

Query: 178 IDLTVKFDIETWAH-KLNAVMLPTGGIRLKELPESIV--------SLPGFAEGVWWVQDA 228
            +L   ++ E W   K N   +  G +     PE+I+        + P F  G+  VQD 
Sbjct: 183 NNLKTNYE-EAWEELKKNGYDIEEGKV----CPEAIIINRGRNIENNPLFKNGLITVQDE 237

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA +         N++VLDLC+APGGKT   A+L  +  K+ A D+ + +L  ++ N  R
Sbjct: 238 SAMMVAPSMELKENMTVLDLCSAPGGKTCHIAELTNNQGKIFAFDIHENKLPLIKENAKR 297

Query: 286 LHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +       +DA  Y    ++  D VL+D PCS  G IR+ P++ W +D + +      
Sbjct: 298 LGITNVKCGTLDASKYMDIYEEKGDRVLIDVPCSGLGIIRKKPEIKWNKDKESLESLVKI 357

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+ ++L    +VK  G ++++ C+L+K+++EE ++  ++  P   ++ P+   Y+  +D 
Sbjct: 358 QKTIMLNAAKYVKKNGKLIYATCTLNKEENEENIKWFIKKRP-DFQIEPI---YYGKLD- 412

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFF-AVALRR 440
            +    EG+I I P+           MDGFF A  +RR
Sbjct: 413 NIIYHDEGYITILPNKY---------MDGFFIAKMIRR 441


>gi|197287099|ref|YP_002152971.1| 16S rRNA methyltransferase B [Proteus mirabilis HI4320]
 gi|224493257|sp|B4F1L5|RSMB_PROMH RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194684586|emb|CAR46442.1| ribosomal RNA small subunit methyltransferase B [Proteus mirabilis
           HI4320]
          Length = 422

 Score =  172 bits (436), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 124/408 (30%), Positives = 211/408 (51%), Gaps = 41/408 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  ++ V+ + +SL+ ++ +L+      + +S +D+ L++ +   TLR 
Sbjct: 1   MKTSYNLRSIAAKAIAQVLDQGLSLSSVIPELQ------KNISDKDKALLQELCFGTLRT 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++ ++  ++   L  K+  L  L+ V + Q+LY  V  +A +   V  A   K+ + 
Sbjct: 55  LPQLEWIIQQLMDKPLKGKQRILHYLIMVGLYQLLYTRVPAHAALAETVNGAIALKKPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDACISP- 175
              L+N +LR+  R++  L++R        + P W   R++N Y +     I      P 
Sbjct: 114 LKGLINGVLRQFQRQQDVLMERFQNNDSRYLHPSWLLTRIKNAYPELWESIIEGNNQKPP 173

Query: 176 -------------LYIDLTVKFDIETWA--HKLNAVMLPTGGIRLKELPESIVSLPGFAE 220
                         Y+ L  K  I  ++  H  NA+ L        E P ++  LPGF E
Sbjct: 174 MWLRVNQIHHSREQYLALLEKEGISAFSDDHHPNAIRL--------ETPCNVHLLPGFNE 225

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEK 278
           G   VQD SA    +L    NN  +LDLCAAPGGKT  +  I   A V A+D+ ++RL +
Sbjct: 226 GWVTVQDRSAQRCAELLAPQNNEQILDLCAAPGGKTTHILEIAPKAHVLAIDIDEQRLAR 285

Query: 279 LRCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           ++ NL+RL L+A  +   D      +C    FD +L+DAPCS+TG IRRHPD+ W R  +
Sbjct: 286 VKENLNRLKLHA-TVKSGDGRYPEQWCANMQFDRILLDAPCSATGVIRRHPDIKWLRRNE 344

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS 383
           DI + A  Q+++L     ++K GG +V++ CS+  +++ + +   L S
Sbjct: 345 DIAQLAQIQKEILHAIWPYLKSGGTLVYATCSILPEENSQQIAAFLSS 392


>gi|28899818|ref|NP_799423.1| Sun protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362016|ref|ZP_05775021.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus K5030]
 gi|260876497|ref|ZP_05888852.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AN-5034]
 gi|260897446|ref|ZP_05905942.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus Peru-466]
 gi|46396865|sp|Q87KD3|RSMB_VIBPA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|28808070|dbj|BAC61307.1| Sun protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087890|gb|EFO37585.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus Peru-466]
 gi|308090396|gb|EFO40091.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AN-5034]
 gi|308114191|gb|EFO51731.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus K5030]
          Length = 427

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 208/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L++ Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQDAYPQQWESIVDANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAA--------PCDVMKLPGFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|156932266|ref|YP_001436182.1| 16S rRNA methyltransferase B [Cronobacter sakazakii ATCC BAA-894]
 gi|224493253|sp|A7MPE7|RSMB_ENTS8 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|156530520|gb|ABU75346.1| hypothetical protein ESA_00037 [Cronobacter sakazakii ATCC BAA-894]
          Length = 429

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 214/402 (53%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLD-LEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK  +N R +++  +  V+ K  SL+ +L  L++       +S +D+ L++ +    LR 
Sbjct: 1   MKKSINLRSLAAQAIEQVVEKGQSLSTVLPPLQHK------VSDKDKALLQELCFGVLRT 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           L +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  + 
Sbjct: 55  LSQLEWLINKLMSRPMTGKQRTIHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRMQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
           F  L+N +LR+  R++ ELL   +G     + P W   R +  + +E + +  ++    P
Sbjct: 114 FKGLINGVLRQFQRQQDELLAEFSGQDARWLHPMWLLNRFQTAWPREWQAVVEANNERPP 173

Query: 176 LYIDLTVKFDI-ETWAHKLNAVMLPTGGIRLK-------ELPESIVSLPGFAEGVWWVQD 227
           +++ +  +    + W   L    + TG I  +       + P  + +LPGF +G   VQD
Sbjct: 174 MWLRVNRQHHSRDEWLKLLEENGM-TGHIHPRYPDAVRLDAPAPVSALPGFEQGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDR 285
           ASA   V+L    N  ++LDLCAAPGGKT  ++ +   A V A+DV  +R+ ++  NL R
Sbjct: 233 ASAQGCVELLAPQNGETILDLCAAPGGKTTHILEAAPQASVMAVDVDAQRISRVYENLKR 292

Query: 286 LHLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L + A+  +    F   +C +  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 293 LKMKADVKVGDGRFPSTWCGETQFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L      +KPGG ++++ CS+  +++ E ++  L  +P
Sbjct: 353 QSEILDAIWPHLKPGGTLLYATCSVLPEENSEQIRAFLSRTP 394


>gi|91226301|ref|ZP_01261141.1| Sun protein [Vibrio alginolyticus 12G01]
 gi|91189312|gb|EAS75591.1| Sun protein [Vibrio alginolyticus 12G01]
          Length = 427

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 207/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVDANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAA--------PCDVMKLPGFEKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|294138832|ref|YP_003554810.1| ribosomal RNA small subunit methyltransferase B [Shewanella
           violacea DSS12]
 gi|293325301|dbj|BAJ00032.1| ribosomal RNA small subunit methyltransferase B [Shewanella
           violacea DSS12]
          Length = 425

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 134/456 (29%), Positives = 220/456 (48%), Gaps = 56/456 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +   V+ K ISL+  L     D    L S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVAFQVLEKGISLSVALP----DQQKHLESGKDKALLAELSYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KLVSDCMSKPLKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R++  L      ++   P W  +RL+  Y +     I  +   P        
Sbjct: 116 NGVLRNIQRQEKPLPTDNDTLAFNTPSWIVKRLKAAYPENWQEVIEQSHQRPPMWLRNNK 175

Query: 176 ------LYIDLTVKFDIETWAHKL-NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + DI   A K  +A++L        E P  +  LPGF +G   VQD 
Sbjct: 176 RSQTRDEYLAALAEIDIPASAGKSSDAILL--------ESPRDVAQLPGFDQGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRCNLDRLH 287
           +A     L    +   VLD CAAPGGKT  L+ ++  ++ A+D  ++RLE+++ NLDRL 
Sbjct: 228 AAQWAATLLAPKDGELVLDACAAPGGKTCHLLELANIQLVAVDFDEKRLERVQQNLDRLS 287

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A+ ++  DA D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 288 LDAK-LVHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQSDIDELAALQ 346

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            K+L     ++KPGG ++++ CS+  Q++E+ ++  L  +     L+P++          
Sbjct: 347 SKILDHCWQWLKPGGTLLYATCSILPQENEQQIRSFLERAD-DATLIPISEQP------- 398

Query: 405 MALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
               P+  GW +ITP         +  MDGF+   L
Sbjct: 399 ---HPDDIGW-QITPG--------TENMDGFYYARL 422


>gi|317049808|ref|YP_004117456.1| sun protein [Pantoea sp. At-9b]
 gi|316951425|gb|ADU70900.1| sun protein [Pantoea sp. At-9b]
          Length = 428

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 133/454 (29%), Positives = 225/454 (49%), Gaps = 45/454 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++ L+  V+ K  SL+ +L       A + LS +D  L++ +    +R L
Sbjct: 1   MKKNTNLRSLAAQLIERVVDKGESLSAILP-----GAQKSLSDKDGALLQELCFGVMRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+  L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALISKLMERPLTGKQRVLHYLIMVGLYQLLYTRVPPHAALAETVAGAEVLKRA-NL 114

Query: 121 AKLVNSILRRVSREKIELLQRI---AGISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  L+  +       + P W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLLNGVLRQFQRQQEALVAEVDQGTQRHLHPAWLLKRLQTAWPEQWQQIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETW------AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    +TW        K   V      +RL E P ++  LPGF +G   VQD S
Sbjct: 175 WLRVNRQHHPRDTWLALLEETEKSAFVGDAPDSLRL-EAPTAVGQLPGFDQGWVTVQDLS 233

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A     L    N  S+LDLCAAPGGKT  +  I   A V A+D+ ++RL ++R NL RL 
Sbjct: 234 AQRCALLLEPQNGESILDLCAAPGGKTTHILEIAPQAAVLAVDIDEQRLTRVRENLQRLG 293

Query: 288 LYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A D+ + D     ++C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 MQA-DVRQGDGRTPAEWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELASLQ 352

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           R++L      +K GG ++++ CS+  +++ + +   L + P              +I  A
Sbjct: 353 REILHAVWPRLKSGGTLLYATCSVLPEENHQQITAFLATHP-------------DAIAEA 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +    E   ++ P         + G DGFF   L
Sbjct: 400 LPHGQENGWQVFP--------ATDGGDGFFYAKL 425


>gi|114561210|ref|YP_748723.1| sun protein [Shewanella frigidimarina NCIMB 400]
 gi|114332503|gb|ABI69885.1| sun protein [Shewanella frigidimarina NCIMB 400]
          Length = 427

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 138/460 (30%), Positives = 216/460 (46%), Gaps = 55/460 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K ISL+  L     D    L + +D+ L+  +    +R LP++D
Sbjct: 1   MNVRALAAKAIYEVLEKGISLSVALP----DQQQHLQNGKDKALLAELCYGVMRQLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L      K+  L QLL V   Q+ +  +  +A +    E A R        K+V
Sbjct: 57  KCVSDCLAKPFKGKQRILHQLLIVGCYQLYFTRIPAHAAISETAE-ACRQLRFDGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+  EL      +    P WF + L+  Y       I  +   P        
Sbjct: 116 NGVLRNIQRQDSELNTDSDTLRFNTPAWFIKHLQQAYPDNWQDIIEQSHQRPPMWLRNNQ 175

Query: 176 ------LYIDLTVKFDIETWA-HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + DI   A    NA++L        E  + + +LP F EG   VQD 
Sbjct: 176 QSQTCDAYLAALAQHDISAQAGSSPNAILL--------ESAKDVAALPDFMEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT--ALDVSKRRLEKLRCNLDRL 286
           +A     L     +  VLD CAAPGGK+  L+     +   A+D  ++RL +++ NLDRL
Sbjct: 228 AAQWAATLLAPTADELVLDACAAPGGKSCHLLELAPTINLVAVDFDQKRLARVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           HL A+ +I  DA D   +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 HLKAQ-LIHGDAADIPSWWQGQQFDRILLDAPCSATGVIRRHPDIKWLRKNSDIEELANL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
           Q+++L     ++KPGG ++++ CS L +++S++V Q + R++     LVP        I+
Sbjct: 347 QKQILDHCWQWLKPGGTLLYATCSILPQENSQQVEQFLARTA--DASLVP--------IE 396

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
               +S  GW +I P            MDGF+   L + I
Sbjct: 397 QQAHISDIGW-QILPG--------QDNMDGFYYARLVKAI 427


>gi|254229997|ref|ZP_04923398.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
 gi|262392829|ref|YP_003284683.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
 gi|151937499|gb|EDN56356.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
 gi|262336423|gb|ACY50218.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
          Length = 427

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 207/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAA--------PCDVMKLPGFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|269967001|ref|ZP_06181071.1| sun protein [Vibrio alginolyticus 40B]
 gi|269828395|gb|EEZ82659.1| sun protein [Vibrio alginolyticus 40B]
          Length = 427

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 207/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVDANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAA--------PCDVMKLPGFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|258545467|ref|ZP_05705701.1| ribosomal RNA small subunit methyltransferase B [Cardiobacterium
           hominis ATCC 15826]
 gi|258519300|gb|EEV88159.1| ribosomal RNA small subunit methyltransferase B [Cardiobacterium
           hominis ATCC 15826]
          Length = 418

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/390 (31%), Positives = 199/390 (51%), Gaps = 19/390 (4%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M AR  + H +  V+ +  +L  LL  +        +S  DQ L +A+V  TLR    + 
Sbjct: 1   MKARQAALHTIDGVINQHRTLNTLLAQDKSR-----VSAADQALYQALVYGTLRQYRALS 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A+   ++        + L  +L + + Q+L +++ D+ V++  V  A   +  R    L+
Sbjct: 56  ALCAQMMEKPPATPGHPLAIILNLGLYQLLQMNLGDHGVINETVNLAPHHRLAR-AKGLI 114

Query: 125 NSILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           N+ILRRV RE+    Q +  A  + +P+W + +   +  +E  +A S++   PL + L  
Sbjct: 115 NAILRRVQRERAHWQQALENAATANLPDWLRGQ---YPAEEAAIAASNSRQPPLTLRLNH 171

Query: 183 KFDIETW--AHK-LNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
             D   W  AH    A  L    I L     ++  +PGF +G   VQDA+A     L   
Sbjct: 172 THDRAAWLAAHGDARANPLHPQAITLTH-GHNVQHIPGFNDGAVSVQDAAAQHAATLLAP 230

Query: 240 LNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA--EDIIE 295
            N   +LD CAAPGGKT  L+     A++ ALD  + RL +++ NLDRL L A  +    
Sbjct: 231 QNGEHILDACAAPGGKTGHLLELAPTAELLALDHDRDRLVRVQENLDRLGLRATLKAADA 290

Query: 296 MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
            D   +   K FDA+L+DAPCS +G +RRHPD+ W R   D+ + A  QR+LL +    +
Sbjct: 291 ADTAAWWDGKPFDAILLDAPCSGSGVLRRHPDIAWLRTPADLKRLAASQRQLLERLWPTL 350

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           KPGG ++++ C++   ++++ ++  L + P
Sbjct: 351 KPGGRLLYTTCTILPAENQDNIRAFLAAHP 380


>gi|260599608|ref|YP_003212179.1| 16S rRNA methyltransferase B [Cronobacter turicensis z3032]
 gi|260218785|emb|CBA34133.1| Ribosomal RNA small subunit methyltransferase B [Cronobacter
           turicensis z3032]
          Length = 425

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 211/398 (53%), Gaps = 25/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLD-LEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           MN R +++  +  V+ K  SL+ +L  L++       +S +D+ L++ +    LR L + 
Sbjct: 1   MNLRSLAAQAIEQVVEKGQSLSTVLPPLQHK------VSDKDKALLQELCFGVLRTLSQQ 54

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           + +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  + F  L
Sbjct: 55  EWLINKLMSRPMTGKQRTIHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRMQ-FKGL 113

Query: 124 VNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           +N +LR+  R++ ELL   AG     + P W  +RL+  + +E + +  ++    P+++ 
Sbjct: 114 INGVLRQFQRQQDELLAEFAGQDARWLHPMWLLKRLQTAWPQEWQAVVQANNERPPMWLR 173

Query: 180 LTVKFDI-ETWAHKLNAVMLPTGGIRLK-------ELPESIVSLPGFAEGVWWVQDASAS 231
           +  +    + W   L    + TG I  +       E P  + +LPGF +G   VQDASA 
Sbjct: 174 VNRQHHSRDEWLTLLEENGM-TGHIHPRYPDAVRLEAPAPVSALPGFEQGWVTVQDASAQ 232

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLY 289
             V+L    N  ++LDLCAAPGGKT  ++ +   A V A+DV  +R+ ++  NL R+ + 
Sbjct: 233 GCVELLAPQNGETILDLCAAPGGKTTHILEAAPQANVLAVDVDAQRISRVYENLKRVKMR 292

Query: 290 AEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           AE  +    F   +C    FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q  +
Sbjct: 293 AEVKVGDGRFPATWCGDMQFDRILLDAPCSATGVIRRHPDIKWLRRDSDISELAQLQSDI 352

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG ++++ CS+  +++ E ++  L  +P
Sbjct: 353 LDAIWPHLKPGGTLLYATCSILPEENSEQIRAFLTRTP 390


>gi|153834294|ref|ZP_01986961.1| ribosomal RNA small subunit methyltransferase B [Vibrio harveyi
           HY01]
 gi|148869302|gb|EDL68316.1| ribosomal RNA small subunit methyltransferase B [Vibrio harveyi
           HY01]
          Length = 427

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 209/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPEQWESIVEANNQKAPMWLR 174

Query: 180 LTVKF-------------DIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +  ++             +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQYHTRDEYLALLKNENIDSTPHTQAMDALKLAA--------PCDVMKLPGFEKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARHPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|117926942|ref|YP_867559.1| sun protein [Magnetococcus sp. MC-1]
 gi|117610698|gb|ABK46153.1| 16S rRNA m(5)C-967 methyltransferase [Magnetococcus sp. MC-1]
          Length = 452

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 126/476 (26%), Positives = 228/476 (47%), Gaps = 71/476 (14%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           KS ++ R +++  +S ++ + + L   L+ +    +      R +     IV  T+R + 
Sbjct: 3   KSHVSERTMAAAAVSAMLSEHLPLETALEQQIHQQSGTSPEMRGR--AHEIVVGTIRHMA 60

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            ++A L   +   L  K + ++ +L  ++ Q  ++    ++ VD AV+  K+   + + +
Sbjct: 61  LLEATLTRFMQKDLKAKHHYVRAVLLTALYQAQFMRTPIHSAVDEAVKLVKQQPRDHNLS 120

Query: 122 KLVNSILRRVSREKIEL----------LQRIAGISIIPEWFKERLENFYGKERV------ 165
             VN++LRR +  ++EL          L+R+A     P W  +R E   G E        
Sbjct: 121 GFVNAVLRRST--EVELSTTWSAVKDPLKRLATRYSHPLWLVKRWEKRLGMEATEARLAA 178

Query: 166 ---------------LAISD--ACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKEL 208
                          + ++D  A      I++TV  + E        +MLP G       
Sbjct: 179 ANAQAPLTLRIHTPKVTVADYLAAAKQAEIEVTVCPEAE------ETLMLPQGA------ 226

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV---SGAK 265
              + +LPG++ G + VQD +A    +L       ++LD CAAPGGK+A L+    +G  
Sbjct: 227 --KVATLPGYSNGWFAVQDRAAQAVARLLAPQAGEAILDACAAPGGKSAHLVALGGAGVV 284

Query: 266 VTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRH 325
           +TALD +++RLE++  N+ RL + ++  +         + LFD  LVDAPC+ TG IRRH
Sbjct: 285 ITALDSAQQRLERMGENMARLGIRSQVKLRCADATQPIEGLFDRALVDAPCTGTGVIRRH 344

Query: 326 PDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           PD+ W R+   + +    Q+++L    + VKPGG++V++ CSL+  ++E+ V + L+  P
Sbjct: 345 PDIKWRRNPSGLAEVVKQQQQILQSVAAAVKPGGLLVYATCSLEPDENEQQVARFLKEHP 404

Query: 386 IPVELVPLNSAYWKSIDMAMALS---PEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
                       WK + +   ++   PE WI    D+  + +  + G+DGF+A  L
Sbjct: 405 -----------QWKRLPLEAGMAGILPE-WIDSAGDL--RTEPATHGVDGFYAARL 446


>gi|254415201|ref|ZP_05028963.1| ribosomal RNA small subunit methyltransferase B [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178007|gb|EDX73009.1| ribosomal RNA small subunit methyltransferase B [Microcoleus
           chthonoplastes PCC 7420]
          Length = 448

 Score =  171 bits (432), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 215/442 (48%), Gaps = 71/442 (16%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L++ D+ L+  +V  T R    +DA++D +      ++   L+ +L + + Q+ YL  + 
Sbjct: 35  LNRPDRALLTDLVYGTTRHTRTLDALIDQLGKKKAHQQPPDLRLILHLGLYQLRYLQRIP 94

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSR--------EKIEL----LQRIAGISI 147
             A V+ +VE AK ++  +  A +VN +LR+ +R        + ++L    +QR+  +  
Sbjct: 95  PSAAVNTSVELAKANQL-KGLAGVVNGVLRQYARLNTNPQLDDPLQLPPQPIQRLGILYS 153

Query: 148 IPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNA------VMLPTG 201
            P+W  E   N  G E   A+      P  IDL +          LNA        +   
Sbjct: 154 FPDWIIELWLNQLGIEETEALCQWFNQPPTIDLRIN--------PLNASIDTVETAMQAA 205

Query: 202 GIRLKELPE------------SIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLC 249
           GI+++ LP             SI +LPGF EG W +QD+SA +   L     +  ++D C
Sbjct: 206 GIQVQRLPHLPQALRFQGSTGSIQTLPGFNEGWWTIQDSSAQLVSHLLNPQPHDVIIDAC 265

Query: 250 AAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK-- 304
           AAPGGKT   A+L+     + A D +  RL+K++ N  RL L +  I   D+ D+ P+  
Sbjct: 266 AAPGGKTTHLAELMRDRGTIWACDKAASRLKKVKANTQRLQLQSIQICPGDSRDF-PQFT 324

Query: 305 KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFS 364
           +  D VL+DAPCS  GT+ R PD+ W      + + +  Q +LL Q  ++VKPGG++V++
Sbjct: 325 QKADTVLLDAPCSGLGTLHRRPDIRWRCTPARVQELSVLQSELLTQTATWVKPGGVLVYA 384

Query: 365 NCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID-----MAMALSPEGWIRITPDM 419
            C+L  Q++E V+Q  L               +W  ID     +    +P+GW+++ P  
Sbjct: 385 TCTLHPQENEAVIQAFLE-----------RHLHW-CIDAPPPTLTAFSTPQGWLKVLPHQ 432

Query: 420 LEKIDGVSSGMDGFFAVALRRL 441
            +        MDGFF V L+ L
Sbjct: 433 HQ--------MDGFFMVRLKHL 446


>gi|77464685|ref|YP_354189.1| rRNA methyltransferase RsmB-like [Rhodobacter sphaeroides 2.4.1]
 gi|77389103|gb|ABA80288.1| rRNA methyltransferase RsmB-like [Rhodobacter sphaeroides 2.4.1]
          Length = 421

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 123/393 (31%), Positives = 193/393 (49%), Gaps = 34/393 (8%)

Query: 52  IVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQA 111
           + +  LR L   D +L   L  + P    +++ +LR++  ++     A + VV  AV+ A
Sbjct: 58  LASSVLRHLGPADRLLAPHLRKAPP---LTVRNILRLATVEMAADGAAPHGVVSSAVDLA 114

Query: 112 KRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
           +R +  +H A LVN++LRR++      L        +P W ++ L   +G+  V AI   
Sbjct: 115 RRGRRTQHLAGLVNAVLRRIAPASFAGLP----AQHLPMWLRQPLVRRWGRAVVTAIEAV 170

Query: 172 CISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
             +P  +DLT +  +      L     PTG  RL+  P  + +LPG+  G WWV DA+A+
Sbjct: 171 QAAPPPLDLTARPGLSAPGEPL-----PTGSFRLRA-PGQVSALPGYEAGQWWVHDAAAA 224

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE 291
           + V L       +V DLCAAPGGKT QL   GA+  A     R   +      R    A 
Sbjct: 225 LAVNLLDPHAGEAVADLCAAPGGKTLQLAAGGARHGARHF--RGPPRAAPRESRADGPAG 282

Query: 292 DIIEMDA-FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
            ++     +   P   F+A+L+DAPCS+TGTIRRHPD+ + +D  ++      Q  +L  
Sbjct: 283 RVVGRSPDWQGGP---FEAILLDAPCSATGTIRRHPDLPFVKDGSELPSLVALQAAMLDH 339

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-IPVE--LVPLNSAYWKSIDMAMAL 407
            +  + PGG +VF  CSL +++ E  +  +L   P + VE   +P     W        +
Sbjct: 340 ALGLLAPGGRLVFCTCSLLEEEGEAQLAALLERHPELTVERPTLPGVEPDW--------I 391

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             EG +R+ PD+  +    + GMDGFF   +RR
Sbjct: 392 GAEGGLRLRPDLWAE----AGGMDGFFMARVRR 420


>gi|269962646|ref|ZP_06176991.1| sun protein [Vibrio harveyi 1DA3]
 gi|269832569|gb|EEZ86683.1| sun protein [Vibrio harveyi 1DA3]
          Length = 427

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 207/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPEQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLTLLKNENIDSTPHTQAMDALKLAA--------PCDVMKLPGFEKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|212632964|ref|YP_002309489.1| Fmu, rRNA SAM-dependent methyltransferase [Shewanella piezotolerans
           WP3]
 gi|212554448|gb|ACJ26902.1| Fmu, rRNA SAM-dependent methyltransferase [Shewanella piezotolerans
           WP3]
          Length = 428

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 125/421 (29%), Positives = 202/421 (47%), Gaps = 41/421 (9%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
            MN R +++ ++  V+ K ISL+  L     D    L S +D+ L+  +    +R LP++
Sbjct: 2   AMNLRALAAKVVFQVLEKGISLSVALP----DQQKHLDSGKDKALLAELCYGVMRHLPQL 57

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D  +   +   L  K+  + QLL +   QI +  +  +A +    E A R  +     K+
Sbjct: 58  DKQVSDCMSKPLKGKQRIVHQLLLIGCYQIYFTRIPSHAAISETAE-ACRQLKFEGLVKV 116

Query: 124 VNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP------- 175
           VN +LR + R++  L      ++   P W  +RL+  Y +     I  +   P       
Sbjct: 117 VNGVLRTIQRQEKPLSTDNDTLAYNTPAWIIKRLKEAYPENWQQVIEQSHQRPPMWLRNN 176

Query: 176 -------LYIDLTVKFDIETWA-HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                   Y+      DIE  A +  ++++L +        P  ++ LPGF  G   VQD
Sbjct: 177 QQSQSRETYLQALAGLDIEAEAGNSPDSILLSS--------PRDVMQLPGFETGAASVQD 228

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDR 285
            +A     L     +  VLD CAAPGGKT  L+      K+ A+D   +RLE+++ NLDR
Sbjct: 229 GAAQWAATLLAPQGDELVLDACAAPGGKTCHLLELAPDIKLVAVDFDAKRLERVQQNLDR 288

Query: 286 LHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L AE +I  DA D   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A 
Sbjct: 289 LSLEAE-LIHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDIEELAA 347

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS------PIPVELVPLNSA 396
            Q K+      ++KPGG ++++ CS+  Q++ + V   L  +      PI  +  P ++ 
Sbjct: 348 LQSKIFDHCWKWLKPGGTLLYATCSILPQENRDQVSAFLARTADATLMPIEEQTNPQDTG 407

Query: 397 Y 397
           +
Sbjct: 408 W 408


>gi|289209431|ref|YP_003461497.1| sun protein [Thioalkalivibrio sp. K90mix]
 gi|288945062|gb|ADC72761.1| sun protein [Thioalkalivibrio sp. K90mix]
          Length = 451

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 129/403 (32%), Positives = 195/403 (48%), Gaps = 31/403 (7%)

Query: 35  DSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQIL 94
           + A   L+ RD   V+A+   TLR+ P++ A+++  L   L +K   +  LL   +A+++
Sbjct: 42  EHATEGLNARDAAWVQALAYTTLRWYPQLSALVNGFLERPLRKKDAVIGVLLAQGLAELM 101

Query: 95  YLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRI----AGISIIPE 150
           +    D+A V    E A R         L+N++LRR  RE+  L   +    A    +PE
Sbjct: 102 HFSTRDHAAVRETAELA-RAIHRPGAVGLINAVLRRAQREQDALEAAVREDPALRFAVPE 160

Query: 151 WFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLP----------T 200
           W  E +   +  +    + +A   P  + L V     +    L A++             
Sbjct: 161 WLLETIRASW-PDDWETLLEAATRPAPMTLRVNLSRTSREEALQALVAAGHPAQAHPQLE 219

Query: 201 GGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI 260
             + L E P  +  LPGFAEG   VQDASA     L        VLD CAAPGGKT  L+
Sbjct: 220 AALTLDE-PADVAQLPGFAEGRLSVQDASAQWAAVLLDPQPGERVLDACAAPGGKTGHLL 278

Query: 261 VSGA---KVTALDVSKRRLEKLRCNLDRL----HLYAEDIIEMDAFDYCPKKLFDAVLVD 313
                  ++TALD    RL ++R NLDRL     L A D+ + DA  +   + FDA+L+D
Sbjct: 279 ERAGGDLQLTALDSDAERLVQVRENLDRLGFAAQLTAADVADPDA--WWDGRPFDAILLD 336

Query: 314 APCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
            PCS+TG IRRHPD+   R  DDI + A  Q ++L      ++PGG ++++ CSL  +++
Sbjct: 337 VPCSATGVIRRHPDIKTLRRADDIPRLAAEQARILEAAWGLLRPGGRLLYATCSLLSEEN 396

Query: 374 EEVVQKVLRSSP-----IPVELVPLNSAYWKSIDMAMALSPEG 411
           + VV   L   P      P    P+  A+ +S+  A+ L  EG
Sbjct: 397 DAVVAGFLERMPDARALEPEGGPPIAGAHARSVGWALPLGLEG 439


>gi|238763703|ref|ZP_04624662.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           kristensenii ATCC 33638]
 gi|238698005|gb|EEP90763.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           kristensenii ATCC 33638]
          Length = 429

 Score =  170 bits (430), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 120/406 (29%), Positives = 214/406 (52%), Gaps = 39/406 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L   + +     +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPRLHKN-----ISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIKQLMARPMTGKQRIFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSHYLHPSWLLARIKQAYPDQWQQIVDANNQKPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y++L  + +I+   H    +AV L T        P ++ +LPGF  G
Sbjct: 175 WLRVSRLHNSRSKYLELLKQANIDALPHDFYPDAVRLIT--------PCAVSTLPGFELG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKL 279
              VQDASA   V L    N   +LDLCAAPGGKT  ++ +  K  V A+D+ ++RL ++
Sbjct: 227 WVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAIDIDEQRLSRV 286

Query: 280 RCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           + NL RL L+A D+   D     ++C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 287 KENLQRLKLHA-DVRVGDGRIPDEWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           I   A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 346 IADLAQLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQIATFLQ 391


>gi|156972728|ref|YP_001443635.1| cytosine-C5-methylase [Vibrio harveyi ATCC BAA-1116]
 gi|156524322|gb|ABU69408.1| hypothetical protein VIBHAR_00393 [Vibrio harveyi ATCC BAA-1116]
          Length = 427

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 207/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPEQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTQAMDALKLAA--------PCDVMKLPGFEKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARHPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|283480068|emb|CAY75984.1| Ribosomal RNA small subunit methyltransferase B [Erwinia pyrifoliae
           DSM 12163]
          Length = 456

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 118/397 (29%), Positives = 214/397 (53%), Gaps = 21/397 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  L++ +    LR L
Sbjct: 28  MKKMTNLRCIAARTIEQVVEQGQSLSNVLP-----AAQKSVGDKDAALLQELCYGVLRTL 82

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ ++  ++   +  K+ +L  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 83  PQLEWIISKLMSRPMTGKQRALHFLIMVGLYQLMFTRIPPHAALAETVEAAVALKRPQ-L 141

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+Q++       + P+W  ERL+  +  + + +  ++    P+
Sbjct: 142 KGLINGVLRQFQRQQDELMQQMNDGDQQYLHPKWLLERLKRAWPVQWQQIVAANNQRPPM 201

Query: 177 YIDLTVKFDI-ETWAHKL-----NAVMLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    +TW   L      A   P     L+ ELP ++  LPGF +G   VQDAS
Sbjct: 202 WLRVNRQHHSRDTWLALLEESGKQAFTHPRHSDALRLELPCAVHQLPGFDQGWVTVQDAS 261

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++ +   AKV A+DV  +RL ++  NL RL+
Sbjct: 262 AQGCVALLAPRDGEQILDLCAAPGGKTTHILEAAPQAKVLAVDVDAQRLARISENLQRLN 321

Query: 288 LYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           L+AE  +        +C  +LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q+
Sbjct: 322 LHAEVKLGDGRTPAAWCGDRLFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQQ 381

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           ++L     ++K GG ++++ CS+  +++   + + L+
Sbjct: 382 QILDAVWPYLKSGGTLLYATCSVLPEENHLQISQFLQ 418


>gi|37681411|ref|NP_936020.1| sun protein [Vibrio vulnificus YJ016]
 gi|320154882|ref|YP_004187261.1| ribosomal RNA small subunit methyltransferase B [Vibrio vulnificus
           MO6-24/O]
 gi|46396771|sp|Q7MGK4|RSMB_VIBVY RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|37200163|dbj|BAC95991.1| sun protein [Vibrio vulnificus YJ016]
 gi|319930194|gb|ADV85058.1| ribosomal RNA small subunit methyltransferase B [Vibrio vulnificus
           MO6-24/O]
          Length = 426

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 123/406 (30%), Positives = 211/406 (51%), Gaps = 40/406 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ +  SL+  L       A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYQVVDRGNSLSTALP-----EAQQSIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIAGKLMDKPLKGKQRVFHHLILVGLYQLGHMRIPAHAAVGETVEGAQALKGPR-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   RE+  L    +   AG  + P W  + L++ Y ++ + +  ++   +P+   
Sbjct: 115 NAVLRNYQREQQALDEFSVSHNAGKYVHPSWLLKILQDAYPEQWQTIVEANNNKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  + SLPGF +G   
Sbjct: 175 VNHAHHDRDEYLQLLKNANIDSTLHSEAMDAIKLAA--------PCDVHSLPGFEQGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A +        +   +LD CAAPGGKTA ++  VS  +V ALD  ++RL+++  N
Sbjct: 227 VQDAAAQLSFNYLQPKDGELILDCCAAPGGKTAHILERVSAREVVALDCDEQRLKRVTEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  +DI  
Sbjct: 287 LKRLNLQAK-VICGDARNPEQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDITA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            A  Q ++     + +KPGG +V++ CS+   ++ E V+  L  +P
Sbjct: 346 LAQLQSEIFDAMWAQLKPGGTLVYATCSITPMENVEQVKAFLARTP 391


>gi|271502215|ref|YP_003335241.1| sun protein [Dickeya dadantii Ech586]
 gi|270345770|gb|ACZ78535.1| sun protein [Dickeya dadantii Ech586]
          Length = 431

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 126/408 (30%), Positives = 209/408 (51%), Gaps = 38/408 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++  L  V+ +  SL+ LL      +  R +S+RD+ L++ I    LR L
Sbjct: 1   MKSTYNLRSIAATTLLQVVEQGQSLSQLLP-----ALQRDISERDRGLLQEICFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  L  ++   L  K+  L  LL V + Q+++  +  +A +   V  A   K  +  
Sbjct: 56  PQLDWYLRQLMAKPLTGKQKVLHYLLMVGLYQLIHTRIPPHAALAETVNGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFY-GKERVLAISDACISPL 176
             L+N +LR+  RE+  L QR+         P+W  +RL+  Y G+   +  ++    P+
Sbjct: 115 KGLINGVLRQFQREQEALQQRLQNNPARYSHPDWLLQRLKKAYPGQWEQIIDANNQHPPM 174

Query: 177 YIDLTVKF---------------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEG 221
           ++ +  +                +    AH  +A+ L T        P ++  LPGF +G
Sbjct: 175 WLRVNRRHHTREAYLALLQEKGIEAHPHAHYPDAIRLST--------PCAVNVLPGFEKG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKL 279
              VQDASA   +      ++  +LDLCAAPGGKT  ++ +   A+V A+DV ++RL+++
Sbjct: 227 FVTVQDASAQGCIHWLSPQDHEDILDLCAAPGGKTTHILEAAPHARVLAVDVDEQRLKRV 286

Query: 280 RCNLDRLHLYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           R NL RL+L+AE           +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI
Sbjct: 287 RENLQRLNLHAEVKCGDGRTPTQWCGDKCFDRILLDAPCSATGVIRRHPDIKWLRRDSDI 346

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSS 384
            + A  Q  +L      +K GG +V++ CS L +++ +++   + R +
Sbjct: 347 AELASLQNTILEAIWPRLKNGGTLVYATCSVLPEENCQQIADFLQRHA 394


>gi|259909968|ref|YP_002650324.1| 16S rRNA methyltransferase B [Erwinia pyrifoliae Ep1/96]
 gi|224965590|emb|CAX57122.1| 16S rRNA methyltransferase B [Erwinia pyrifoliae Ep1/96]
          Length = 429

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 118/397 (29%), Positives = 214/397 (53%), Gaps = 21/397 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  L++ +    LR L
Sbjct: 1   MKKMTNLRCIAARTIEQVVEQGQSLSNVLP-----AAQKSVGDKDAALLQELCYGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ ++  ++   +  K+ +L  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWIISKLMSRPMTGKQRALHFLIMVGLYQLMFTRIPPHAALAETVEAAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+Q++       + P+W  ERL+  +  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELMQQMNDGDQQYLHPKWLLERLKRAWPVQWQQIVAANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKL-----NAVMLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    +TW   L      A   P     L+ ELP ++  LPGF +G   VQDAS
Sbjct: 175 WLRVNRQHHSRDTWLALLEESGKQAFTHPRHSDALRLELPCAVHQLPGFDQGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++ +   AKV A+DV  +RL ++  NL RL+
Sbjct: 235 AQGCVALLAPRDGEQILDLCAAPGGKTTHILEAAPQAKVLAVDVDAQRLARISENLQRLN 294

Query: 288 LYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           L+AE  +        +C  +LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q+
Sbjct: 295 LHAEVKLGDGRTPAAWCGDRLFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQQ 354

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           ++L     ++K GG ++++ CS+  +++   + + L+
Sbjct: 355 QILDAVWPYLKSGGTLLYATCSVLPEENHLQISQFLQ 391


>gi|238797213|ref|ZP_04640714.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           mollaretii ATCC 43969]
 gi|238718850|gb|EEQ10665.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           mollaretii ATCC 43969]
          Length = 431

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 215/407 (52%), Gaps = 41/407 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L           +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLHNSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPHHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNESRYLHPSWLLARIKLAYPDQWQQILDANNQKPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y++L  + DI+   H L  +A+ L T        P ++ +LPGF  G
Sbjct: 175 WLRVNRLHHTRSEYLELLKQADIDAVPHDLYSDALRLIT--------PCAVSALPGFELG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKL 279
              VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL+++
Sbjct: 227 WATVQDASAQGCVDLLDPHNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLDRV 286

Query: 280 RCNLDRLHLYAEDIIEMD----AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           + NL RL L+A  ++ +       D+C  + FD +L+DAPCS+TG IRRHPD+ W R   
Sbjct: 287 KENLQRLKLHA--VVRVGDGRTPEDWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDR 344

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           DI + A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 345 DIAELAQLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQIAAFLQ 391


>gi|227115242|ref|ZP_03828898.1| 16S rRNA methyltransferase B [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 429

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 208/403 (51%), Gaps = 35/403 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +       R +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVYQ-----REVSDKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE     K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGTVSLKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+QR A  S   + P W   R+E  Y    + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELIQREATHSSHYLHPSWLLTRIERAYPHHWQNIVEANNQRPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y++L  +  IE + H           IRL   P ++  LPGF++G  
Sbjct: 175 WLRVNRLHHTREAYLNLLDQEGIEAFPHAEY-----NDAIRLAA-PCAVDQLPGFSQGWA 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRC 281
            VQDASA   V      +   +LDLCAAPGGKT  ++ +  K  V A+DV + RL +++ 
Sbjct: 229 TVQDASAQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDVDETRLGRVKE 288

Query: 282 NLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL RL ++AE + + D      +C  ++FD VL+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLLRLQMHAE-VKQGDGRYPDSWCEGRVFDRVLLDAPCSATGVIRRHPDIKWLRRDRDIE 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           +    Q+++L      +K GG +V++ CS+  Q++ + V   L
Sbjct: 348 ELVALQKEILDAIWPHLKTGGTLVYATCSILPQENTQQVADFL 390


>gi|260771086|ref|ZP_05880014.1| ribosomal RNA small subunit methyltransferase B [Vibrio furnissii
           CIP 102972]
 gi|260613975|gb|EEX39166.1| ribosomal RNA small subunit methyltransferase B [Vibrio furnissii
           CIP 102972]
          Length = 426

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 118/387 (30%), Positives = 202/387 (52%), Gaps = 26/387 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ +L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAAQVLFQVVDKGQSLSMALP-----AAQQNIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ S L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIANALMDSPLKGKQRVFHHLILVGIYQLSFMRIPPHAAVGETVEGAQDLKGPR-LRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R +     E +   AG    P W  + L+N Y ++   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQDALDTEAMSHNAGKYGHPSWLLKLLQNAYPQQWEAIVEANNSKAPMWLR 174

Query: 180 LTVK-FDIETWAHKLNAVMLPTG-------GIRLKELPESIVSLPGFAEGVWWVQDASAS 231
           +  +  + + +   LN   + +         ++L   P  +  LPGFA+G   VQDA+A 
Sbjct: 175 VNHQHHERDAYQALLNHENIDSSVHSQAHDALKLAA-PCDVTQLPGFAQGWVSVQDAAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
           + +      +   +LD CAAPGGKTA ++    G  V A+D    RL+++  NL RL+L 
Sbjct: 234 LALHYLQPQDGELILDCCAAPGGKTAHILERTHGCDVVAIDCDDTRLKRVHDNLKRLNLS 293

Query: 290 AEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
           A+ ++  DA     +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR+
Sbjct: 294 AK-VVCGDARYPEQWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALAELQRE 352

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDS 373
           +L      +KPGG +V++ CS+  Q++
Sbjct: 353 ILDAMWQQLKPGGTLVYATCSITPQEN 379


>gi|315178589|gb|ADT85503.1| cytosine-C5-methylase [Vibrio furnissii NCTC 11218]
          Length = 426

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 117/387 (30%), Positives = 202/387 (52%), Gaps = 26/387 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ +L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAAQVLFQVVDKGQSLSMALP-----AAQQNIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ S L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SIANALMDSPLKGKQRVFHHLILVGIYQLSFMRIPPHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R +     E +   AG    P W  + L+N Y ++   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQDALDAEAMSHNAGKYGHPSWLLKLLQNAYPQQWEAIVEANNSKAPMWLR 174

Query: 180 LTVKF-DIETWAHKLNAVMLPTG-------GIRLKELPESIVSLPGFAEGVWWVQDASAS 231
           +  +  + + +   LN   + +         ++L   P  +  LPGFA+G   VQDA+A 
Sbjct: 175 VNHQHHERDAYQALLNHENIDSSVHSQARDALKLAA-PCDVTQLPGFAQGWVSVQDAAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
           + +      +   +LD CAAPGGKTA ++    G  V A+D    RL+++  NL RL+L 
Sbjct: 234 LALHYLQPQDGELILDCCAAPGGKTAHILERTHGCDVVAIDCDDTRLKRVHDNLKRLNLS 293

Query: 290 AEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
           A+ ++  DA     +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR+
Sbjct: 294 AK-VVCGDARYPEQWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALAELQRE 352

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDS 373
           +L      +KPGG +V++ CS+  Q++
Sbjct: 353 ILDAMWQQLKPGGTLVYATCSITPQEN 379


>gi|148261637|ref|YP_001235764.1| Fmu (Sun) domain-containing protein [Acidiphilium cryptum JF-5]
 gi|146403318|gb|ABQ31845.1| Fmu (Sun) domain protein [Acidiphilium cryptum JF-5]
          Length = 415

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 147/389 (37%), Positives = 210/389 (53%), Gaps = 33/389 (8%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
           LR L  +DA+L+  L  + P     ++ +LR+  AQ+  L    +A V  AV  A     
Sbjct: 53  LRRLGSLDAILEPHLRRAPP---APVRHILRIGAAQLALLGAPAHAAVSTAVGLAHARGL 109

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP 175
            + FA LVN++LR+VS +    L+ +    +  P W      ++    R +A +    +P
Sbjct: 110 GK-FAGLVNAVLRKVSADGAAALEALDSPRLDTPAWL---WASWGAAARAIATTHQGEAP 165

Query: 176 LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
           L  DLT+K   +  A       LPTG +RL    + +  L G+A G  WVQDA+A++P +
Sbjct: 166 L--DLTLK---DGAAVPEGGERLPTGSVRLPAGTD-VTQLYGYAAGTLWVQDAAAALPAR 219

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
           L G +    VLDLCAAPGGKTAQL  +GA VTALD   RRL +LR NLDRL L AE  + 
Sbjct: 220 LLGDVAGRRVLDLCAAPGGKTAQLAAAGAAVTALDRDARRLARLRENLDRLGLAAE-TVA 278

Query: 296 MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
            DA D+ P + FDA+L+DAPCS+TGTIRRHP++L  R   DI   A  Q +LL    + +
Sbjct: 279 ADALDWRPAQRFDAILLDAPCSATGTIRRHPEILHLRRPRDIETCAALQDRLLDAAAAML 338

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKV-----LRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
            PGG +V++ CSL  ++    ++       LR +P+    +P          +A A++P 
Sbjct: 339 APGGTLVYAVCSLQPEEGARRIEAACGRLGLRRAPLGAAELP---------GLAEAVTPA 389

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALR 439
           G +   P M  +      GMDGFFA  L+
Sbjct: 390 GDLATHPGMWAE----RGGMDGFFAARLQ 414


>gi|304399258|ref|ZP_07381124.1| sun protein [Pantoea sp. aB]
 gi|304353184|gb|EFM17565.1| sun protein [Pantoea sp. aB]
          Length = 433

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 135/459 (29%), Positives = 225/459 (49%), Gaps = 54/459 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSINLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDSALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+  L  L+ V + Q+ Y  V  +A +   V  A+  K     
Sbjct: 56  PQLEALIGKLMARPLTGKQRVLHYLIMVGLYQLEYTRVPAHAALAETVAGAEVLKRTS-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL  I       + P W  +RL++ + ++ + +  ++    P+
Sbjct: 115 KGLLNGVLRQFQRQREELLASIQDGPQRYLHPGWLLKRLQHAWPEQWQQIVEANNQRPPM 174

Query: 177 YIDLTVKF-DIETWAHKLNAVMLPTG-----------GIRLKELPESIVSLPGFAEGVWW 224
           ++ +  +  + + W     A++  +G            +RL + P  +  LPGF +G   
Sbjct: 175 WLRVNQQHHERDAWL----ALLTESGRNAQPADDVPDALRL-DAPAPVSQLPGFGQGWVT 229

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCN 282
           VQD SA     L    N   +LDLCAAPGGKT  +  I   A+V A+DV  +RL+++  N
Sbjct: 230 VQDLSAQRCALLLEPQNGEQILDLCAAPGGKTTHILEIAPEAEVMAVDVDAQRLKRVEEN 289

Query: 283 LDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL + A D+ + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI +
Sbjct: 290 LQRLGMKA-DVKQGDGRTPQQWCGDRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAE 348

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  Q ++L      +KPGG ++++ CS+  +++ + +   L+      + VPL  A   
Sbjct: 349 LAKLQSEILNAVWPHLKPGGTLIYATCSILPEENHQQIDAFLQRQ-HDAQAVPLRDA--- 404

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
                    P   +++ P         + G DGFF   L
Sbjct: 405 ---------PANGLQVFPQ--------AEGGDGFFYAKL 426


>gi|326405127|ref|YP_004285209.1| RNA methyltransferase [Acidiphilium multivorum AIU301]
 gi|325051989|dbj|BAJ82327.1| RNA methyltransferase [Acidiphilium multivorum AIU301]
          Length = 418

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 147/389 (37%), Positives = 210/389 (53%), Gaps = 33/389 (8%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
           LR L  +DA+L+  L  + P     ++ +LR+  AQ+  L    +A V  AV  A     
Sbjct: 56  LRRLGSLDAILEPHLRRAPP---APVRHILRIGAAQLALLGAPAHAAVSTAVGLAHARGL 112

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP 175
            + FA LVN++LR+VS +    L+ +    +  P W      ++    R +A +    +P
Sbjct: 113 GK-FAGLVNAVLRKVSADGAAALEALDSPRLDTPAWL---WASWGAAARAIATTHQGEAP 168

Query: 176 LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
           L  DLT+K   +  A       LPTG +RL    + +  L G+A G  WVQDA+A++P +
Sbjct: 169 L--DLTLK---DGAAVPEGGERLPTGSVRLPAGTD-VTQLYGYAAGTLWVQDAAAALPAR 222

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
           L G +    VLDLCAAPGGKTAQL  +GA VTALD   RRL +LR NLDRL L AE  + 
Sbjct: 223 LLGDVAGRRVLDLCAAPGGKTAQLAAAGAAVTALDRDARRLARLRENLDRLGLAAE-TVA 281

Query: 296 MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
            DA D+ P + FDA+L+DAPCS+TGTIRRHP++L  R   DI   A  Q +LL    + +
Sbjct: 282 ADALDWRPAQRFDAILLDAPCSATGTIRRHPEILHLRRPRDIETCAALQDRLLDAAAAML 341

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKV-----LRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
            PGG +V++ CSL  ++    ++       LR +P+    +P          +A A++P 
Sbjct: 342 APGGTLVYAVCSLQPEEGARRIEAACGRLGLRRAPLGAAELP---------GLAEAVTPA 392

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALR 439
           G +   P M  +      GMDGFFA  L+
Sbjct: 393 GDLATHPGMWAE----RGGMDGFFAARLQ 417


>gi|183600721|ref|ZP_02962214.1| hypothetical protein PROSTU_04317 [Providencia stuartii ATCC 25827]
 gi|188019701|gb|EDU57741.1| hypothetical protein PROSTU_04317 [Providencia stuartii ATCC 25827]
          Length = 428

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 212/403 (52%), Gaps = 27/403 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +  V+    SL+ +L +L+      + ++++D+ L++ I    LR+
Sbjct: 1   MKNTYNLRSIAAVAIGQVIDGGQSLSTVLPELQ------KNINEKDKSLLQEICFGVLRY 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   L  K+ +L  L+ V + Q+LY  +  +A +   V  A   K  + 
Sbjct: 55  LPKLEWFVAQLMEKPLTGKQRTLHYLIMVGIYQLLYTRIPPHAALAETVNGAVALKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFY-GKERVLAISDACISP 175
              L+N +LR   R++ +L +R    S   + P W  +RL+N Y  K + +  ++    P
Sbjct: 114 LKGLINGVLRSFQRQQTQLEERNTNNSSQYLHPSWLLKRLQNAYPDKWQTIIDANNQRPP 173

Query: 176 LYIDLTVKFDIETWAHK------LNAVMLPTG--GIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +  +        K      + + + P     I+L E P S+  LPGF +G   VQD
Sbjct: 174 MWLRVNSQHHTAEQYQKYLEENEIASELHPHHPCAIKLSE-PTSVTRLPGFEKGWATVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDR 285
            SA    +L    N+ ++LDLCAAPGGKT  ++     A V A+D+ + RL++++ NL R
Sbjct: 233 VSAQGCAELLEPQNHETILDLCAAPGGKTTHILELAPKAHVVAVDIDEHRLKRVKENLQR 292

Query: 286 LHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L   A  +I+ D     ++   +LFD +L+DAPCS+TG IRRHPD+ W R   DI +   
Sbjct: 293 LQQQAA-VIQGDGTKPEEWANGQLFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELTE 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q K+L     ++K GG +V++ CS+  +++   ++  L   P
Sbjct: 352 LQAKILESIWPYLKVGGTLVYATCSIMPEENSLQIKNFLAKHP 394


>gi|123444066|ref|YP_001008036.1| 16S rRNA methyltransferase B [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|224493291|sp|A1JRZ3|RSMB_YERE8 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|122091027|emb|CAL13910.1| conserved hypothetical protein [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 429

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 122/408 (29%), Positives = 212/408 (51%), Gaps = 43/408 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLQKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-------------- 163
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +              
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSHYLHPSWLLARIKLAYPDQWQQILDANNQKPPM 174

Query: 164 --RVLAISDACISPLYIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFA 219
             RV  +  + I   Y++L  + +IE   H    +AV L T        P ++  LPGF 
Sbjct: 175 WLRVNRLHHSRIE--YLELLKQANIEALPHDFYPDAVRLIT--------PCAVSDLPGFE 224

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT--ALDVSKRRLE 277
            G   VQDASA   V L    +   +LDLCAAPGGKT  ++ +  KV   A+D+ ++RL 
Sbjct: 225 LGWVTVQDASAQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKVHVLAVDIDEQRLS 284

Query: 278 KLRCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           +++ NL RL L+A D+   D     ++C  + FD +L+DAPCS+TG IRRHPD+ W R  
Sbjct: 285 RVKENLQRLRLHA-DVRVGDGRTPDEWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRD 343

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
            DI + A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 344 SDIAELAQLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQIATFLQ 391


>gi|163751682|ref|ZP_02158901.1| sun protein [Shewanella benthica KT99]
 gi|161328421|gb|EDP99577.1| sun protein [Shewanella benthica KT99]
          Length = 425

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 132/456 (28%), Positives = 219/456 (48%), Gaps = 56/456 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +   V+ K  SL+  L     D    L S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAARVAFQVLEKGTSLSVALP----DQQQHLESGKDKALLAELSYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KLVSDCMSKPLKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R++  L      ++   P W  +RL+  Y +     I  +   P        
Sbjct: 116 NGVLRNIQRQEKPLPTDNDTLAFNTPAWIVKRLKAAYPENWQEVIEQSHQRPPMWLRNNK 175

Query: 176 ------LYIDLTVKFDIETWAHKL-NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + DI   A K  +A++L        E P  +  LPGF +G   VQD 
Sbjct: 176 QSQTRDEYLAALAEIDIPASAGKSSDAILL--------ESPRDVAQLPGFEQGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRCNLDRLH 287
           +A     L    +   +LD CAAPGGKT  L+ ++  ++ A+D  ++RLE+++ NLDRL 
Sbjct: 228 AAQWAATLLAPKDGELILDACAAPGGKTCHLLELANIELVAVDFDEKRLERVQQNLDRLS 287

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A+ ++  DA D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 288 LKAK-LVHGDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQTDIDELASLQ 346

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            K+L     ++KPGG ++++ CS+  Q++E+ ++  L  +     L P++          
Sbjct: 347 SKILDHCWQWLKPGGTLLYATCSILPQENEQQIRSFLARAD-DATLFPISEQP------- 398

Query: 405 MALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
              +P+  GW +ITP         +  MDGF+   L
Sbjct: 399 ---NPDDIGW-QITPG--------TENMDGFYYARL 422


>gi|260901337|ref|ZP_05909732.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ4037]
 gi|308109871|gb|EFO47411.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ4037]
          Length = 427

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 206/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  ++ LP F +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAA--------PCDVMKLPSFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAELQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|325924335|ref|ZP_08185879.1| ribosomal RNA small subunit methyltransferase RsmB [Xanthomonas
           gardneri ATCC 19865]
 gi|325545200|gb|EGD16510.1| ribosomal RNA small subunit methyltransferase RsmB [Xanthomonas
           gardneri ATCC 19865]
          Length = 436

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 134/412 (32%), Positives = 209/412 (50%), Gaps = 29/412 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ +RL ++ +L+ V  +  SL      E   S   L   RD+ LV AI    LR  P 
Sbjct: 8   AGVASRLAAARVLTAVFDQGRSLKA----ELAASLPGLSDPRDRALVEAICFAVLRRRPA 63

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D  L   L   LP +   L+ LL    AQ+  L +  +A +   V+  +     R  A 
Sbjct: 64  YDVALRQWLERPLPPRDAELKALLMAGFAQLDVLQLPAHAALSATVDACRALGRPRQ-AG 122

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPLYIDLT 181
           +VN+ILRR  RE    +   AG    P W +++L   +G +   + ++ A ++P+++ + 
Sbjct: 123 MVNAILRRAQREGFPAVSADAGW---PSWLRKQLRADWGDRAETIFVASALMAPMWLRVH 179

Query: 182 -VKFDIETWAHKLNAV--------MLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDASAS 231
             + D   +  +L  +        +LP   +RL   LP  +  LPGFAEG   VQD SA 
Sbjct: 180 RGRTDPAAYVARLAELGIAAETDPVLPDA-VRLHIALP--VSQLPGFAEGEVSVQDGSAQ 236

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
                    ++  VLD CAAPGGK A L+    G ++TALDV  RRLE+++  L R    
Sbjct: 237 QVADALPLASSARVLDACAAPGGKAAHLLERYPGLQLTALDVDARRLERVQQTLQRTVPG 296

Query: 290 AEDIIEM-DAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           A+  ++  DA D   +  ++ FDAVL+DAPCS+TG +RR PDVL  R  DDI      Q 
Sbjct: 297 AQVALQAADAADPAGWWDEQPFDAVLLDAPCSATGVVRRQPDVLLHRRADDIDAVCALQA 356

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
           +LL      ++PGG ++++ CSL  ++++  V+  L+ +P   +  PL + +
Sbjct: 357 RLLDATWRTLRPGGQLLYTTCSLLARENQAQVEAFLQQTPD-AQAQPLGAQF 407


>gi|310765566|gb|ADP10516.1| Ribosomal RNA small subunit methyltransferase B [Erwinia sp.
           Ejp617]
          Length = 441

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 117/397 (29%), Positives = 213/397 (53%), Gaps = 21/397 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  L++ +    LR L
Sbjct: 13  MKKMTNLRCIAARTIEQVVEQGQSLSNVLP-----AAQKSVGDKDAALLQELCYGVLRTL 67

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ ++  ++   +  K+ +L  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 68  PQLEWIISKLMSRPMTGKQRALHFLIMVGLYQLMFTRIPPHAALAETVEAAVALKRPQ-L 126

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+Q++       + P+W  ERL+  +  + + +  ++    P+
Sbjct: 127 KGLINGVLRQFQRQQDELMQQMNDGDQQYLHPKWLLERLKRAWPVQWQQIVAANNQRPPM 186

Query: 177 YIDLTVKFDI-ETWAHKL-----NAVMLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    + W   L      A   P     L+ ELP ++  LPGF +G   VQDAS
Sbjct: 187 WLRVNRQHHSRDAWLALLEESGKQAFTHPRHSDALRLELPCAVHQLPGFDQGWVTVQDAS 246

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++ +   AKV A+DV  +RL ++  NL RL+
Sbjct: 247 AQGCVALLAPRDGEQILDLCAAPGGKTTHILEAAPQAKVLAVDVDAQRLARISENLQRLN 306

Query: 288 LYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           L+AE  +        +C  +LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q+
Sbjct: 307 LHAEVKLGDGRTPAAWCGDRLFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQQ 366

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           ++L     ++K GG ++++ CS+  +++   + + L+
Sbjct: 367 QILDAVWPYLKSGGTLLYATCSVLPEENHLQISQFLQ 403


>gi|238898791|ref|YP_002924473.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
 gi|229466551|gb|ACQ68325.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Candidatus
           Hamiltonella defensa 5AT (Acyrthosiphon pisum)]
          Length = 429

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 126/409 (30%), Positives = 213/409 (52%), Gaps = 42/409 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  + R +++ ++S V+ K  SL+ +L        ++     D+ L++ +   TLR L
Sbjct: 1   MKNTYHLRAIAAQIISQVLDKGRSLSVVLPEVQNHVPYK-----DKALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PR++  +  ++   L  KK  L  LL V + Q++Y  +  +A++   V+ A   K  + F
Sbjct: 56  PRLEHCVKHLMTRPLNAKKRLLHFLLMVGLYQLIYTRIPPHAILSETVKAAAVLKYPQ-F 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS--IIPEWFKERLENFYGKE--RVLAISDACISPL 176
             L+N+ILR   R K  LLQ++      + P+W  +R++  Y ++   +L  ++    P+
Sbjct: 115 KGLINAILREFERRKESLLQKVEAQDPYLHPQWLLQRIKTAYPEQWPSILRANNE-RPPM 173

Query: 177 YIDLTV-------------KFDIETWAHK--LNAV-MLPTGGIRLKELPESIVSLPGFAE 220
           +I + V             K  I+  AH   L+AV +LP         P S+  LPGF  
Sbjct: 174 WIRVNVLHHSREKYLTELEKSGIKAKAHSICLDAVQILP---------PCSVKELPGFDL 224

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEK 278
           G   VQD SA   + L    N+  +LDLCAAPG KT  ++     A V A+D+  +RLE+
Sbjct: 225 GWATVQDVSAQRCIDLLDPQNDDYILDLCAAPGVKTTHILERAPSADVLAVDIDAKRLER 284

Query: 279 LRCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           ++ NL RLHL A   +  DA     +   K+FD +L+D PCS+TG IRRHPD+ W R   
Sbjct: 285 IKENLQRLHLSARLKV-ADALVPEQWYEGKMFDKILLDVPCSATGIIRRHPDIKWLRRDS 343

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           DI   A  Q +++      ++ GG++++S CS+  +++++ + + L+  
Sbjct: 344 DIAALAQLQSEIIKAVWPTLRQGGMLLYSTCSILPEENQQQITEFLKHQ 392


>gi|71898895|ref|ZP_00681062.1| Fmu, rRNA SAM-dependent methyltransferase [Xylella fastidiosa
           Ann-1]
 gi|71731307|gb|EAO33371.1| Fmu, rRNA SAM-dependent methyltransferase [Xylella fastidiosa
           Ann-1]
          Length = 429

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 205/400 (51%), Gaps = 34/400 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M  G+  R+V++ +L+ V+ +  SL      E   +   L   RD+ LV AI    LR  
Sbjct: 1   MSDGIAPRVVAARVLALVVDQGRSLKT----ELAAALPTLEDVRDRALVEAICFAVLRRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P  +A L   L   L R    L+ LL V  AQ+  L V  YA +   V+ A R     H 
Sbjct: 57  PVYEAALTRWLARPLGRGDAQLRGLLMVGFAQLDVLKVPPYAALSATVD-ACRVLGWPHR 115

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI--SPLYI 178
           A  VN++LRR  RE++ +   ++  +  P W  ER+   +G E+  AI DA +  +P+++
Sbjct: 116 ASFVNAVLRRAQRERLPV---VSSDAAWPRWLAERIRADWG-EQAEAIFDASLKPAPMWL 171

Query: 179 DLTVKF-DIETWAHKLNAVML---PTGGIRLKELPES--------IVSLPGFAEGVWWVQ 226
            + +++ D  T+  +L A  L   P+G +     PE+        ++ LPGF  G   VQ
Sbjct: 172 RVNLRYGDRHTYVQRLQAAGLEAVPSGLV-----PEALALDCSMPVLQLPGFQAGEVSVQ 226

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--TALDVSKRRLEKLRCNLD 284
           D SA     L     +  +LD CAAPGGK A L+     +  TALDV  +RL ++    D
Sbjct: 227 DLSAQQVAALLSPAPHARLLDACAAPGGKAAHLLERAPTLCLTALDVDMQRLRRVAETCD 286

Query: 285 RLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           R+H+ A  +   DA D   +   + FDAVL+DAPCS+TG +RR PDVL  R  +D++   
Sbjct: 287 RIHVKAR-LCVADATDLAAWWDGEAFDAVLLDAPCSATGVVRRQPDVLLHRRAEDLLHLL 345

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
             Q +LL      ++PGG++V+  CS+ + +++  ++  L
Sbjct: 346 NIQSRLLDACWRTLRPGGVLVYMTCSVLRAENQTQLEAFL 385


>gi|296533616|ref|ZP_06896179.1| rRNA (cytosine-C(5)-)-methyltransferase [Roseomonas cervicalis ATCC
           49957]
 gi|296266054|gb|EFH12116.1| rRNA (cytosine-C(5)-)-methyltransferase [Roseomonas cervicalis ATCC
           49957]
          Length = 376

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 148/387 (38%), Positives = 201/387 (51%), Gaps = 31/387 (8%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
           LR L  +DAVL+  L    P +   ++  LR+  A++L L+   +A V   V     D  
Sbjct: 15  LRRLGSLDAVLEPSLRREPPPE---VRNALRIGAAELLLLETPPHAAVASCV-----DLV 66

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP 175
            R FA LVN++LR+V+      L+ + G  +  P W        YG   V AI+ A   P
Sbjct: 67  PRPFAGLVNAVLRKVAAAGPAALEELDGERLDTPGWLWSAWHGAYGPA-VRAIARAHRLP 125

Query: 176 LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
             +DL++K           A+MLPTG  R       I  LP FAEG+ W QDA+A++P +
Sbjct: 126 APLDLSLKPGTPA---PEGALMLPTGTARFPAG-TRITELPAFAEGLAWAQDAAAALPAR 181

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
           L      + V DLCAAPGGKTAQL  +GA VTA++    RL +LR N+ RL L  E  ++
Sbjct: 182 LLAVTPGMLVADLCAAPGGKTAQLAAAGAAVTAVERDPTRLLRLRENMARLGLPVES-VQ 240

Query: 296 MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
            D  ++ P   FDA+L+DAPCS+TGTIRRHPDV   +   DI   A  QR+LL      +
Sbjct: 241 ADVAEWDPGTRFDAILLDAPCSATGTIRRHPDVPHLKRPGDIATLAGLQRQLLAAAARLL 300

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKV---LRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            PGG +VF+ CSL  ++ E         L   PI  E VP          +  ALSP+GW
Sbjct: 301 APGGRLVFATCSLQPEEGEAQAASPPPGLLPDPIRPEEVP---------GLEAALSPQGW 351

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALR 439
           +R  PD+  +      G+DGFF    R
Sbjct: 352 LRTRPDLWAE----QGGLDGFFMARFR 374


>gi|145300988|ref|YP_001143829.1| ribosomal RNA small subunit methyltransferase B [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142853760|gb|ABO92081.1| ribosomal RNA small subunit methyltransferase B [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 430

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 130/409 (31%), Positives = 210/409 (51%), Gaps = 26/409 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ ++  V+ +  SL+ +L      +A   ++ RD+ L++ +   TLR+LPR+D
Sbjct: 1   MKTRAQAALVIQQVLDQGQSLSAVLP-----AAQEKVAPRDRALLQELCYGTLRWLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A +  ++   L  K      L+ V + Q++Y  +  +A V   V   K  K       L+
Sbjct: 56  AAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKLLK-GTSLRGLI 114

Query: 125 NSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE-RVLAISDACISPLYI- 178
           N +LR   R    +L RI  +  I    PEW  +RL   Y ++   +  ++    P++I 
Sbjct: 115 NGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPEDWEFIMEANNQRPPMWIR 174

Query: 179 DLTVKFDIETWAHKL-----NAVMLPTG-GIRLKELPESIVSLPGFAEGVWWVQDASASI 232
           + + +   E    ++     NAV    G    L E P  +  LPGF  G   VQD +A  
Sbjct: 175 NNSQRQGREQMLARMAEVGINAVAGQEGEDCILLERPCDVTKLPGFETGDCSVQDGAAQQ 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG---AKVTALDVSKRRLEKLRCNLDRLHLY 289
             +L        VLD CAAPGGKTA L+      A V A+D  + RL++++ NLDR+ L 
Sbjct: 235 AARLLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDADENRLKRVQENLDRIGLQ 294

Query: 290 AEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
           A  +I  DA     + P+  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  QR+
Sbjct: 295 AR-VIHGDASTPELWWPQGQFDRILLDAPCSATGVIRRHPDIKWLRRDQDIRELAELQRR 353

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           +L+   S +K GG ++++ CS+  +++ E ++  L ++P    LVPL++
Sbjct: 354 ILIALWSKLKSGGTLLYATCSVLPEENREQIRAFLATTP-DATLVPLHA 401


>gi|238788880|ref|ZP_04632670.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           frederiksenii ATCC 33641]
 gi|238722907|gb|EEQ14557.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           frederiksenii ATCC 33641]
          Length = 429

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 121/407 (29%), Positives = 211/407 (51%), Gaps = 41/407 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLHKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKQTYPAQWQQILDANNQKPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y+DL  + +I+   H +  +AV L T        P ++  LPGF  G
Sbjct: 175 WLRVSRLHHSRNEYLDLLKQANIDALPHDVYPDAVRLIT--------PCAVSDLPGFELG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKL 279
              VQDASA   V L    N   +LDLCAAPGGKT  ++ +  K  V A+D+ ++RL ++
Sbjct: 227 WVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKTHVLAVDIDEQRLNRV 286

Query: 280 RCNLDRLHLYA----EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           + NL RL L A     D    D   +C  + FD +L+DAPCS+TG IRRHPD+ W R   
Sbjct: 287 KENLQRLKLNAVVRVGDGRTPDT--WCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDS 344

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           DI + A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 345 DIAELAKLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQITAFLQ 391


>gi|77359003|ref|YP_338578.1| 16S rRNA methyltransferase [Pseudoalteromonas haloplanktis TAC125]
 gi|76873914|emb|CAI85135.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 431

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 213/416 (51%), Gaps = 36/416 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +  N R +++  L  V+ K  SL   L       A + L  +D+ L++ I    LR+L
Sbjct: 1   MSNVPNVRALAAETLYNVVDKGASLNQELPF-----ASQGLPPKDKALLQQICYGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P ++     ++   L  K+   Q LL V + Q+ ++ V  +A +   V  A +       
Sbjct: 56  PSLENYCQHLVEEPLKGKRRIFQFLLYVGIYQLQHMRVPPHAAISETVN-ALQQLRALGL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGK--ERVLA------- 167
             L+N+ILR   R+++EL ++   I +     P WF ++++  Y    E +LA       
Sbjct: 115 KGLINAILRSFQRQQLELEEKAKLIPVCLYNHPNWFIKQVKEAYPDSWEDLLAENQQQAP 174

Query: 168 ----ISDACISPL-YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
               ++ A  S   Y D+    DIE   H LN   +   GI+L + P  + SLP F  G 
Sbjct: 175 MWLRVNQAQYSTQEYSDMLTANDIE---HTLNPDFI--DGIKLAK-PRDVFSLPEFDTGA 228

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRC 281
             VQDA+A +  +     ++ ++LD CAAPGGKT  ++ ++ A+V ALD    RLE+++ 
Sbjct: 229 CSVQDAAAQLAARFLEPKDDDTILDACAAPGGKTCHILELADAEVLALDSDATRLERVKQ 288

Query: 282 NLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL R+ L A D+   DA     +  +K FD +L+D PCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLTRIGLGA-DLQCGDASQPHTWWDEKQFDRILLDVPCSATGVIRRHPDIKWLRRASDIA 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             A  Q  +L      +KPGG +V++ CS+  Q++++ V K L ++   VE +PL+
Sbjct: 348 DLAALQGDILDSIWPLLKPGGTLVYATCSVLPQENQQQVAKFLANN-NDVEHIPLH 402


>gi|27364478|ref|NP_760006.1| 16S rRNA methyltransferase B [Vibrio vulnificus CMCP6]
 gi|46396909|sp|Q8DDE5|RSMB_VIBVU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|27360597|gb|AAO09533.1| ribosomal RNA small subunit methyltransferase B [Vibrio vulnificus
           CMCP6]
          Length = 426

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 209/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ +  SL+  L       A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYQVVDRGNSLSTALP-----EAQQSIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIAGKLMDKPLKGKQRVFHHLILVGLYQLGHMRIPAHAAVGETVEGAQALKGPR-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   RE+  L    +   AG  + P W  + L++ Y ++ + +  ++   +P+   
Sbjct: 115 NAVLRNYQREQQALDEFSVSHNAGKYVHPSWLLKILQDAYPEQWQTIVEANNNKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  + SLPGF +G   
Sbjct: 175 VNHAHHDRDEYLQLLKNANIDSTLHSEAMDAIKLAA--------PCDVHSLPGFEQGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A +        +   +LD CAAPGGKTA ++  VS  +V ALD  ++RL+++  N
Sbjct: 227 VQDAAAQLSFNYLQPKDGELILDCCAAPGGKTAHILERVSAREVVALDCDEQRLKRVTEN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  +DI  
Sbjct: 287 LKRLNLQAK-VICGDARNPEQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDITA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+   ++ E V+  L
Sbjct: 346 LAQLQSEIFDAMWAQLKPGGTLVYATCSITPMENVEQVKAFL 387


>gi|315125135|ref|YP_004067138.1| 16S rRNA methyltransferase [Pseudoalteromonas sp. SM9913]
 gi|315013648|gb|ADT66986.1| 16S rRNA methyltransferase [Pseudoalteromonas sp. SM9913]
          Length = 431

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 131/418 (31%), Positives = 212/418 (50%), Gaps = 38/418 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +  N R +++  L  V+ K  SL   L       A + LS +D+ L++ I    LR+L
Sbjct: 1   MSNVSNVRALAAETLYNVVDKGASLNQELPF-----ASQGLSPKDKALLQQICYGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P ++     ++   L  K+   Q LL V + Q+ ++ V  +A +   V  A +       
Sbjct: 56  PSLENYCQHLVEQPLKGKRRIFQFLLYVGIYQLQHMRVPPHAAISETVN-ALQQLRALGL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGK--ERVLAISDACIS 174
             L+N+ILR   R++ EL ++   I +     P WF ++++  Y    E +L  ++   +
Sbjct: 115 KGLINAILRSFQRQQAELEEKAKQIPVCLYNHPNWFIKQVKEAYPDSWEDILE-ANQQQA 173

Query: 175 PL-------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEG 221
           P+             Y ++    DIE   H LN   +   GI+L + P  + SLP F  G
Sbjct: 174 PMWLRVNQSQFSTQEYSEMLTANDIE---HTLNPDFI--DGIKLSK-PRDVFSLPEFDTG 227

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLR 280
              VQDA+A +  +     N  S+LD CAAPGGKT  ++ ++ A V ALD    RLE+++
Sbjct: 228 ACSVQDAAAQLAARYLDPQNGDSILDACAAPGGKTCHILELADADVLALDSDATRLERVK 287

Query: 281 CNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
            NL+R+ L A D+   DA     +  ++ FD +L+D PCS+TG IRRHPD+ W R   DI
Sbjct: 288 QNLERIGLGA-DLQCGDASQPHTWWDEEQFDRILLDVPCSATGVIRRHPDIKWLRRASDI 346

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
              +  Q  +L      +KPGG +V++ CS+  Q++++ V K L ++    E +PL+S
Sbjct: 347 NDLSTLQGDILDSIWPLLKPGGTLVYATCSVLPQENQQQVAKFLANNE-DAEHIPLHS 403


>gi|91791391|ref|YP_561042.1| sun protein [Shewanella denitrificans OS217]
 gi|91713393|gb|ABE53319.1| sun protein [Shewanella denitrificans OS217]
          Length = 428

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 122/394 (30%), Positives = 199/394 (50%), Gaps = 20/394 (5%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L L+       + + +D+ L+  +    +R LP++D
Sbjct: 2   MNLRALAAKAIFDVLEKGLSLSVALPLQQQ----HVQNGKDKALLAELCYGVMRQLPQLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L      K+  L QLL V   Q+ +  +  +A V    E  ++ K +    K+V
Sbjct: 58  KCVSDCLAKPFKGKQRILHQLLLVGCYQLYFTRIPSHAAVSETAEACRQLKFD-GLVKVV 116

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP---LYIDL 180
           N +LR + R++ EL      +    P W  +RL+  Y ++    I  +   P   L  + 
Sbjct: 117 NGVLRNIQRQEPELNTDSDTLKYNTPAWLIKRLQQAYPQDWQQVIEQSHERPPMWLRNNR 176

Query: 181 TVKFDIETWAHKLNAVMLPTGGIR----LKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
            V+      A   N  +  + G+     L E P  ++ LPGF  G   VQD +A     L
Sbjct: 177 LVQTRDAYLASLTNENIEASAGLSPDAILLESPTDVLQLPGFMSGSASVQDGAAQWAATL 236

Query: 237 FGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
                N  VLD CAAPGGKT  L  I     +TA+D   +RLE+++ NLDRL L A+ +I
Sbjct: 237 LAPQANEVVLDACAAPGGKTCHLLEIAPNISLTAVDFDLKRLERVQQNLDRLKLTAQ-VI 295

Query: 295 EMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQG 351
             DA +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q ++L   
Sbjct: 296 HGDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNSDIDELATLQMQILDHC 355

Query: 352 ISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSS 384
             ++KPGG ++++ CS L +++S+++   + R++
Sbjct: 356 WQWLKPGGTLLYATCSILPEENSQQINAFLTRTA 389


>gi|85060226|ref|YP_455928.1| 16S rRNA methyltransferase B [Sodalis glossinidius str.
           'morsitans']
 gi|123738922|sp|Q2NQQ2|RSMB_SODGM RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|84780746|dbj|BAE75523.1| putative rRNA methylase [Sodalis glossinidius str. 'morsitans']
          Length = 433

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 128/408 (31%), Positives = 203/408 (49%), Gaps = 37/408 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R++++  ++ V+ +  SL  LL           LS++D+ L++ +    +R L
Sbjct: 1   MKTHYNLRVIAARAVAQVLDQGQSLGALLPPLQAP-----LSEKDRALLQELCFGIMRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ +L  ++   L  K+  +  LL V + Q+ Y  +  +A +   VE A   K  + F
Sbjct: 56  PQLEWLLRQLMAKPLTGKQRPVHYLLMVGLYQLTYTRIPPHAALAETVEGAVAMKRPQ-F 114

Query: 121 AKLVNSILRRVSREKIELL---QRIAGISIIPEWFKERLENFYGKERVLAISDACISP-- 175
             L+N +LR+  R++  LL   +R     + P W ++R+   +  +    I      P  
Sbjct: 115 KGLINGVLRQFQRQQPALLADAERQDIRHLHPSWLQKRILAAWPAQYAQIIDANNQRPPM 174

Query: 176 ------------LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y+ L    DI   AH      LP   IRL E+P ++  LPGF  G  
Sbjct: 175 WLRVNRLHHSRDAYLALLAGTDIAAVAHS----QLPDA-IRL-EMPCNVGRLPGFDRGWV 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRC 281
            VQDASA     L    N+ ++LDLCAAPGGKT  +  I   A+V A+DV  +R  ++  
Sbjct: 229 TVQDASAQGCALLLAPQNSETILDLCAAPGGKTTHILEIAPAARVMAVDVDGQRAARIHD 288

Query: 282 NLDRLHLYAEDII----EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           NL RL + AE +I      DA+      LFD +L+DAPCS+TG IRRHPD+ W R   DI
Sbjct: 289 NLQRLGMQAEVVIGDGRTPDAWRS--GMLFDRILLDAPCSATGVIRRHPDIKWLRRDGDI 346

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            + A  QR++L      +K GG ++++ CS+  +++   +   L   P
Sbjct: 347 AELAELQRQILCAAWRVLKLGGTLLYATCSILPEENRGQIAAFLADHP 394


>gi|332163229|ref|YP_004299806.1| 16S rRNA methyltransferase B [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318607711|emb|CBY29209.1| ribosomal RNA small subunit methyltransferase B [Yersinia
           enterocolitica subsp. palearctica Y11]
 gi|325667459|gb|ADZ44103.1| 16S rRNA methyltransferase B [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
          Length = 429

 Score =  167 bits (423), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 122/408 (29%), Positives = 210/408 (51%), Gaps = 43/408 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLQKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-------------- 163
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +              
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSHYLHPSWLLARIKLAYPDQWQQILDANNQKPPM 174

Query: 164 --RVLAISDACISPLYIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFA 219
             RV  +  + I   Y+ L  + +IE   H    +AV L T        P ++  LPGF 
Sbjct: 175 WLRVSRLHHSRIE--YLGLLKQANIEALPHDFYPDAVRLIT--------PCAVSDLPGFE 224

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLE 277
            G   VQDASA   V L        +LDLCAAPGGKT  ++ +   A V A+D+ ++RL 
Sbjct: 225 LGWVTVQDASAQGCVDLLDPQEGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLS 284

Query: 278 KLRCNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           +++ NL RL L+A D+   D     ++C  + FD +L+DAPCS+TG IRRHPD+ W R  
Sbjct: 285 RVKENLQRLKLHA-DVRVGDGRTPDEWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRD 343

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
            DI + A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 344 SDIAELAQLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQIATFLQ 391


>gi|238783195|ref|ZP_04627221.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           bercovieri ATCC 43970]
 gi|238715991|gb|EEQ07977.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           bercovieri ATCC 43970]
          Length = 431

 Score =  167 bits (422), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 120/407 (29%), Positives = 213/407 (52%), Gaps = 41/407 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L           +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLHNTISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKLAYPDQWQQILDANNQKPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y++L  + DI+   H    +A+ L T        P ++ +LPGF  G
Sbjct: 175 WLRVNRLHHSRSEYLELLKQADIDAAPHDAYPDALRLIT--------PCAVSALPGFELG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKL 279
              VQDASA   V+L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL ++
Sbjct: 227 WVTVQDASAQGCVELLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRV 286

Query: 280 RCNLDRLHLYA----EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           + NL RL L+A     D    +A  +C  + FD +L+DAPCS+TG IRRHPD+ W R   
Sbjct: 287 KENLQRLQLHAVVRVGDGRTPEA--WCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDS 344

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           DI + A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 345 DIAELAQLQSEIIEAIWPKLKKGGVMVYATCSILPEENQQQIAAFLQ 391


>gi|157959859|ref|YP_001499893.1| sun protein [Shewanella pealeana ATCC 700345]
 gi|157844859|gb|ABV85358.1| sun protein [Shewanella pealeana ATCC 700345]
          Length = 426

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 131/457 (28%), Positives = 215/457 (47%), Gaps = 57/457 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L     D    L S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALP----DQQRHLDSGKDKALLAELCYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   +   +  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KQVSDCMSKQMKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R++  L      ++   P W  +RL++ Y       I  +   P        
Sbjct: 116 NGVLRNIQRQEKPLATDNDTLAYNTPAWIIKRLKDAYPDNWQSVIEQSHERPPMWLRNNQ 175

Query: 176 ------LYIDLTVKFDIETWA-HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+      +IE  A +  ++++L +        P  ++ LPGF  G   VQD 
Sbjct: 176 QSQTRETYLLALAGLEIEAQAGNSPDSILLSS--------PRDVMQLPGFETGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     +  VLD CAAPGGKT  L  +    K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQGDELVLDACAAPGGKTCHLLELAPNIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE ++  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  
Sbjct: 288 SLKAE-LVHGDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDIEELAQL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++      ++KPGG ++F+ CS+  Q++++ V   L  +P    LVP+          
Sbjct: 347 QSQIFDHCWKWLKPGGTLLFATCSILPQENKDQVSAFLARTP-DATLVPIEE-------- 397

Query: 404 AMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
               +P+  GW +I P            MDGF+   L
Sbjct: 398 --QANPDDIGW-QIVPG--------QDNMDGFYYARL 423


>gi|45434953|gb|AAS60514.1| tRNA and rRNA cytosine-C5-methylases [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 435

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 215/409 (52%), Gaps = 39/409 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+ +  SL+ +L +L+      + +S +D+ L++ +   TLR 
Sbjct: 7   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQ------KNISDKDRALLQELCFGTLRV 60

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  + 
Sbjct: 61  LPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ- 119

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR+  R+++ELL+R        + P W   R++  Y  + + +  ++    P
Sbjct: 120 LKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPP 179

Query: 176 L-------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
           +             Y++L  + DI    H +  +AV L T        P ++  LPGF  
Sbjct: 180 MWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLIT--------PCAVNHLPGFEL 231

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +
Sbjct: 232 GWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSR 291

Query: 279 LRCNLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ NL RL L A   + +  A D +C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 292 VKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRD 351

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           I + A  Q +++      +K GG++V++ CS+  +++++ +   L+  P
Sbjct: 352 ISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP 400


>gi|261866823|ref|YP_003254745.1| methionyl-tRNA formyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261412155|gb|ACX81526.1| methionyl-tRNA formyltransferase [Aggregatibacter
           actinomycetemcomitans D11S-1]
          Length = 451

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 126/403 (31%), Positives = 211/403 (52%), Gaps = 29/403 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           + ++AR  +  +L  V+ +  SL+ LL       A  ++  +D  L++ I     R LPR
Sbjct: 13  TALSARTAAVQILFQVLEQGKSLSSLLP-----DAQVVIKAQDLPLLQEICFGVCRVLPR 67

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ ++  ++   L  KK  +  LL V + QILY  +  YA VD  V  AK + + + F  
Sbjct: 68  LEQIIAQLVDKPLRGKKRIVHCLLLVGLYQILYTRIPVYAAVDEIVNTAK-NLQLQSFQG 126

Query: 123 LVNSILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           LVN++LRR  RE+  +L ++     ++ P+W   +L+  Y   R +  ++    P+++ +
Sbjct: 127 LVNAVLRRFLREQESMLAKVDKHWQTLHPDWLVNKLKKVYPNWREIIEANNQKPPMWLRV 186

Query: 181 -TVKFDIETW-----AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
            T K  +ET+     A +++A +           P S+  LP FAEG   VQD  A    
Sbjct: 187 NTQKNSLETYRTLLTAQQMDAQITSHPQALGLTQPTSVQYLPLFAEGGVTVQDLHAQWAA 246

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYAED 292
            L    N   +LD CAAPGGKT  ++     A+V ALDV + RL++++ NL R+   A  
Sbjct: 247 LLLQPQNGELILDACAAPGGKTTHILELAPQAEVVALDVEENRLQRVKENLARMQQQA-T 305

Query: 293 IIEMDAFDYCPK----KL------FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           I+  DA +  P+    KL      FD +L+DAPCS+TG IRRHPD+ W R   DI     
Sbjct: 306 IVCGDAAN--PRAWLTKLGKSAVRFDRILLDAPCSATGVIRRHPDIKWLRKEADIEPLVE 363

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q ++L     ++KP G+++++ CS+  +++   +++ L+ +P
Sbjct: 364 LQEQILQALWPYLKPSGVLLYATCSVLAEENARQIERFLQHTP 406


>gi|120596855|ref|YP_961429.1| sun protein [Shewanella sp. W3-18-1]
 gi|120556948|gb|ABM22875.1| sun protein [Shewanella sp. W3-18-1]
          Length = 429

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 136/458 (29%), Positives = 217/458 (47%), Gaps = 59/458 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     D    L S +D+ L+  I    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----DQQKHLASGKDKALLAEICYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLEKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + DIE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRTEYLAALAELDIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQVNELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +    LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIGSWWQGGLFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSID 402
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L R+    +++            
Sbjct: 347 QQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLDRTVDAKLDI------------ 394

Query: 403 MAMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +A   SP+  GW +ITP            MDGF+   L
Sbjct: 395 LAQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|224493303|sp|A9R925|RSMB_YERPG RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
          Length = 429

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 215/409 (52%), Gaps = 39/409 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+ +  SL+ +L +L+      + +S +D+ L++ +   TLR 
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQ------KNISDKDRALLQELCFGTLRV 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  + 
Sbjct: 55  LPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR+  R+++ELL+R        + P W   R++  Y  + + +  ++    P
Sbjct: 114 LKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPP 173

Query: 176 L-------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
           +             Y++L  + DI    H +  +AV L T        P ++  LPGF  
Sbjct: 174 MWLRVNRQHHSRSEYLELLTQADINAEPHPIYRDAVRLIT--------PCAVNHLPGFEL 225

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +
Sbjct: 226 GWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSR 285

Query: 279 LRCNLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ NL RL L A   + +  A D +C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 286 VKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           I + A  Q +++      +K GG++V++ CS+  +++++ +   L+  P
Sbjct: 346 ISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP 394


>gi|254362113|ref|ZP_04978233.1| rRNA (cytosine-C(5)-)-methyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261491771|ref|ZP_05988351.1| FMU protein [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261495480|ref|ZP_05991927.1| FMU protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|153093674|gb|EDN74629.1| rRNA (cytosine-C(5)-)-methyltransferase [Mannheimia haemolytica
           PHL213]
 gi|261308814|gb|EEY10070.1| FMU protein [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|261312610|gb|EEY13733.1| FMU protein [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 448

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 130/407 (31%), Positives = 212/407 (52%), Gaps = 35/407 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
            +++R +S+ ++  V+ +  SL+ L+       A + L  +D  LV+ I     R LPR+
Sbjct: 13  ALSSRAISATIILQVLDQGKSLSTLIP-----DAQKQLEPKDLPLVQEITFGVCRVLPRL 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           ++++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F  L
Sbjct: 68  ESIIKLLVEKPLKGKTRLVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKTLKLD-SFRAL 126

Query: 124 VNSILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            N +LRR  RE+ E+L ++     ++ PEW   +L+  Y   R +  ++    P++I + 
Sbjct: 127 TNGVLRRFLREQEEILAKVDKHWQTLHPEWLVNKLKKAYPNWREIVEANNQRPPMWIRVN 186

Query: 182 VKF-DIETWAHKLNAVMLPTGGIRLKELPESIV--------------SLPGFAEGVWWVQ 226
            +      +A  ++ ++ P    +  E P + V               LP F +G   VQ
Sbjct: 187 QQHIKTNDYAALISELVEPEFA-KNSENPTACVPKCALLLERAVNVNQLPHFEQGWATVQ 245

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLD 284
           DA A    +L G  N  +VLD CAAPGGKT  ++     AKV ALD+ + RL ++R NL 
Sbjct: 246 DAHAQWSAELLGAENGETVLDACAAPGGKTTHILEKAPKAKVMALDIEESRLSRVRENLV 305

Query: 285 RLHLYAEDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           RL   A+ +I  DA    P++      LFD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 306 RLGQIAQ-VICGDASK--PEEWLEEGVLFDRILLDAPCSATGVIRRHPDIKWLRKEGDIA 362

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           + A  Q ++L      +KP GI++++ CS+  Q++ E +Q+ L+ +P
Sbjct: 363 ELATLQGEILKALWQRLKPNGILLYATCSVLPQENSEQIQRFLQDTP 409


>gi|162420599|ref|YP_001605204.1| 16S rRNA methyltransferase B [Yersinia pestis Angola]
 gi|162353414|gb|ABX87362.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           Angola]
          Length = 435

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 215/409 (52%), Gaps = 39/409 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+ +  SL+ +L +L+      + +S +D+ L++ +   TLR 
Sbjct: 7   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQ------KNISDKDRALLQELCFGTLRV 60

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  + 
Sbjct: 61  LPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ- 119

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR+  R+++ELL+R        + P W   R++  Y  + + +  ++    P
Sbjct: 120 LKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPP 179

Query: 176 L-------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
           +             Y++L  + DI    H +  +AV L T        P ++  LPGF  
Sbjct: 180 MWLRVNRQHHSRSEYLELLTQADINAEPHPIYRDAVRLIT--------PCAVNHLPGFEL 231

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +
Sbjct: 232 GWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSR 291

Query: 279 LRCNLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ NL RL L A   + +  A D +C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 292 VKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRD 351

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           I + A  Q +++      +K GG++V++ CS+  +++++ +   L+  P
Sbjct: 352 ISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP 400


>gi|165936548|ref|ZP_02225116.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166213307|ref|ZP_02239342.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399475|ref|ZP_02304999.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419402|ref|ZP_02311155.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167425618|ref|ZP_02317371.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|270488262|ref|ZP_06205336.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           KIM D27]
 gi|294502314|ref|YP_003566376.1| hypothetical protein YPZ3_0204 [Yersinia pestis Z176003]
 gi|165915664|gb|EDR34273.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166205605|gb|EDR50085.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166963396|gb|EDR59417.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167051979|gb|EDR63387.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167055308|gb|EDR65102.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|262360394|gb|ACY57115.1| hypothetical protein YPD4_0206 [Yersinia pestis D106004]
 gi|262364344|gb|ACY60901.1| hypothetical protein YPD8_0211 [Yersinia pestis D182038]
 gi|270336766|gb|EFA47543.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           KIM D27]
 gi|294352773|gb|ADE63114.1| hypothetical protein YPZ3_0204 [Yersinia pestis Z176003]
          Length = 431

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 215/409 (52%), Gaps = 39/409 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+ +  SL+ +L +L+      + +S +D+ L++ +   TLR 
Sbjct: 3   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQ------KNISDKDRALLQELCFGTLRV 56

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  + 
Sbjct: 57  LPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ- 115

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR+  R+++ELL+R        + P W   R++  Y  + + +  ++    P
Sbjct: 116 LKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPP 175

Query: 176 L-------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
           +             Y++L  + DI    H +  +AV L T        P ++  LPGF  
Sbjct: 176 MWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLIT--------PCAVNHLPGFEL 227

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +
Sbjct: 228 GWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSR 287

Query: 279 LRCNLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ NL RL L A   + +  A D +C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 288 VKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRD 347

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           I + A  Q +++      +K GG++V++ CS+  +++++ +   L+  P
Sbjct: 348 ISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP 396


>gi|22127891|ref|NP_671314.1| 16S rRNA methyltransferase B [Yersinia pestis KIM 10]
 gi|51597957|ref|YP_072148.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis IP 32953]
 gi|108809224|ref|YP_653140.1| 16S rRNA methyltransferase B [Yersinia pestis Antiqua]
 gi|108813989|ref|YP_649756.1| 16S rRNA methyltransferase B [Yersinia pestis Nepal516]
 gi|145597481|ref|YP_001161556.1| 16S rRNA methyltransferase B [Yersinia pestis Pestoides F]
 gi|150260712|ref|ZP_01917440.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis CA88-4125]
 gi|153947745|ref|YP_001402832.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis IP 31758]
 gi|161511468|ref|NP_991637.2| 16S rRNA methyltransferase B [Yersinia pestis biovar Microtus str.
           91001]
 gi|165927896|ref|ZP_02223728.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|166010534|ref|ZP_02231432.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|167468244|ref|ZP_02332948.1| 16S rRNA methyltransferase B [Yersinia pestis FV-1]
 gi|170022575|ref|YP_001719080.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis YPIII]
 gi|186897153|ref|YP_001874265.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis PB1/+]
 gi|218927446|ref|YP_002345321.1| 16S rRNA methyltransferase B [Yersinia pestis CO92]
 gi|229836278|ref|ZP_04456445.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Pestoides A]
 gi|229840098|ref|ZP_04460257.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842180|ref|ZP_04462335.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904520|ref|ZP_04519631.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Nepal516]
 gi|46396984|sp|Q8ZJ81|RSMB_YERPE RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|81638254|sp|Q664V2|RSMB_YERPS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|122979388|sp|Q1C2X7|RSMB_YERPA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|122979880|sp|Q1CCX4|RSMB_YERPN RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493292|sp|A7FNK4|RSMB_YERP3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493293|sp|B2K506|RSMB_YERPB RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493294|sp|A4TH21|RSMB_YERPP RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493295|sp|B1JJH6|RSMB_YERPY RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|21961028|gb|AAM87565.1|AE014004_3 hypothetical protein y4021 [Yersinia pestis KIM 10]
 gi|51591239|emb|CAH22905.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777637|gb|ABG20156.1| hypothetical protein YPN_3829 [Yersinia pestis Nepal516]
 gi|108781137|gb|ABG15195.1| hypothetical protein YPA_3233 [Yersinia pestis Antiqua]
 gi|115346057|emb|CAL18923.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209177|gb|ABP38584.1| hypothetical protein YPDSF_0162 [Yersinia pestis Pestoides F]
 gi|149290120|gb|EDM40197.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis CA88-4125]
 gi|152959240|gb|ABS46701.1| ribosomal RNA small subunit methyltransferase B [Yersinia
           pseudotuberculosis IP 31758]
 gi|165920172|gb|EDR37473.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165990624|gb|EDR42925.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|169749109|gb|ACA66627.1| sun protein [Yersinia pseudotuberculosis YPIII]
 gi|186700179|gb|ACC90808.1| sun protein [Yersinia pseudotuberculosis PB1/+]
 gi|229678638|gb|EEO74743.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Nepal516]
 gi|229690490|gb|EEO82544.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696464|gb|EEO86511.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706346|gb|EEO92353.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Pestoides A]
 gi|320013373|gb|ADV96944.1| 16S rRNA methyltransferase B [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 429

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 122/409 (29%), Positives = 215/409 (52%), Gaps = 39/409 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+ +  SL+ +L +L+      + +S +D+ L++ +   TLR 
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPELQ------KNISDKDRALLQELCFGTLRV 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  + 
Sbjct: 55  LPQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR+  R+++ELL+R        + P W   R++  Y  + + +  ++    P
Sbjct: 114 LKGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPP 173

Query: 176 L-------------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
           +             Y++L  + DI    H +  +AV L T        P ++  LPGF  
Sbjct: 174 MWLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLIT--------PCAVNHLPGFEL 225

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +
Sbjct: 226 GWVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSR 285

Query: 279 LRCNLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ NL RL L A   + +  A D +C  + FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 286 VKENLQRLQLQAVVRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRD 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           I + A  Q +++      +K GG++V++ CS+  +++++ +   L+  P
Sbjct: 346 ISELAQLQSEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP 394


>gi|167621966|ref|YP_001672260.1| sun protein [Shewanella halifaxensis HAW-EB4]
 gi|167351988|gb|ABZ74601.1| sun protein [Shewanella halifaxensis HAW-EB4]
          Length = 426

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 119/410 (29%), Positives = 201/410 (49%), Gaps = 39/410 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L ++       L S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALPVQQK----HLDSGKDKALLAELCYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   +   +  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KQVSDCMSKQMKGKQRIVHQLLLVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R++  L      ++   P W  +RL+  Y       I  +   P        
Sbjct: 116 NGVLRNIQRQEKPLSTDNDTLAYNTPAWIIKRLQAAYPDNWQTVIEQSHERPPMWLRNNQ 175

Query: 176 ------LYIDLTVKFDIETWA-HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+      DIE  A +  ++++L +        P  ++ LPGF  G   VQD 
Sbjct: 176 QSQTRETYLQALAGLDIEAQAGNSPDSILLSS--------PRDVMQLPGFESGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     +  VLD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQGDELVLDACAAPGGKSCHLLELAPDIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE ++  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  
Sbjct: 288 SLKAE-LVHGDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDIEELAQL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP----IPVE 389
           Q ++      ++KPGG ++++ CS+  Q++++ V   L  +P    +P+E
Sbjct: 347 QSQIFDHCWKWLKPGGTLLYATCSILPQENKDQVSAFLARTPDATLVPIE 396


>gi|238792967|ref|ZP_04636597.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           intermedia ATCC 29909]
 gi|238727821|gb|EEQ19345.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           intermedia ATCC 29909]
          Length = 429

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 119/407 (29%), Positives = 209/407 (51%), Gaps = 41/407 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLP-----GLQKNISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ + + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRIFHYLIMIGLYQLVYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKQAYPDQWQQIVDANNQKPPM 174

Query: 177 -------------YIDL--TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEG 221
                        Y+DL      D E  A+  +AV L T        P ++  LPGF  G
Sbjct: 175 WLRVSRLHHTRGEYLDLLKEAGIDAEPHAYYPDAVRLIT--------PCAVSDLPGFELG 226

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKL 279
              VQDASA   V L    N   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL ++
Sbjct: 227 WVTVQDASAQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRV 286

Query: 280 RCNLDRLHLYAEDIIEMD----AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
             NL RL L+A  ++ +        +C  + FD +L+DAPCS+TG IRRHPD+ W R   
Sbjct: 287 NENLQRLKLHA--VVRVGDGRTPETWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDS 344

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           DI   A  Q +++      +K GG++V++ CS+  +++++ +   L+
Sbjct: 345 DIADLAALQSEIIEAIWPRLKKGGVMVYATCSILPEENQQQIAAFLQ 391


>gi|223041828|ref|ZP_03612018.1| Trk system potassium uptake protein TrkA [Actinobacillus minor 202]
 gi|223017397|gb|EEF15818.1| Trk system potassium uptake protein TrkA [Actinobacillus minor 202]
          Length = 432

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 129/406 (31%), Positives = 209/406 (51%), Gaps = 32/406 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   NAR V++H++  V+ +  SL  L+       A   +  +D  LV+ I     R L
Sbjct: 1   MKKKQNARAVAAHIILQVLDQGKSLATLIP-----EAQSQVESKDLPLVQEIAFGVCRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PR++ ++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F
Sbjct: 56  PRLENIIKQLVEKPLKGKTRLVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKSLKLDS-F 114

Query: 121 AKLVNSILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
             L N +LRR  RE+  +L ++     ++ PEW   +L+  Y   R +  ++    P++I
Sbjct: 115 RALTNGVLRRFLREQETILAKVDKHWQTLHPEWLVNKLKKAYPNWREIVEANNQKPPMWI 174

Query: 179 DLTVKF-----------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
            +  +            D+      + A  LP   I L +   S+  LP F +G   VQD
Sbjct: 175 RVNTQHTNRADYVGLLGDLAKNTENVTAC-LPDCAIALGKAV-SVNQLPHFEQGWATVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDR 285
           A A    +L    N   +LD CAAPGGKT  ++     AKV ALD+ + RL +++ NL R
Sbjct: 233 AHAQWSAELLDAQNGELILDACAAPGGKTTHILEKAPQAKVIALDIEEARLARVKENLAR 292

Query: 286 LHLYAEDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L+  A  +I  DA    P++      +FD +L+DAPCS+TG IRRHPD+ W R  +DI +
Sbjct: 293 LNQQA-TVICGDASQ--PEQWLDNGVMFDRILLDAPCSATGVIRRHPDIKWLRKEEDIAE 349

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            A  Q K+L    + +KP GI++++ CS+  +++ + +Q+ + ++P
Sbjct: 350 LAALQSKILNALWARLKPNGILLYATCSVLPEENSQQIQQFIANTP 395


>gi|240947872|ref|ZP_04752312.1| ribosomal RNA small subunit methyltransferase B [Actinobacillus
           minor NM305]
 gi|240297834|gb|EER48270.1| ribosomal RNA small subunit methyltransferase B [Actinobacillus
           minor NM305]
          Length = 444

 Score =  166 bits (420), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 130/406 (32%), Positives = 208/406 (51%), Gaps = 32/406 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   NAR V++H++  V+ +  SL  L+       A   +  +D  LV+ I     R L
Sbjct: 9   MKKKQNARAVAAHIILQVLDQGKSLATLIP-----EAQSQVESKDLPLVQEIAFGVCRVL 63

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PR++ ++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F
Sbjct: 64  PRLENIIKQLVEKPLKGKTRLVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKSLKLDS-F 122

Query: 121 AKLVNSILRRVSREKIELLQRIAGI--SIIPEWFKERLENFYGKERVLAISDACISPLYI 178
             L N +LRR  RE+  +L ++     ++ PEW   +L+  Y   R +  ++    P++I
Sbjct: 123 RALTNGVLRRFLREQETILAKVDKHWQTLHPEWLVNKLKKAYPNWREIVEANNQKPPMWI 182

Query: 179 DLTVKF-----------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
            +  +            D+        A  LP   I L +   S+  LP F +G   VQD
Sbjct: 183 RVNTQHTNRADYIGLLGDLAKNTENATA-YLPDCAIALDKAV-SVNRLPHFEQGWATVQD 240

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDR 285
           A A    +L    N   +LD CAAPGGKT  ++     AKV ALD+ + RL +++ NL R
Sbjct: 241 AHAQWSAELLDAQNGELILDACAAPGGKTTHILEKAPQAKVIALDIEEARLARVKENLAR 300

Query: 286 LHLYAEDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L+  A  +I  DA    P++      +FD +L+DAPCS+TG IRRHPD+ W R  +DI +
Sbjct: 301 LNQRA-TVICGDASQ--PEQWLDNGVMFDRILLDAPCSATGVIRRHPDIKWLRKEEDIAE 357

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            A  Q K+L    + +KP GI++++ CS+  +++ E +Q+ + ++P
Sbjct: 358 LAALQSKILNALWARLKPNGILLYATCSILPEENTEQIQQFIANTP 403


>gi|71276447|ref|ZP_00652723.1| Fmu, rRNA SAM-dependent methyltransferase [Xylella fastidiosa
           Dixon]
 gi|71901280|ref|ZP_00683379.1| Fmu, rRNA SAM-dependent methyltransferase [Xylella fastidiosa
           Ann-1]
 gi|170730998|ref|YP_001776431.1| Sun protein [Xylella fastidiosa M12]
 gi|71162763|gb|EAO12489.1| Fmu, rRNA SAM-dependent methyltransferase [Xylella fastidiosa
           Dixon]
 gi|71728971|gb|EAO31103.1| Fmu, rRNA SAM-dependent methyltransferase [Xylella fastidiosa
           Ann-1]
 gi|167965791|gb|ACA12801.1| Sun protein [Xylella fastidiosa M12]
          Length = 429

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 131/400 (32%), Positives = 204/400 (51%), Gaps = 34/400 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M  G+  R+V++ +L+ V+ +  SL      E   +   L   RD+ LV AI    LR  
Sbjct: 1   MSDGIAPRVVAARVLALVVDQGRSLKT----ELAAALPTLEDVRDRALVEAICFAVLRRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P  +A L   L   L R    L+ LL V  AQ+  L V  YA +   V+ A R     H 
Sbjct: 57  PVYEAALTRWLARPLGRGDAQLRGLLMVGFAQLDVLKVPPYAALSATVD-ACRVLGWPHR 115

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI--SPLYI 178
              VN++LRR  RE++ +   ++  +  P W  ER+   +G E+  AI DA +  +P+++
Sbjct: 116 VSFVNAVLRRAQRERLPV---VSSDAAWPRWLAERIRADWG-EQAEAIFDASLKPAPMWL 171

Query: 179 DLTVKF-DIETWAHKLNAVML---PTGGIRLKELPES--------IVSLPGFAEGVWWVQ 226
            + +++ D  T+  +L A  L   P+G +     PE+        ++ LPGF  G   VQ
Sbjct: 172 RVNLRYGDRHTYVQRLQAAGLEAVPSGLV-----PEALALDCSMPVLQLPGFQAGEVSVQ 226

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--TALDVSKRRLEKLRCNLD 284
           D SA     L     +  +LD CAAPGGK A L+     +  TALDV  +RL ++    D
Sbjct: 227 DLSAQQVAALLSPAPHARLLDACAAPGGKAAHLLERAPTLCLTALDVDMQRLRRVAETCD 286

Query: 285 RLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           R+H+ A  +   DA D   +   + FDAVL+DAPCS+TG +RR PDVL  R  +D++   
Sbjct: 287 RIHVKAR-LCVADATDLAAWWDGEAFDAVLLDAPCSATGVVRRQPDVLLHRRAEDLLPLL 345

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
             Q +LL      ++PGG++V+  CS+ + +++  ++  L
Sbjct: 346 NIQSRLLDACWRTLRPGGVLVYVTCSVLRAENQAQLEAFL 385


>gi|28199632|ref|NP_779946.1| hypothetical protein PD1761 [Xylella fastidiosa Temecula1]
 gi|182682377|ref|YP_001830537.1| sun protein [Xylella fastidiosa M23]
 gi|46396863|sp|Q87AR1|RSMB_XYLFT RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|28057747|gb|AAO29595.1| conserved hypothetical protein [Xylella fastidiosa Temecula1]
 gi|182632487|gb|ACB93263.1| sun protein [Xylella fastidiosa M23]
 gi|307578659|gb|ADN62628.1| sun protein [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 431

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 132/400 (33%), Positives = 204/400 (51%), Gaps = 34/400 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M  G+  R+V++ +L+ V+ +  SL      E   +   L   RD+ LV AI    LR  
Sbjct: 1   MSDGIAPRVVAARVLALVVDQGRSLKT----ELAAALPTLEDVRDRALVEAICFAVLRRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P  +A L   L   L R    L+ LL V  AQ+  L V  YA +   V+ A R     H 
Sbjct: 57  PVYEAALTRWLARPLGRGDAQLRGLLMVGFAQLDVLKVPPYAALSATVD-ACRVLGWPHR 115

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI--SPLYI 178
              VN++LRR  RE++ +   ++  +  P W  ER+   +G E+  AI DA +  +P+++
Sbjct: 116 VSFVNAVLRRAQRERLPV---VSSDAAWPRWLAERIRADWG-EQAEAIFDASLKPAPMWL 171

Query: 179 DLTVKF-DIETWAHKLNAVML---PTGGIRLKELPES--------IVSLPGFAEGVWWVQ 226
            + +++ D  T+  +L A  L   P+G +     PE+        +V LPGF  G   VQ
Sbjct: 172 RVNLRYGDRHTYVQRLQAAGLEAVPSGLV-----PEALALDCSVPVVQLPGFQGGEVSVQ 226

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--TALDVSKRRLEKLRCNLD 284
           D SA     L     +  +LD CAAPGGK A L+     +  TALDV  +RL ++    D
Sbjct: 227 DLSAQQVAALLSPAPHARLLDACAAPGGKAAHLLERAPTLCLTALDVDMQRLRRVAETCD 286

Query: 285 RLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           R+H+ A  +   DA D   +   + FDAVL+DAPCS+TG +RR PDVL  R  +D++   
Sbjct: 287 RIHVKAR-LCVADATDLAAWWDGEPFDAVLLDAPCSATGVVRRQPDVLLHRRAEDLLPLL 345

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
             Q +LL      ++PGG++V+  CS+ + +++  ++  L
Sbjct: 346 NIQSRLLDACWRTLRPGGVLVYVTCSVLRAENQTQLEAFL 385


>gi|146291133|ref|YP_001181557.1| sun protein [Shewanella putrefaciens CN-32]
 gi|145562823|gb|ABP73758.1| sun protein [Shewanella putrefaciens CN-32]
          Length = 429

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 134/458 (29%), Positives = 217/458 (47%), Gaps = 59/458 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     +    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----EQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLEKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + DIE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRTEYLAALAELDIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L  +    K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQANELILDACAAPGGKSCHLLEVEPNIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +    LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIGSWWQGGLFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSID 402
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L R+    +++            
Sbjct: 347 QQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLDRTVDAKLDI------------ 394

Query: 403 MAMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +A   SP+  GW +ITP            MDGF+   L
Sbjct: 395 LAQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|282901368|ref|ZP_06309293.1| Fmu, rRNA SAM-dependent methyltransferase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193647|gb|EFA68619.1| Fmu, rRNA SAM-dependent methyltransferase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 446

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 135/470 (28%), Positives = 221/470 (47%), Gaps = 71/470 (15%)

Query: 15  LSCVMRKRISLTCLLDLEYGDSA----------FRLLSQRDQILVRAIVNVTLRFLPRID 64
           ++ +  ++I+ T L ++  G  A          F+L S  D+ L+  +V  ++R    +D
Sbjct: 1   MNTLSTRQIAFTALREVHRGAYADIAIDRTLHKFKL-SDHDRRLMTELVYGSVRRQRSLD 59

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
           A++D +     P++   L+ +L + + Q+ Y   +   A V+  V+ AK +         
Sbjct: 60  AIIDQIADKKSPQQPRDLRCILHLGLYQLRYQQKIPVSAAVNTTVQLAKENGFPG-LTGF 118

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFY--------------GKERVLAIS 169
           VN  LR    + I LL++ +   I+PE   ERL   Y              G+E    + 
Sbjct: 119 VNGFLR----QYIRLLEKTSDPLILPENLVERLGILYSFPNWVIEVWLSQLGQEETEKLC 174

Query: 170 DACISPLYIDLTVKFDIETWAHKLNAVMLPTGGI--RLKELPES---------IVSLPGF 218
                   IDL V   +      + +V   +G +  R+  LP+          I +LPGF
Sbjct: 175 QWMNQTPTIDLRVNI-LRASVEMVESVFKKSGILLHRIPHLPQGLRLVGPAGPIQNLPGF 233

Query: 219 AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRR 275
            EG W +QDA+A +   L        ++D+CAAPGGKT   A+L+    K+ A D +  R
Sbjct: 234 TEGWWCIQDAAAQLVGHLLDPRPGEVIIDVCAAPGGKTTHIAELMGDNGKIYACDRTPSR 293

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           L KL  N  RL L + +I   D+ ++     L D VL+DAPCS  GT+ RH D  W ++ 
Sbjct: 294 LRKLSENAQRLRLQSIEIFPGDSRNFTKFHHLADRVLLDAPCSGLGTMHRHADARWRQNL 353

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             +   A  QR+L+    +FVKPGG++V++ C+L  Q++EE++++ L  +P         
Sbjct: 354 SSVGDLAHIQRELISHTANFVKPGGVLVYATCTLHPQENEELIREFLHVNP--------- 404

Query: 395 SAYWK----SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              W+    ++D     SP GW+++ P            MDGFF V LR+
Sbjct: 405 --QWEMEKPNLDFLDVSSP-GWLKLWPH--------QQNMDGFFLVRLRK 443


>gi|300718674|ref|YP_003743477.1| 16S rRNA methyltransferase B [Erwinia billingiae Eb661]
 gi|299064510|emb|CAX61630.1| 16S rRNA methyltransferase B [Erwinia billingiae Eb661]
          Length = 429

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 113/384 (29%), Positives = 203/384 (52%), Gaps = 23/384 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + ++++D  L++ +    LR L
Sbjct: 1   MKKNTNLRSIAAQTIEKVVEQGQSLSNVLP-----AAQKSVAEKDAALLQELCYGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ ++  ++   +  K+ ++  L+ V + Q+++  +  +A +   VE A   K  + F
Sbjct: 56  PQLEWIIGQLMERPMTGKQRTIHFLVMVGLYQLIFTRIPAHAALAETVEGASSLKR-QQF 114

Query: 121 AKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+Q++       +  +W  ERL+  +      +  ++    P+
Sbjct: 115 KGLINGVLRQFQRKQDELVQQMNVGDQKYLHSKWLLERLKRAWPNNWEAIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  +    + W   L           L    +RL E P  +  LPGF +G   VQDA
Sbjct: 175 WLRVNRQHHSRDAWLKLLQEAGKEAEPHPLHADALRL-ETPCPVSQLPGFDQGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT--ALDVSKRRLEKLRCNLDRL 286
           SA   V L    N  S+LDLCAAPGGKT  ++ +  + T  A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCVALLDPQNGESILDLCAAPGGKTTHILEAAPQATVLAVDIDEQRLARINENLLRL 293

Query: 287 HLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++ AE  +        +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 NMTAEVKVGDGCLPETWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSL 368
           +++L      +KPGG ++++ CS+
Sbjct: 354 QQILDAIWPHLKPGGTLLYATCSI 377


>gi|293391667|ref|ZP_06636001.1| methionyl-tRNA formyltransferase [Aggregatibacter
           actinomycetemcomitans D7S-1]
 gi|290952201|gb|EFE02320.1| methionyl-tRNA formyltransferase [Aggregatibacter
           actinomycetemcomitans D7S-1]
          Length = 451

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 125/403 (31%), Positives = 211/403 (52%), Gaps = 29/403 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           + ++AR  +  +L  V+ +  SL+ LL       A  ++  +D  L++ I     R LPR
Sbjct: 13  TALSARTAAVQILFQVLEQGKSLSSLLP-----DAQVVIKAQDLPLLQEICFGVCRVLPR 67

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ ++  ++   L  KK  +  LL V + QILY  +  YA VD  V  AK + + + F  
Sbjct: 68  LEQIIAQLVDKPLRGKKRIVHCLLLVGLYQILYTRIPVYAAVDEIVNTAK-NLQLQSFQG 126

Query: 123 LVNSILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           LVN++LRR  RE+  +L ++     ++ P+W   +L+  Y   R +  ++    P+++ +
Sbjct: 127 LVNAVLRRFLREQESMLAKVDKHWQTLHPDWLVNKLKKVYPNWREIIEANNQKPPMWLRV 186

Query: 181 -TVKFDIETW-----AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
            T K  +ET+     A +++A +           P S+  LP FAEG   VQD  A    
Sbjct: 187 NTQKNSLETYRTLLTAQQMDAQITSHPQALGLTQPTSVQYLPLFAEGGVTVQDLHAQWAA 246

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYAED 292
            L    N   +LD CAAPGGKT  ++     A+V ALDV + RL++++ NL R+   A  
Sbjct: 247 LLLQPQNGELILDACAAPGGKTTHILELAPQAEVVALDVEENRLQRVKENLARMQQQA-T 305

Query: 293 IIEMDAFDYCPK----KL------FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           I+  DA +  P+    KL      FD +L+DAPCS+TG +RRHPD+ W R   DI     
Sbjct: 306 IVCGDAAN--PRAWLTKLGKSAVRFDRILLDAPCSATGVVRRHPDIKWLRKEADIEPLVE 363

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q ++L     ++KP G+++++ CS+  +++   +++ L+ +P
Sbjct: 364 LQEQILQALWPYLKPSGVLLYATCSVLAEENARQIERFLQRTP 406


>gi|220906120|ref|YP_002481431.1| sun protein [Cyanothece sp. PCC 7425]
 gi|219862731|gb|ACL43070.1| sun protein [Cyanothece sp. PCC 7425]
          Length = 443

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 137/463 (29%), Positives = 210/463 (45%), Gaps = 48/463 (10%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR ++   L  V R   +   +   E       L  +R++ L   +V   +R    +D
Sbjct: 1   MNARQLAFITLQAVHRGAYADVAV---ERSLRQHPLTEERERRLATELVYGCVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
           A++D +      ++   L+ LL + + Q+ YL+ +   A V   VE  K  +     A  
Sbjct: 58  ALVDQLAKKPARQQPPDLRTLLHLGLYQLRYLNHIPANAAVHTTVELVKH-RGLAGLAGF 116

Query: 124 VNSILRRVSREK---------IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN +LR+  R+           + +Q++A +   P+W         G      +      
Sbjct: 117 VNGLLRQYIRQSAGGDPLSLPTDPVQQLALLHSYPDWIVANWMEQIGTTETDQLCQWLNR 176

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPTG-----------GIRLKELPESIVSLPGFAEGVW 223
           P  IDL +   ++T   ++ +     G           G+RL E   +I  LPGFA+G W
Sbjct: 177 PPSIDLRIN-PLQTSIEQVGSAFQSAGVSVQPLAGLPQGLRLTEPSGAIEQLPGFAQGWW 235

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKLR 280
            VQDASA +   L        ++D CAAPGGK+   A+LI     V A D +  RL+KL 
Sbjct: 236 SVQDASAQLVSHLLNPQPGEVIIDACAAPGGKSTHIAELIGDKGIVWACDRTPSRLKKLE 295

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            N  RL L +  I + D+         D VL+DAPCS  GT+ RH D  W +  + + + 
Sbjct: 296 QNRQRLKLNSIRICQGDSRMSEFTAQADRVLLDAPCSGLGTLHRHADARWRQTPESVAQL 355

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP---IPVELVPLNSAY 397
           A  Q +LL    ++VKPGG +V++ C+L   ++E V+Q+ L   P   I     P  SA 
Sbjct: 356 AQLQTELLHHTATWVKPGGTLVYATCTLHPTENEAVIQQFLAHHPQWQIQAPRHPPFSAD 415

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           W        L+P+GWI++ P   +        MDGFF V L R
Sbjct: 416 W--------LAPQGWIKVWPHRHQ--------MDGFFMVRLGR 442


>gi|261346903|ref|ZP_05974547.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rustigianii DSM 4541]
 gi|282564970|gb|EFB70505.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rustigianii DSM 4541]
          Length = 428

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 129/461 (27%), Positives = 234/461 (50%), Gaps = 51/461 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +  V+ K  SL+ +L +L+      R ++++D+ L++ +    LR+
Sbjct: 1   MKNKYNLRSIAATAIGQVLDKGQSLSTVLPELQ------RNINEKDKALLQEMCFGVLRY 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   L  K+  L  L+ V + Q+LY  +  +A +   V+ A   K  + 
Sbjct: 55  LPKLEWFISQLMEKPLTGKQRILHYLIMVGIYQLLYTRIPAHAALAETVDGAVALKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISP 175
              L+N +LR   R++++L +R    +   + P W  +RL+  Y  + + +  ++    P
Sbjct: 114 LKGLINGVLRSFLRQQVQLEERNHNNNSQYLHPSWLLKRLQIAYPDQWQDIVDANNQRPP 173

Query: 176 LYIDLTVKFDIETWAHKL------NAVMLPT--GGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +  + +       L       A + PT    +RL++   S+  LPGF EG   VQD
Sbjct: 174 MWLRVNPQHNTTDQYLTLLEQAGITAHLHPTHPNAVRLED-ATSVNRLPGFDEGWSTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDR 285
            SA    +L   ++  S+LDLCAAPGGKT  ++     A V A+D+   RL++++ NL R
Sbjct: 233 VSAQGCAELLSPVDGDSILDLCAAPGGKTTHILELAPKAHVLAVDIDDSRLKRVKENLQR 292

Query: 286 LHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L   A  +I+ D     ++   + FD +L+DAPCS+TG IRRHPD+ W R   DI + + 
Sbjct: 293 LKQQA-IVIQGDGTKPEEWAHGQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELSQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L     ++KPGG +V++ CS+  +++   +Q+ L                 K +D
Sbjct: 352 LQFQILEAIWPYLKPGGTLVYATCSIIPEENSLQIQRFLT----------------KHVD 395

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
            ++    E  ++I P         ++G DGFF   L +  Q
Sbjct: 396 ASITDGTEFGLQILPS--------TTGGDGFFYARLLKQAQ 428


>gi|238896785|ref|YP_002921530.1| 16S rRNA methyltransferase B [Klebsiella pneumoniae NTUH-K2044]
 gi|238549112|dbj|BAH65463.1| 16S rRNA m5C967 methyltransferase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 431

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 210/402 (52%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVVEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   LN   L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLNETGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GVKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L    + +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNATWTHLKPGGTLVYATCSILPEENSQQIAAFLARTP 394


>gi|269140542|ref|YP_003297243.1| 16S rRNA methyltransferase B [Edwardsiella tarda EIB202]
 gi|267986203|gb|ACY86032.1| 16S rRNA methyltransferase B [Edwardsiella tarda EIB202]
 gi|304560327|gb|ADM42991.1| Ribosomal RNA small subunit methyltransferase B [Edwardsiella tarda
           FL6-60]
          Length = 430

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 130/404 (32%), Positives = 215/404 (53%), Gaps = 39/404 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R +++  LS V+ +  SL+ +L      SA + LS +D+ L++ +   TLR LP+++ 
Sbjct: 7   NLRAIAARTLSAVLDQGQSLSSVLP-----SAAQPLSDKDRALLQELCFGTLRVLPQLEW 61

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++  ++   L  K+  L  LL V + Q++Y  +  +A +   V+ A   K  +    L+N
Sbjct: 62  IVQQLMAKVLTGKQRPLHYLLLVGLYQLIYTRIPPHAALAETVDGAVALKRPQ-LKGLIN 120

Query: 126 SILRRVSREKIELLQRI---AGISIIPEWFKERLENFYGKERVLAISDACIS--PL---- 176
            +LR+  R++  LL +    A   + P W  +RL+  Y  E+  +I+DA     P+    
Sbjct: 121 GVLRQFQRQQQPLLLQSQQHASHWLHPSWLLKRLQQAY-PEQWQSIADANNQRPPMWLRV 179

Query: 177 ---------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                    Y+ L ++  I+   H+      P   +RL++ P+ +  LPGF +G   VQD
Sbjct: 180 NRCHHTRDAYLALLLQAGIDAVPHE----TFPDA-LRLQD-PQPVSRLPGFEQGWVTVQD 233

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDR 285
           ASA   V L    +   +LDLC APGGKT  ++ +  K  V A+DV + RL+++R NL R
Sbjct: 234 ASAQHSVDLLDPQDGEQILDLCCAPGGKTTHILEAAPKAHVLAVDVDESRLKRVRENLQR 293

Query: 286 LHLYAE----DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           L  +AE    D    D  ++   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A
Sbjct: 294 LQQHAEIRCGDGRTPD--EWARGRQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELA 351

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
             QR+++     F+K GG++V++ CS+  Q+++E +   L   P
Sbjct: 352 ALQREIIDAVWPFLKSGGVMVYATCSILPQENQEQILAFLSRHP 395


>gi|262040752|ref|ZP_06013983.1| RNA methyltransferase Sun [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041896|gb|EEW42936.1| RNA methyltransferase Sun [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 431

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 210/402 (52%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVIEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPEQWQEIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   LN   L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLNEAGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GVKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L    + +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNATWAHLKPGGTLVYATCSILPEENSQQIAAFLARTP 394


>gi|119943873|ref|YP_941553.1| sun protein [Psychromonas ingrahamii 37]
 gi|119862477|gb|ABM01954.1| sun protein [Psychromonas ingrahamii 37]
          Length = 436

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 128/409 (31%), Positives = 206/409 (50%), Gaps = 29/409 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +L+ V+ +  SL+ +L     D     LS +D+ L++ +    LR LPR+D
Sbjct: 1   MNVRALAAKILNQVVEQGQSLSNVLPPVQQD-----LSPKDKALLQVLCYGVLRTLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
                ++  +L  K+  L  L+ V   Q+LY  +  +A V   V  AK  K+ +    +V
Sbjct: 56  FFCRSLMDKALKGKQRDLHFLILVGFYQLLYTRIPSHAAVGETVNGAKELKK-QALKGMV 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERLENFYGKERVLAI--SDACISPLYI 178
           N +LR   RE+  L+++     A +   P W  +RL+  YG E    I  ++   +P+++
Sbjct: 115 NGVLRNFLREQESLVEKANKQPALVYCHPSWLVKRLQAAYGDELAAQIMHNNNQQAPMWL 174

Query: 179 DLT-VKFDIETWAHKLNAVMLPT-------GGIRLKELPESIVSLPGFAEGVWWVQDASA 230
            +  +    + +   LN   L +         +RL E P  +  LPGF EG   VQD +A
Sbjct: 175 RVNALHHTRDQYQVLLNDAGLLSFSSEFNDNALRL-EKPTDVYKLPGFTEGWVSVQDGAA 233

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTA---QLIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
            +            VLD C+APGGKT    +L  +  ++ A+D   +RL +++ NLDRL 
Sbjct: 234 QLAAHYLDAQAGDLVLDACSAPGGKTVHVLELQKNIKQMVAVDADAKRLLRVQENLDRLK 293

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +I  DA     +   +LFD +L DAPCS+TG IRRHPD+ W R   DI      Q
Sbjct: 294 LKAS-VIHGDASQPGSWWHGELFDRILCDAPCSATGVIRRHPDIRWLRRESDIAGLVSLQ 352

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
           + +L      +KPGGI++++ CS+   +++  +Q  L S      L+PL
Sbjct: 353 KNILHALWDKLKPGGILLYATCSILPDENDLQIQDFLESRQ-DASLIPL 400


>gi|127514666|ref|YP_001095863.1| sun protein [Shewanella loihica PV-4]
 gi|126639961|gb|ABO25604.1| sun protein [Shewanella loihica PV-4]
          Length = 427

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 133/454 (29%), Positives = 216/454 (47%), Gaps = 53/454 (11%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R +++ ++  V+ K +SL+  L     +   RL S +D+ L+  +    +R LP++D 
Sbjct: 3   NLRALAARVVFQVLEKGVSLSVALP----EQQQRLTSGKDKALLAELCYGVMRHLPQLDK 58

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++   +   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+VN
Sbjct: 59  LVSDCMSKPLKGKQRIVHQLLLVGCYQLYFTRIPGHAAISETAE-ACRQLKFEGLVKVVN 117

Query: 126 SILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP--------- 175
            +LR + R +  L +    ++   P W  +RL+  Y       I+ +   P         
Sbjct: 118 GVLRNLQRNQKPLPEDNETLAFNTPAWLIKRLKAAYPDSWQEMIAQSHQRPPMWLRNNQL 177

Query: 176 -----LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASA 230
                 Y+ L  + +I       N  +L        E P+ +  LPGFA+GV  VQD +A
Sbjct: 178 SQTREQYLTLLDEQEIAATPGASNDAIL-------LESPKDVGMLPGFADGVASVQDGAA 230

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--TALDVSKRRLEKLRCNLDRLHL 288
                L     N  +LD CAAPGGK+  L+ S   +   A+D   +RLE+++ NLDRL L
Sbjct: 231 QWAASLLAPEANELILDACAAPGGKSCHLLESQPSIDLVAVDFDAKRLERVQQNLDRLSL 290

Query: 289 YAE----DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
            A+    D  ++D++    K  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 291 KAKLVHGDAAKIDSWWQGDK--FDRILLDAPCSATGVIRRHPDIKWLRKQADIEELATLQ 348

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L     ++KPGG ++++ CS+  Q++ E +   L  +     L+P+      S D+ 
Sbjct: 349 SQILDHCWQWLKPGGTLLYATCSILPQENAEQIAAFLARTQ-DATLIPIAQQQ-NSDDI- 405

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
                 GW +ITP            MDGF+   L
Sbjct: 406 ------GW-QITPG--------QDNMDGFYYARL 424


>gi|308188325|ref|YP_003932456.1| ribosomal RNA small subunit methyltransferase B [Pantoea vagans
           C9-1]
 gi|308058835|gb|ADO11007.1| Ribosomal RNA small subunit methyltransferase B [Pantoea vagans
           C9-1]
          Length = 433

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 225/458 (49%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSINLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDSALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+  L  L+ V + Q+ Y  V  +A +   V  A+  K     
Sbjct: 56  PQLEALIGRLMERPLTGKQRVLHYLIMVGLYQLEYTRVPAHAALAETVAGAEVLKRT-SL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL  I       + P W  +RL++ + ++ + +  ++    P+
Sbjct: 115 KGLLNGVLRQFQRQREELLASIQDGPQRYLHPGWLLKRLQHAWPEQWQQIVEANNLRPPM 174

Query: 177 YID-----------LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
           ++            L +  +I+  A   + V      +RL + P  +  LPGF +G   V
Sbjct: 175 WLRVNRQHHNRDAWLAMLVEIDRNAQPADDV---PDALRL-DAPAPVSQLPGFDQGWVTV 230

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNL 283
           QD SA     L    N   +LDLCAAPGGKT  +  I   A+V A+DV  +RL+++  NL
Sbjct: 231 QDLSAQRCALLLEPQNGEQILDLCAAPGGKTTHILEIAPEAEVMAVDVDAQRLKRVEENL 290

Query: 284 DRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            RL + A D+ + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + 
Sbjct: 291 QRLGMKA-DVKQGDGRTPQQWCGDRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAEL 349

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
           A  Q ++L      +KPGG ++++ CS+  +++ + ++  L+           + A  +S
Sbjct: 350 AKLQSEILDAIWPHLKPGGTLIYATCSILPEENHQQIEAFLQRQ---------HDAQAES 400

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +  A    P   +++ P         + G DGFF   L
Sbjct: 401 LRGA----PANGLQVFPQ--------AEGGDGFFYAKL 426


>gi|152998580|ref|YP_001364261.1| sun protein [Shewanella baltica OS185]
 gi|151363198|gb|ABS06198.1| sun protein [Shewanella baltica OS185]
          Length = 428

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 132/458 (28%), Positives = 216/458 (47%), Gaps = 59/458 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     D    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----DQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + +IE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRAEYLAALAELEIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSID 402
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L R++   +E +   +       
Sbjct: 347 QQQILEHCWKWLKPGGTLLYATCSILPQENRDQISAFLERTADAKLETLSQQN------- 399

Query: 403 MAMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
                SP+  GW +ITP            MDGF+   L
Sbjct: 400 -----SPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|319790535|ref|YP_004152168.1| sun protein [Thermovibrio ammonificans HB-1]
 gi|317115037|gb|ADU97527.1| sun protein [Thermovibrio ammonificans HB-1]
          Length = 445

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 125/428 (29%), Positives = 216/428 (50%), Gaps = 59/428 (13%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           L+ +++  +R +VN T+RFL  +D  ++      L  +K +++  LR+   Q+ +  V  
Sbjct: 35  LTPQERAFLRELVNGTVRFLRLLDFSVERASGRRLASQKPTVRNALRLLAYQLFFTGVPP 94

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRV----SREKIEL----LQRIAGISIIPEWF 152
           YA ++  VE  K+ +  +  A  VN++ +++     RE++E     L+R+A +     W 
Sbjct: 95  YAALNETVEVVKQ-RLGKGAAGFVNAVGKKLLNFNYREEVESIKDPLERLATLHSFETWM 153

Query: 153 KERLENFYGKERVLAISDAC--ISPLYIDLTVKFDIETWAHKLNAVMLPTG--------- 201
            +R E+FYG   +  + +    ++PL+I + +   I+T   +L  ++   G         
Sbjct: 154 VKRWESFYGPRELPHLLEGLNKVAPLFIRVNL---IKTQPQELLNLLKSAGVEAEPHPFL 210

Query: 202 --GIRLK---ELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
              IR+K    LPE    LPGF EG++++QD ++ +   L        +LD+ AAPGGKT
Sbjct: 211 KEMIRIKGRVNLPE----LPGFKEGLFYIQDPASYLAAYLLQPKPGELILDVGAAPGGKT 266

Query: 257 ---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD-----AFDYCPKKLFD 308
              A L  +GAK+ A+DV++ R E L+ NL +L +   +++  D      F    +  FD
Sbjct: 267 TAIASLTGNGAKIVAVDVNRERAELLKENLRKLGVENTEVVITDIARDPNFLNRFRGKFD 326

Query: 309 AVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSL 368
            +L+DAPCS+TG IRRHP+  W +    I  +   QR LL      +KP G +++S CSL
Sbjct: 327 RILIDAPCSATGVIRRHPEGKWNKSLSLIKHNQTIQRSLLKAAKELLKPTGTLLYSVCSL 386

Query: 369 DKQDSEE--VVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGV 426
           ++++ EE     + L  +P+P+  +P    Y K  +       EG +R+ P         
Sbjct: 387 EREEGEENSAFARRLGYTPLPLTGLP---EYLKEREQ------EGSLRLFPH-------- 429

Query: 427 SSGMDGFF 434
               DGF+
Sbjct: 430 KDNADGFY 437


>gi|269468281|gb|EEZ79965.1| ribosomal RNA small subunit methyltransferase B [uncultured SUP05
           cluster bacterium]
          Length = 423

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 109/359 (30%), Positives = 190/359 (52%), Gaps = 16/359 (4%)

Query: 44  RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAV 103
           +D  L +++V  T+RF  +++ ++  +L  SL ++   +  L+ +   QILY  VA +A 
Sbjct: 35  QDDALAKSLVFGTIRFYHQLNDIVTDLLNHSLEKEDLDIHCLMLLGAYQILYSKVAIHAS 94

Query: 104 VDLAVEQAKRDKENRHFAK-LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGK 162
           +   V+    +  ++ +AK LVN+ILR++ R+K  LL +       P W  ++++  Y  
Sbjct: 95  IFETVDTL--NFLDKTWAKGLVNAILRQIDRDKDSLLAQTHYSH--PTWLVKKIKQNYPD 150

Query: 163 E-RVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSL 215
           +   +   +   +P+ I +  K  ++ +   L    + +  + +       + P S+  L
Sbjct: 151 DFEQIFTQNNTQAPMTIRVHPKSSVDDYQQSLANENVQSNKLEITPQALILDKPMSVYDL 210

Query: 216 PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSK 273
           P F  G  +VQDASA +   L    NN  +LD C+APGGK   L  +   A + ALD S 
Sbjct: 211 PDFESGSCYVQDASAQLAANLLDPKNNDVILDACSAPGGKATHLCELAPNATIVALDNSS 270

Query: 274 RRLEKLRCNLDRLHLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWT 331
            RLE+++ N  R ++   +II+ +A   D+   +LF+ +L+DAPCS+TG IRRHPD+   
Sbjct: 271 ERLERVKQNTQRFNIDNIEIIKGNAQQQDWWDGELFNKILLDAPCSATGVIRRHPDIKLL 330

Query: 332 RDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVEL 390
           R   DI      Q K+L    S +KP G+++++ CS+ K ++E+ +   L S P   E+
Sbjct: 331 RKPKDITNLVKLQAKILANLWSMLKPDGVLLYATCSILKSENEDQITHFLESHPDAEEI 389


>gi|188535245|ref|YP_001909042.1| 16S rRNA methyltransferase B [Erwinia tasmaniensis Et1/99]
 gi|224493254|sp|B2VK95|RSMB_ERWT9 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|188030287|emb|CAO98176.1| rRNA methylase Sun [Erwinia tasmaniensis Et1/99]
          Length = 429

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 116/398 (29%), Positives = 210/398 (52%), Gaps = 23/398 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  L++ +    LR L
Sbjct: 1   MKKMTNLRCIAAQTIEKVVEQGQSLSNVLP-----AAQKSVGDKDAALLQELCYGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ V+  ++   +  K+ ++  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWVIGRLMSRPMTGKQRAVHFLIMVGLYQLMFTRIPAHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ EL+Q++       + P+W  ERL+  +  + + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELMQQMNDGDQQYLHPKWLLERLKRAWPAQWKQIVDANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKL-----NAVMLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    + W   L      A   P  G  L+ E P ++  LPGF +G   VQD S
Sbjct: 175 WLRVNRQHHSRDAWLTLLEESGKQAFAHPQHGDALRLESPCAVGQLPGFDQGWITVQDVS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++ +   AKV A+DV  +RL ++  NL RL 
Sbjct: 235 AQGCVALLAPRDGEQILDLCAAPGGKTTHILEAAPQAKVMAVDVDAQRLARVSENLQRLT 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C    FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MQAE-VKQGDGRTPAAWCGDTQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           +++L      +KPGG ++++ CS+  +++   + + L+
Sbjct: 354 QQILDAVWPHLKPGGTLLYATCSVLPEENHVQIGQFLQ 391


>gi|330002246|ref|ZP_08304257.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp. MS
           92-3]
 gi|328537385|gb|EGF63634.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp. MS
           92-3]
          Length = 431

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 209/402 (51%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVVEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPEQWQEIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   LN   L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLNETGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L      +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNAIWGHLKPGGTLVYATCSILPEENSQQIAAFLARTP 394


>gi|149190437|ref|ZP_01868708.1| Sun protein [Vibrio shilonii AK1]
 gi|148835691|gb|EDL52657.1| Sun protein [Vibrio shilonii AK1]
          Length = 425

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 122/402 (30%), Positives = 206/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L L       + +  RDQ L++ I    LR LPR++
Sbjct: 1   MNVRAAAANILFQVVDKGQSLSSALPL-----GQQQVKPRDQALLQEICFGALRILPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +V   ++   L  K+     L+ V + QI ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  SVASELMDKPLKGKQRVFHHLILVGIYQIGHMRIPAHAAVGETVEATKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R + +L    +   AG    P W  + L+  Y ++  ++  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEQLDEISVSHNAGKYGHPSWLLKLLQESYPQQWEMIVEANNTKAPMWLR 174

Query: 180 LTVKF-------------DIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +  +               I++ AH   L+A+ L          P  + +LPGF +G   
Sbjct: 175 VNHQHLNRDDYQALLKNEGIDSTAHSEALDALKLAA--------PCDVNNLPGFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++     ++V A+D  + RL+++  N
Sbjct: 227 VQDAAAQLSINYLEPKDGELILDCCAAPGGKTAHILERTKDSQVVAIDCDETRLKRVHDN 286

Query: 283 LDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL L A+ ++  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLKLQAK-VVCGDARTPSEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIEA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  QR++       +K GG +V++ CS+  Q+++E V+  L
Sbjct: 346 LAELQREIFDAMWQQLKVGGTLVYATCSITPQENKEQVKAFL 387


>gi|217971245|ref|YP_002355996.1| sun protein [Shewanella baltica OS223]
 gi|217496380|gb|ACK44573.1| sun protein [Shewanella baltica OS223]
          Length = 428

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 214/457 (46%), Gaps = 57/457 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     D    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----DQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + +IE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRTEYLAALAELEIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L             +A  K   +
Sbjct: 347 QQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLE-----------RTADAKLDKL 395

Query: 404 AMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +   SP+  GW +ITP            MDGF+   L
Sbjct: 396 SQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|126172286|ref|YP_001048435.1| sun protein [Shewanella baltica OS155]
 gi|125995491|gb|ABN59566.1| sun protein [Shewanella baltica OS155]
          Length = 428

 Score =  163 bits (413), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 214/457 (46%), Gaps = 57/457 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     D    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----DQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + +IE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRAEYLAALAELEIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L             +A  K   +
Sbjct: 347 QQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLE-----------RTADAKLDTL 395

Query: 404 AMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +   SP+  GW +ITP            MDGF+   L
Sbjct: 396 SQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|88801025|ref|ZP_01116574.1| hypothetical protein MED297_05044 [Reinekea sp. MED297]
 gi|88776228|gb|EAR07454.1| hypothetical protein MED297_05044 [Reinekea sp. MED297]
          Length = 427

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 131/461 (28%), Positives = 223/461 (48%), Gaps = 64/461 (13%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRD---QILVRAIVNVTLRFLPR 62
           N RL+++ +L  V+ +  SL         D   R L   D   Q  ++ +V  + R+   
Sbjct: 3   NTRLIAAEILLQVVDEGRSLN--------DELPRRLKHIDPDQQAFLQQLVYGSTRYYFA 54

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +D +++ ++   +  K+  +  LL + + Q+ +LDVA++A ++  VE     K  + +AK
Sbjct: 55  LDELINLLVEKPIRGKERLVHMLLAIGLYQLWHLDVAEHAAINETVEATLTAK--KQWAK 112

Query: 123 -LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI-----SPL 176
            LVN+ LRR  RE+  +L ++      P W  +RL   Y ++     +D C+      P+
Sbjct: 113 NLVNASLRRFQRERETILPQLRRTESFPGWLNKRLRQAYPEQ----FADICVQSNQPGPM 168

Query: 177 YIDLTVKFDI-ETW----------AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
            + +  +    E W          AH  N    P G       P  +++LPGF +G   V
Sbjct: 169 TLRINRRMMTREAWLLLAIKEGLVAHSTNHS--PVGATLAS--PAPVLALPGFEDGALSV 224

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG-AKVTALDVSKRRLEKLRCNLD 284
           QD +A +   L    +   VLD C+APGGKT  L+     ++ A+D+ + RL +++ NL+
Sbjct: 225 QDEAAQMCATLLPVTDGQRVLDACSAPGGKTGHLLEKADIELVAIDIDEHRLGRVQENLE 284

Query: 285 RL----HLYAEDIIEMDAF-DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           R+     L AED  E++ + D  P   FDAVL+DAPCS TG IRRHPD+   R + DI  
Sbjct: 285 RIGVSAELIAEDAAEIERWWDGVP---FDAVLLDAPCSGTGVIRRHPDIKLLRKSADIKA 341

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            +  Q +LL +    VKPGG ++++ CS+   ++ + +   L++ P          A  +
Sbjct: 342 LSQVQSRLLDRLWGTVKPGGYLLYATCSVLPDENTDRIAAFLQAHP---------EAQEQ 392

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            + +   +  E  ++  P         S G DGF+   L++
Sbjct: 393 PLALQADVDTEHGVQWLPQ--------SDGHDGFYYALLKK 425


>gi|297180807|gb|ADI17013.1| tRNA and rRNA cytosine-c5-methylases [uncultured Vibrionales
           bacterium HF0010_22E23]
          Length = 426

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 125/399 (31%), Positives = 202/399 (50%), Gaps = 34/399 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ +  SLT +L       A + ++ RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAMAAKVIFQVVDQGQSLTAVLP-----KAQQQIADRDGALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A+   ++   L  K+     L+ V + Q+ Y+ V  +A V   V   K  K+ +    LV
Sbjct: 56  AITQSLMEKPLTGKQRVFHHLILVGLYQLNYMRVPAHAAVAETVNATKPLKKPQ-LRGLV 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   RE+  L ++     AG    P W  + L+N Y    + +  S+   +P+++ 
Sbjct: 115 NAVLRNYQREQDALNEKAISHDAGRYGHPGWLLKLLQNAYPDSWQQIVDSNHQKAPMWLR 174

Query: 180 LT-VKFDIETWAHKLNAVMLPTGGIRLKELPES-----------IVSLPGFAEGVWWVQD 227
           +     + + +   LNA      GI  +  PE+           +  LPGF +G   VQD
Sbjct: 175 VNRTHHNRDEYLELLNAE-----GIEGEAHPEAEDAIKLGSPCDVTKLPGFEKGWVSVQD 229

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS--GAKVTALDVSKRRLEKLRCNLDR 285
           A+A + V          +LD CAAPGGKT  ++     AKV A+D    RL ++  NL R
Sbjct: 230 AAAQLSVNYLQPKAGELILDCCAAPGGKTCHILEHQPNAKVVAIDADANRLTRVEENLGR 289

Query: 286 LHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L+L A D+I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI +   
Sbjct: 290 LNLNA-DVICGDARSPDEWWNGEDFDRILLDAPCSATGVIRRHPDIKWLRRADDIEQLVT 348

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            Q ++       +K GG +V++ CS+  Q++ E V+  L
Sbjct: 349 LQAEIFDAMWQKLKRGGTLVYATCSVTPQENAEQVKAFL 387


>gi|251797738|ref|YP_003012469.1| sun protein [Paenibacillus sp. JDR-2]
 gi|247545364|gb|ACT02383.1| sun protein [Paenibacillus sp. JDR-2]
          Length = 491

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 138/431 (32%), Positives = 211/431 (48%), Gaps = 43/431 (9%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L + D  LV  +V  T++    +D  L       L + +  + QLLR+S  Q+LYLD + 
Sbjct: 71  LQRADAALVTELVYGTIQRQLTLDHWLGKFAAKGLRKLEPWVHQLLRMSAYQLLYLDRIP 130

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELL-------QRIAGISI---IP 149
            +A V+ AV  AKR + ++  + +VN ILR + R + EL          +  IS+    P
Sbjct: 131 AHAAVNEAVTIAKR-RGHQGISGMVNGILRSIDRNRAELTVDAIADKNPVVQISVRYSYP 189

Query: 150 EWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGG----IRL 205
           EW  ER    YG E   AI  +   P +  + V   + +  +++ +++   GG     RL
Sbjct: 190 EWLVERWVKAYGAETAEAICASGNEPPHASVRVN-PLRSSRNEVLSLLTEQGGDAEASRL 248

Query: 206 KELPESIV--------SLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT- 256
              P  IV           GF +G+W +QD S+ +  ++      + VLD CAAPGGKT 
Sbjct: 249 A--PAGIVVRRGGNLADTEGFRDGLWTMQDESSMLVAEVVAPKAGMQVLDCCAAPGGKTT 306

Query: 257 --AQLIVSGAKVTALDVS--KRRL---EKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDA 309
             A+L+    KV A D+   KR+L   + +R  L  +    ED  ++    + P  + DA
Sbjct: 307 HMAELMSGKGKVYANDLHPHKRQLIVDQAVRLGLQNIEAITEDAGKLGE-RFAPASI-DA 364

Query: 310 VLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLD 369
           VL+DAPCS  G IRR P++ WT+   D+ + A  QR+LL      VKPGG +V+S C+++
Sbjct: 365 VLLDAPCSGFGVIRRKPEIKWTKTAGDVAEIAAIQRRLLGAVAGLVKPGGTLVYSTCTIE 424

Query: 370 KQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSG 429
             ++EE V   L+  P   +L     A W    +A  L  +G I  + D   ++     G
Sbjct: 425 STENEEQVAVFLKEHP-EFQL----DAEWPEEALA-PLREKGIIDSSFDGQAQLLPHHYG 478

Query: 430 MDGFFAVALRR 440
            DGFF   LRR
Sbjct: 479 SDGFFIARLRR 489


>gi|161506038|ref|YP_001573150.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|224493259|sp|A9MN78|RSMB_SALAR RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|160867385|gb|ABX24008.1| hypothetical protein SARI_04219 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 429

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 133/457 (29%), Positives = 221/457 (48%), Gaps = 50/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    +           +RL E P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRL 286
           SA   V      N   +LDLCAAPGGKT  ++ +   A V A+DV ++RL ++  NL RL
Sbjct: 234 SAQKCVAFLAPQNGEHILDLCAAPGGKTTHILEAAPEADVLAVDVDEQRLSRIYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPAQWCDEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAKL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++   +   L+ +P                  
Sbjct: 353 QAEILDTVWPRLKPGGTLVYATCSVLPEENSAQINAFLQRTP------------------ 394

Query: 404 AMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
             ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 DAALSETG----TPDQPGQQNLPGAEEG-DGFFYAKL 426


>gi|283835706|ref|ZP_06355447.1| hypothetical protein CIT292_10098 [Citrobacter youngae ATCC 29220]
 gi|291068385|gb|EFE06494.1| ribosomal RNA small subunit methyltransferase B [Citrobacter
           youngae ATCC 29220]
          Length = 429

 Score =  163 bits (413), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 117/406 (28%), Positives = 210/406 (51%), Gaps = 33/406 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L      +  + ++ +D+ L++ +    LR L
Sbjct: 1   MKKHLNLRSMAAQAVEQVVEKGQSLSNVLP-----AMQQKVADKDKALLQELCFGALRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQA---KRDKEN 117
            +++ ++  ++   +  K+ ++  L+ V   Q+L+  +  +A +   VE A   KR +  
Sbjct: 56  SQLEWMIQQLMERPMTGKQRTVHYLIMVGFYQLLHTRIPPHAALAETVEGAVVIKRPQ-- 113

Query: 118 RHFAKLVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFYGKE-RVLAISDACI 173
                L+N +LR+  R + ELL   A   +    P W  +R++  Y ++   +  ++   
Sbjct: 114 --LKGLINGVLRQFQRRQEELLTEFAQSDLRFLHPSWLVKRIKAAYPQQWEAILEANNQR 171

Query: 174 SPLYIDLTVKFDI-ETWAHKLNAVMLPTG--------GIRLKELPESIVSLPGFAEGVWW 224
            P+++ +       + W   L    L TG         +RL E P  +++LPGF +G   
Sbjct: 172 PPMWLRVNRNHHTRDAWLELLAEAGL-TGFPHPDYPDAVRL-ETPAPVLALPGFEQGWVT 229

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCN 282
           VQDASA   V      N   +LDLCAAPGGKT  +  +   A V A+DV ++RL ++  N
Sbjct: 230 VQDASAQGCVSYLQPQNGEQILDLCAAPGGKTTHILEVAPQANVMAVDVDEKRLSRVYDN 289

Query: 283 LDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL + A  + + D      +C ++ FD +L+DAPCS++G IRRHPD+ W R   DI +
Sbjct: 290 LKRLGMKA-TVKQGDGRYPQQWCGEQQFDRILLDAPCSASGVIRRHPDIKWLRRDRDIAE 348

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            A  Q ++L    + +KPGG +V++ CS+  +++++ +   L  +P
Sbjct: 349 LAQLQAEILNATWTHLKPGGTLVYATCSILPEENQQQIAAFLARTP 394


>gi|254515962|ref|ZP_05128022.1| ribosomal RNA small subunit methyltransferase B [gamma
           proteobacterium NOR5-3]
 gi|219675684|gb|EED32050.1| ribosomal RNA small subunit methyltransferase B [gamma
           proteobacterium NOR5-3]
          Length = 433

 Score =  163 bits (412), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 143/459 (31%), Positives = 227/459 (49%), Gaps = 46/459 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK G   R  ++ +++ V+R   SL   L+     S   +L  RDQ L R I   TLR  
Sbjct: 1   MKPGAAVRACAARIIAEVLRGD-SLDRALE-----SHLTILPGRDQPLCREICFGTLRQY 54

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PR+DA+L  +L   L  K   +  L    + Q+  + +  +A V   V+ A   K+ R  
Sbjct: 55  PRLDALLGQLLQKPLRAKDRDVHALALAGLYQLTSMRIPAHAAVSATVDAATVLKK-RQL 113

Query: 121 AKLVNSILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKER-VLAISDACISPLY 177
           + L+N++LRR  RE+  LL  +  A  S  P+W    L   + + R  +A ++    P+ 
Sbjct: 114 SGLLNAVLRRFQREEEALLAALSDAQASAHPDWLWNALGQHWPEHREQIARANNSYPPMT 173

Query: 178 IDLTV-KFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDASA 230
           + + + + D +++  +L    +     RL       E    +  LPGFAEG+  VQD +A
Sbjct: 174 LRVNLSRVDRDSYLQQLADAGITAHPGRLSPAALTLEQAVDVTLLPGFAEGLCSVQDEAA 233

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLH 287
            +  QL        +LD CAAPGGK+  ++    S A +TA+D+S+ RL +++ NLDRL 
Sbjct: 234 QLAAQLLAPRPGERILDACAAPGGKSCHILEQLPSDASLTAMDISEERLHRVQENLDRLG 293

Query: 288 LYAEDIIEMDAFDYCPKKL-----FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L A  I+      + P  L     FDA+L+D PCS+TG IRRHPDV   R  +D V  A 
Sbjct: 294 LAATLIVGDGG--HPPTALVDRGPFDAMLLDVPCSATGVIRRHPDVKVLRREEDAVSFAA 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
            QR +L      + PGG +++  CS L +++S+ V + + R S           A  +++
Sbjct: 352 QQRAILNGLWPLLAPGGRLLYVTCSLLPEENSQAVAEFLARQS----------DASEEAL 401

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +A A +    +++ PD+        SG DG +   LR+
Sbjct: 402 HVASAQACAQGLQLLPDV--------SGTDGLYFAMLRK 432


>gi|29655200|ref|NP_820892.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           RSA 493]
 gi|161829958|ref|YP_001597731.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           RSA 331]
 gi|1169714|sp|P45679|RSMB_COXBU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|29542472|gb|AAO91406.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii RSA 493]
 gi|161761825|gb|ABX77467.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           RSA 331]
          Length = 430

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 220/419 (52%), Gaps = 50/419 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ L++ V++K+ SLT LL            ++++Q L++ +   TLR+  ++ 
Sbjct: 1   MNTRATTAILVNQVVQKKCSLTALLSA----------NKKNQSLIQELCYGTLRWYFKLK 50

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK-L 123
            + + +L + L  K + +  L+     Q+ YL++  + +V+  V  A+  K  + +AK L
Sbjct: 51  LIAEKLLHAPLRDKDHDIFCLILTGFYQLNYLNIPTHTIVNQTVGAAEILK--KPWAKGL 108

Query: 124 VNSILRRVSREKIELL----QRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYI 178
           +N +LRR   EK ELL    + I G    P WF + ++  +      + I++    P+  
Sbjct: 109 INKLLRRFIAEKDELLTFTEKTIEGQYAHPLWFIQHIKKAWPDHWESILIANNARPPM-- 166

Query: 179 DLTVKFDIETWAHKLNAVMLPTGGIRLK-----------ELPESIVSLPGFAEGVWWVQD 227
             T++ ++   + ++   ML    I  K           E P S+  LPGF EG  ++QD
Sbjct: 167 --TLRVNLTKISREIYLEMLDQKNISAKPLDFLPAAIQLEKPCSVHQLPGFNEGYCYIQD 224

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCNLD 284
           A+      L    NN +VLD CAAPG KT+ ++     +    A+D +K+RL +++ N+ 
Sbjct: 225 AAGQFAAYLLKLENNQTVLDACAAPGSKTSHILEVNPHLKTLVAIDNNKQRLNRIKENIT 284

Query: 285 RLHLYAE-------DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           RL L  E       D+ ++D   +   +LFD +L+DAPCS+TG IRRHPD+   R   DI
Sbjct: 285 RLGLRQEHLQCLLADVSQID--QWSSGELFDRILLDAPCSATGVIRRHPDIKLLRQPGDI 342

Query: 338 VKSACFQRKL-LLQGI-SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             S   Q+KL LL  + + +K GG +++S CS+   ++E+V+++ L S+   VEL P N
Sbjct: 343 --SQYHQKKLQLLNALWTVLKAGGFLLYSTCSVLPDENEKVIEEFL-STHDKVELSPTN 398


>gi|218245524|ref|YP_002370895.1| sun protein [Cyanothece sp. PCC 8801]
 gi|218166002|gb|ACK64739.1| sun protein [Cyanothece sp. PCC 8801]
          Length = 451

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 138/441 (31%), Positives = 218/441 (49%), Gaps = 72/441 (16%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVA 99
           LS  D+ LV  +V   +R    +D ++D +   +  ++   L+ +L + + Q+ YL  + 
Sbjct: 41  LSGSDRALVTELVYGIVRRKRTLDTLIDQLGKKASHQQPPDLRLILYIGLYQLRYLSQIP 100

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILR---RVSREKIELL-------QRIAGISIIP 149
             A V+ AV  AK +   R  + +VN ILR   R+++E  + L        R+  +   P
Sbjct: 101 PSAAVNTAVNLAKENSLQR-LSGVVNGILRQYIRLAQENNDPLILPDDPISRLGVLYSFP 159

Query: 150 E-----WFK-------ERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +     W +       E L N++ +  VL   D  I+PL   L    +++T   + N  +
Sbjct: 160 DFMIKLWLEQWGLETTEELCNWFNQPPVL---DIRINPLKTTLE---EVKTTLSQGNLTL 213

Query: 198 LP---TGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGG 254
           +P     G+RL+    +I  LPGF EG W VQD+SA +   L     +  ++D CAAPGG
Sbjct: 214 MPLEIPQGLRLQGKTGAIQDLPGFKEGWWTVQDSSAQLVSHLLDPQPSEVIIDACAAPGG 273

Query: 255 KT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII-----EMDAFDYCPKKL 306
           KT   A+L+     + A D    RL+KL  N +RL L +  I+     ++D F    + +
Sbjct: 274 KTTHIAELMGDQGTIWACDRYASRLKKLSANKERLQLNSIKIVTGDSRQLDQF----QGI 329

Query: 307 FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC 366
            D VLVDAPCS  GT+ RHPD+ W +  + I + A  Q++LL    ++VKP GI+V++ C
Sbjct: 330 ADRVLVDAPCSGLGTLHRHPDIRWRQTPEKIEELAILQKELLETTANWVKPQGILVYATC 389

Query: 367 SLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSP-------EGWIRITPDM 419
           +L  Q++E V++  L S P           +WK ID+    SP        G I+I P  
Sbjct: 390 TLTYQENEGVIEHFLASHP-----------HWK-IDVPSPNSPVAKWMTASGSIKILPHQ 437

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
            +        MDGFF V L++
Sbjct: 438 QD--------MDGFFMVKLKK 450


>gi|153212957|ref|ZP_01948551.1| sun protein [Vibrio cholerae 1587]
 gi|153826427|ref|ZP_01979094.1| sun protein [Vibrio cholerae MZO-2]
 gi|124116183|gb|EAY35003.1| sun protein [Vibrio cholerae 1587]
 gi|149739813|gb|EDM54008.1| sun protein [Vibrio cholerae MZO-2]
          Length = 434

 Score =  163 bits (412), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 203/398 (51%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 9   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 63

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 64  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 122

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 123 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 182

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  ++        L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 183 VNHQYHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 243 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 302

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 303 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 361

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 362 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 399


>gi|307150080|ref|YP_003885464.1| sun protein [Cyanothece sp. PCC 7822]
 gi|306980308|gb|ADN12189.1| sun protein [Cyanothece sp. PCC 7822]
          Length = 450

 Score =  163 bits (412), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 132/463 (28%), Positives = 224/463 (48%), Gaps = 42/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   + R ++  +L  + RK       LD     +  + L   D+ LV  +V   +R +
Sbjct: 1   MKLETDPRQLAVTILRDIYRKDAYTDIALDQGLKQAQLKSL---DRGLVTELVYGIVRRV 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D ++  +   +  ++   L+ +L++ + Q+ YLD +   A V+ +VE AK+++  + 
Sbjct: 58  RTLDQLITQLGKKTATQQPPDLRIILQIGLYQLRYLDQIPVSAAVNTSVELAKKNQLGK- 116

Query: 120 FAKLVNSILRRVSR------EKIEL----LQRIAGISIIPEWFKERLENFYGKERVLAIS 169
            + +VN ILR+  R      + +EL    + R+  +   P W  ++    +G+     + 
Sbjct: 117 LSGVVNGILRQYDRIQAQGKDPLELPSDRINRLGVLHSFPNWIVQQWLEEWGEGETEKLC 176

Query: 170 DACISPLYIDLTVKF------DIETWAHKLNAVMLPT----GGIRLKELPESIVSLPGFA 219
           +    P  ID+ V        ++E    K    +LP       +RL     SI  LPGF 
Sbjct: 177 EWFNQPAMIDIRVNLLKTTVEEVELGFSKAGVKVLPVPHLPQALRLIGGSRSISQLPGFE 236

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRL 276
           EG W VQD+SA +   L        ++D CAAPGGKT   A+L+     + A D    RL
Sbjct: 237 EGWWTVQDSSAQLVTHLLDPQPEEIIIDACAAPGGKTTHIAELMQDRGTIWACDRVASRL 296

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            K++ N  RL L +  I   D+      ++  D VL+DAPCS  GT+ + PD+ W +  +
Sbjct: 297 RKVQQNAQRLQLNSIKICSGDSRQLTQFRETADRVLIDAPCSGLGTLHKRPDIRWRQTPE 356

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            I + +  QR+LL +  S++KP G++V++ C+L+  ++E++++  L   P      PL+S
Sbjct: 357 KIEELSVLQRELLEEAASWIKPKGVLVYATCTLNPLENEKLIEAFLHHHPNWQIQPPLSS 416

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
               S   A A +P GWI++ P +          MDGFF V L
Sbjct: 417 ----SPAAAFATTP-GWIKVLPHL--------HLMDGFFMVKL 446


>gi|152972197|ref|YP_001337343.1| 16S rRNA methyltransferase B [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|224493256|sp|A6TEU2|RSMB_KLEP7 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|150957046|gb|ABR79076.1| 16S rRNA m5C967 methyltransferase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 431

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 117/402 (29%), Positives = 209/402 (51%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVVEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPEQWQEIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   LN   L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLNEAGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GVKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L      +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNAIWGHLKPGGTLVYATCSILPEENSQQIAAFLARTP 394


>gi|332533679|ref|ZP_08409538.1| ribosomal RNA small subunit methyltransferase B [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332036843|gb|EGI73304.1| ribosomal RNA small subunit methyltransferase B [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 431

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 131/417 (31%), Positives = 206/417 (49%), Gaps = 36/417 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +  N R +++  L  V+ K  SL   L       A + L  +D+ L++ I    LR+L
Sbjct: 1   MSNVPNVRALAAETLYNVVDKGASLNQELPF-----ASQGLPPKDKALLQQICYGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P ++     ++   L  K+   Q LL V + Q+ ++ V  +A +   V  A         
Sbjct: 56  PSLENYCQHLVEQPLKGKRRIFQFLLYVGIYQLQHMRVPPHAAISETVN-ALAQLRALGL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE-RVLAISDACISP 175
             L+N+ILR   R++ EL ++   I +     P WF ++++  Y      L   +   +P
Sbjct: 115 KGLINAILRSFQRQQAELEEKAKLIPVCLYNHPNWFIKQVQTAYPDSWEALLEENQQQAP 174

Query: 176 L-------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
           +             Y D+    DIE   H LN   +   GI+L + P  + SLP F  G 
Sbjct: 175 MWLRVNQAQFSTQEYSDMLSANDIE---HTLNPDFI--DGIKLAK-PRDVFSLPEFDTGA 228

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRC 281
             VQDA+A +  +      +  +LD CAAPGGKT  ++ ++ A V ALD    RLE+++ 
Sbjct: 229 CSVQDAAAQLAARFLEPKADDYILDACAAPGGKTCHILELADADVLALDSDSTRLERVKQ 288

Query: 282 NLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL R+ L A D+   DA     +  +KLFD +L+D PCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLTRIGLGA-DLQCGDASQPHTWWDEKLFDRILLDVPCSATGVIRRHPDIKWLRRASDIE 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
             A  Q  +L      +KPGG +V++ CS+  Q++++ V K L ++   VE +PL+ 
Sbjct: 348 DLAKLQSDILDSIWPLLKPGGTLVYATCSVLPQENQQQVAKFLANND-DVEHIPLHE 403


>gi|160873155|ref|YP_001552471.1| sun protein [Shewanella baltica OS195]
 gi|160858677|gb|ABX47211.1| sun protein [Shewanella baltica OS195]
 gi|315265380|gb|ADT92233.1| sun protein [Shewanella baltica OS678]
          Length = 428

 Score =  162 bits (411), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 214/457 (46%), Gaps = 57/457 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     D    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----DQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + +IE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LFQSRSEYLATLAELEIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLTPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L             +A  K   +
Sbjct: 347 QQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLE-----------RTADAKLDTL 395

Query: 404 AMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +   SP+  GW +ITP            MDGF+   L
Sbjct: 396 SQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|90413777|ref|ZP_01221765.1| Putative Sun protein [Photobacterium profundum 3TCK]
 gi|90325246|gb|EAS41743.1| Putative Sun protein [Photobacterium profundum 3TCK]
          Length = 431

 Score =  162 bits (411), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 120/395 (30%), Positives = 203/395 (51%), Gaps = 26/395 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L      +A + + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAAQVVFQVVDQGQSLSAALP-----AAQQNIRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   V  A +D +      L+
Sbjct: 56  SITTHLMDKPLKGKQRVFHHLILVGLYQLGHMRIPAHAAVAETVN-ATKDLKKTQLRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N+ILR   R++ +L    +   AG    P W  + L+  Y ++   +  ++   +P+++ 
Sbjct: 115 NAILRNYQRQQEQLDAQSVSHDAGKYGHPGWLLKMLKASYPEQLEAIVTANNTKAPMWLR 174

Query: 180 LTVKFDI-ETWAHKLNAVMLPTG-------GIRLKELPESIVSLPGFAEGVWWVQDASAS 231
           +  +    + +   LN V + TG        +RL   P  +  LPGFA+G   VQD +A 
Sbjct: 175 VNRQHHTRDEYRALLNDVGIETGLHPEAADALRLLS-PCDVSKLPGFADGWSSVQDGAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
           + V       +  +LD CAAPGGKTA ++     AKV A+D  +RRL ++  NL RL L 
Sbjct: 234 LAVDFLQPQADELILDCCAAPGGKTAHIMERQPTAKVVAIDCDERRLTRVHENLARLKLD 293

Query: 290 AEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
           A  ++  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R   DI   A  Q +
Sbjct: 294 AT-VLCADARYPADWWHGEKFDRILLDAPCSATGVIRRHPDIKWLRRASDIEALAILQAE 352

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           +       +K GG +V++ CS+  Q++ E V+  L
Sbjct: 353 IFDAMWLQLKSGGTLVYATCSITPQENSEQVKAFL 387


>gi|304412733|ref|ZP_07394336.1| sun protein [Shewanella baltica OS183]
 gi|307305802|ref|ZP_07585548.1| sun protein [Shewanella baltica BA175]
 gi|304348943|gb|EFM13358.1| sun protein [Shewanella baltica OS183]
 gi|306911295|gb|EFN41721.1| sun protein [Shewanella baltica BA175]
          Length = 428

 Score =  162 bits (411), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 213/457 (46%), Gaps = 57/457 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     D    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----DQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLAKPLKGKQRIIHQLLIIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + +IE +     +A++L          P+ +  LP F EG   VQD 
Sbjct: 176 LSQSRTEYLAALAELEIEASEGSSADAILLAH--------PKDVAILPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHGDAANIDSWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L             +A  K   +
Sbjct: 347 QQQILDHCWKWLKPGGTILYATCSILPQENRDQISAFLE-----------RTADAKLDTL 395

Query: 404 AMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +   SP+  GW +ITP            MDGF+   L
Sbjct: 396 SQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|257058561|ref|YP_003136449.1| sun protein [Cyanothece sp. PCC 8802]
 gi|256588727|gb|ACU99613.1| sun protein [Cyanothece sp. PCC 8802]
          Length = 451

 Score =  162 bits (411), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 138/441 (31%), Positives = 218/441 (49%), Gaps = 72/441 (16%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVA 99
           LS  D+ LV  +V   +R    +D ++D +   +  ++   L+ +L + + Q+ YL  + 
Sbjct: 41  LSGSDRALVTELVYGIVRRKRTLDTLIDQLGKKASHQQPPDLRLILYIGLYQLRYLSQIP 100

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILR---RVSREKIELL-------QRIAGISIIP 149
             A V+ AV  AK +   R  + +VN ILR   R+++E  + L        R+  +   P
Sbjct: 101 PSAAVNTAVNLAKENSLQR-LSGVVNGILRQYIRLAQENNDPLILPDDPISRLGVLYSFP 159

Query: 150 E-----WFK-------ERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +     W +       E L N++ +  VL   D  I+PL   L    +++T   + N  +
Sbjct: 160 DFMIKLWLEQWGLETTEELCNWFNQPPVL---DIRINPLKTTLE---EVKTTLSQGNLTL 213

Query: 198 LP---TGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGG 254
           +P     G+RL+    +I  LPGF EG W VQD+SA +   L     +  ++D CAAPGG
Sbjct: 214 MPLEIPQGLRLQGKTGAIQDLPGFKEGWWTVQDSSAQLVSHLLDPQPSEVIIDACAAPGG 273

Query: 255 KT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII-----EMDAFDYCPKKL 306
           KT   A+L+     + A D    RL+KL  N +RL L +  I+     ++D F    + +
Sbjct: 274 KTTHIAELMGDQGTIWACDRYASRLKKLSANKERLQLNSIKIVTGDSRQLDQF----QGI 329

Query: 307 FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC 366
            D VLVDAPCS  GT+ RHPD+ W +  + I + A  Q++LL    ++VKP GI+V++ C
Sbjct: 330 ADRVLVDAPCSGLGTLHRHPDIRWRQTPEKIEELAILQKELLETTANWVKPQGILVYATC 389

Query: 367 SLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSP-------EGWIRITPDM 419
           +L  Q++E V++  L S P           +WK ID+    SP        G I+I P  
Sbjct: 390 TLTYQENEGVIEHFLASHP-----------HWK-IDVPSPDSPAAKWMTASGAIKILPHQ 437

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
            +        MDGFF V L++
Sbjct: 438 QD--------MDGFFMVKLKK 450


>gi|229530170|ref|ZP_04419559.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           12129(1)]
 gi|229332303|gb|EEN97790.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           12129(1)]
 gi|327482955|gb|AEA77362.1| Ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           LMA3894-4]
          Length = 426

 Score =  162 bits (411), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLQGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 235 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 391


>gi|15837530|ref|NP_298218.1| hypothetical protein XF0928 [Xylella fastidiosa 9a5c]
 gi|46397049|sp|Q9PEV0|RSMB_XYLFA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|9105851|gb|AAF83738.1|AE003932_2 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 421

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 123/357 (34%), Positives = 185/357 (51%), Gaps = 30/357 (8%)

Query: 44  RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAV 103
           RD+ LV AI    LR  P  +A L   L   L R    L+ LL V  AQ+  L V  YA 
Sbjct: 32  RDRALVEAICFAVLRRRPVYEAALTQWLARPLGRGDAQLRGLLMVGFAQLDVLKVPPYAA 91

Query: 104 VDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKE 163
           +   V+ A R     H A  VN++LRR  RE++ +   ++  +  P W  ER+   +G E
Sbjct: 92  LSATVD-ACRVLGWPHRASFVNAVLRRAQRERLPV---VSSDAAWPRWLAERIRADWG-E 146

Query: 164 RVLAISDACI--SPLYIDLTVKF-DIETWAHKLNAVML---PTGGIRLKELPES------ 211
              AI DA +  +P+++ + +++ D  T+  +L A  L   P+G +     PE+      
Sbjct: 147 LAEAIFDASLKPAPMWLRVNLRYGDRHTYVQRLQAAGLEAVPSGLV-----PEALALDCS 201

Query: 212 --IVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--T 267
             ++ LPGF  G   VQD SA     L     +  VLD CAAPGGK A L+     +  T
Sbjct: 202 MPVLQLPGFQAGEVSVQDLSAQQVAALLSPAPHARVLDACAAPGGKAAHLLERAPTLCLT 261

Query: 268 ALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRR 324
           ALDV  +RL ++    DR+H+ A  +   DA D   +   + FDAVL+DAPCS+TG +RR
Sbjct: 262 ALDVDMQRLRRVAETCDRIHVKAR-LCVADATDLAAWWDGEAFDAVLLDAPCSATGVVRR 320

Query: 325 HPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            PDVL  R  +D++     Q +LL      ++PGG++V+  CS+ + +++  ++  L
Sbjct: 321 QPDVLLHRRAEDLLPLLNIQSRLLDACWRTLRPGGVLVYVTCSVLRAENQTQLEAFL 377


>gi|294625236|ref|ZP_06703876.1| Sun protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|294666265|ref|ZP_06731516.1| Sun protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
 gi|292600464|gb|EFF44561.1| Sun protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           11122]
 gi|292603974|gb|EFF47374.1| Sun protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB
           10535]
          Length = 436

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 136/407 (33%), Positives = 206/407 (50%), Gaps = 42/407 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEY---GDSAFRLLSQRDQILVRAIVNVTLRF 59
           +G+ +RL ++ +L+ V  +  SL   L L     GD        RD+ LV AI    +R 
Sbjct: 8   AGVASRLAAARVLTAVFDQGRSLKAELALTLPGIGDP-------RDRALVEAICFAVIRR 60

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
            P  +  L   L  +LP +   L+ LL V  AQ+  L +  +A +   V+  +     R 
Sbjct: 61  RPAYELALRQWLERALPPRDAELKALLMVGFAQLDVLQLPAHAALSATVDACRALGRPRQ 120

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAI--SDACISPLY 177
            A +VN+ILRR  RE    +   AG    P W +++L   +G +R  AI  + A ++P++
Sbjct: 121 -AGMVNAILRRAQREGFPAVADDAGW---PSWLRKQLRADWG-DRAEAIFTASAQMAPMW 175

Query: 178 IDLT-VKFDIETWAHKL--------NAVMLPTGGIRLKE-LPESIVSLPGFAEGVWWVQD 227
           + +   + D  T+  +L           +LP   +RL   +P  +  LPGFAEG   VQD
Sbjct: 176 LRVQRSRTDPATYVARLAELDIVAHTDAVLPDA-VRLHNAVP--VSQLPGFAEGDVSVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDR 285
            SA           +  VLD CAAPGGK A L+    G ++ ALDV  RRLE+++  L R
Sbjct: 233 GSAQQVADALTLARSARVLDACAAPGGKAAHLLERHPGLQLVALDVDARRLERVQQTLQR 292

Query: 286 ------LHLYAEDIIEMDAF-DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
                 + L A D  + +A+ D  P   FDAVL+DAPCS+TG +RR PDVL  R  DDI 
Sbjct: 293 TVPNAQVALQAADAADTEAWWDGQP---FDAVLLDAPCSATGVVRRQPDVLLHRRADDID 349

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
                Q +LL      ++PGG ++++ CSL  ++++  V+  L+ +P
Sbjct: 350 ALCALQARLLDATWRTLRPGGQLLYTTCSLLARENQAQVEAFLQRTP 396


>gi|319424439|gb|ADV52513.1| sun protein [Shewanella putrefaciens 200]
          Length = 429

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 133/458 (29%), Positives = 216/458 (47%), Gaps = 59/458 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     +    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFEVLEKGVSLSVALP----EQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRISECLEKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y ++    I  +   P        
Sbjct: 116 NGVLRNIQRQLSPLSTESDTLSYNTPAWLIKRLKEAYPEQWQDIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIE-TWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    + DIE +     +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRTEYLAALAELDIEASEGSSADAILLAH--------PKDVATLPRFHEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+       + A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQVNELILDACAAPGGKSCHLLELEPSINLVAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +    LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-LIHSDAANIGSWWQGGLFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSID 402
           Q+++L     ++KPGG ++++ CS+  Q++ + +   L R+    +++            
Sbjct: 347 QQQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLDRTVDAKLDI------------ 394

Query: 403 MAMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +A   SP+  GW +ITP            MDGF+   L
Sbjct: 395 LAQQNSPQDIGW-QITPGQ--------DNMDGFYYARL 423


>gi|153209759|ref|ZP_01947497.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           'MSU Goat Q177']
 gi|212217708|ref|YP_002304495.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii CbuK_Q154]
 gi|120575262|gb|EAX31886.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           'MSU Goat Q177']
 gi|212011970|gb|ACJ19350.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii CbuK_Q154]
          Length = 430

 Score =  162 bits (410), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 219/419 (52%), Gaps = 50/419 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ L++ V++K+ SLT LL            ++ +Q L++ +   TLR+  ++ 
Sbjct: 1   MNTRATAAILVNQVVQKKRSLTALLSA----------NKNNQSLIQELCYGTLRWYFKLK 50

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK-L 123
            + + +L + L  K + +  L+     Q+ YL++  + +V+  V  A+  K  + +AK L
Sbjct: 51  LIAEKLLHAPLRDKDHDIFCLILTGFYQLNYLNIPTHTIVNQTVGAAEILK--KPWAKGL 108

Query: 124 VNSILRRVSREKIELL----QRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYI 178
           +N +LRR   EK ELL    + I G    P WF + ++  +      + I++    P+  
Sbjct: 109 INKLLRRFIAEKDELLTFTEKTIEGQYAHPLWFIQHIKKAWPDHWESILIANNARHPM-- 166

Query: 179 DLTVKFDIETWAHKLNAVMLPTGGIRLK-----------ELPESIVSLPGFAEGVWWVQD 227
             T++ ++   + ++   ML    I  K           E P S+  LPGF EG  ++QD
Sbjct: 167 --TLRVNLTKISREIYLEMLDQKNISAKPLDFLPAAIQLEKPCSVHQLPGFNEGYCYIQD 224

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCNLD 284
           A+      L    NN +VLD CAAPG KT+ ++     +    A+D +K+RL +++ N+ 
Sbjct: 225 AAGQFAAYLLKLENNQTVLDACAAPGSKTSHILEVNPHLKTLVAIDNNKQRLNRIKENIT 284

Query: 285 RLHLYAE-------DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           RL L  E       D+ ++D   +   +LFD +L+DAPCS+TG IRRHPD+   R   DI
Sbjct: 285 RLGLRQEHLQCLLADVSQID--QWSSGELFDRILLDAPCSATGVIRRHPDIKLLRQPGDI 342

Query: 338 VKSACFQRKL-LLQGI-SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             S   Q+KL LL  + + +K GG +++S CS+   ++E+V+++ L S+   VEL P N
Sbjct: 343 --SQYHQKKLQLLNALWTVLKAGGFLLYSTCSVLPDENEKVIEEFL-STHDKVELSPTN 398


>gi|148241673|ref|YP_001226830.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           RCC307]
 gi|147849983|emb|CAK27477.1| Ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           RCC307]
          Length = 454

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 146/461 (31%), Positives = 204/461 (44%), Gaps = 64/461 (13%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRL------LSQRDQILVRAIVNVTL 57
           G+  RLV+  +L  V           D  Y D A         LS RD+ L   +    +
Sbjct: 28  GLPPRLVAWRVLEAVG----------DGAYADLALERELKRSKLSPRDRGLATELAYGAI 77

Query: 58  RFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKE 116
           R   R+D  LD +      ++   L+ LL V + QIL +D V   A V  AVE AKR++ 
Sbjct: 78  RQRRRLDGWLDLLGKVPAAKQPPRLRWLLHVGLQQILLMDRVPASAAVSTAVELAKRERL 137

Query: 117 NRHFAKLVNSILRRVSR--EKIELL-------QRIAGISIIPEWFKERLENFYGKERVLA 167
            R  A +VN +LR   R  E  E L       +R+A    +P+W    L    G ER  A
Sbjct: 138 QR-LAPVVNGVLRAAVRAVEAGESLPVPSDPQKRLALEHSLPDWLVAELWGQIGPERTEA 196

Query: 168 ISDAC--ISPLYIDLT-VKFDIETWAHKLNAVMLP--TGGIRLKELPESIVSLPGFAEGV 222
           ++ A   I PL +    ++   E     L AV L     G+ L   P  +  L GF+EG 
Sbjct: 197 LAAASNRIPPLDLRCNRLRSSREALLENLPAVALAELPDGLTLTSRPGPLPQLAGFSEGQ 256

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKL 279
           W VQD +A     L        VLD CAAPGGKT   A+L+    +V A+DV+ RRL+++
Sbjct: 257 WCVQDRAAQRIAPLLDPKPGQRVLDACAAPGGKTTHIAELMGDQGEVVAVDVAPRRLQQV 316

Query: 280 RCNLDRLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
             N +RL L        DA D      + FD VL+D PCS  GT+ RH D  W    D I
Sbjct: 317 SANAERLGLSCIRTEAADATDLTDWEAESFDRVLLDVPCSGLGTLARHADARWNLKPDGI 376

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            +    Q +LL QG   +KP G +V++ C++   ++  VV+  +  +P            
Sbjct: 377 EELVGLQHQLLEQGARLLKPDGRLVYATCTVHPAENTGVVEAFVEENP-----------D 425

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           W+  +  M L P+                  G DGFFA  L
Sbjct: 426 WQFSEPPMQLWPD----------------PQGGDGFFAAVL 450


>gi|229515917|ref|ZP_04405374.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           TMA 21]
 gi|229524946|ref|ZP_04414351.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           bv. albensis VL426]
 gi|229338527|gb|EEO03544.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           bv. albensis VL426]
 gi|229347017|gb|EEO11979.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           TMA 21]
          Length = 426

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 235 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 391


>gi|317494309|ref|ZP_07952723.1| ribosomal RNA small subunit methyltransferase B [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316917559|gb|EFV38904.1| ribosomal RNA small subunit methyltransferase B [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 430

 Score =  162 bits (409), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 116/403 (28%), Positives = 203/403 (50%), Gaps = 37/403 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R +++  L  V+ +  SL+ +L      +  + +S++D+ L++ +    LR LP+++ 
Sbjct: 7   NLRAIAAKALGSVLDQGQSLSTVLP-----ALSKEVSEKDRALLQELCFGVLRVLPQLEW 61

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
            +  ++   L  K+  L  L+ V + Q++Y  +  +A +   V  A   K  +    L+N
Sbjct: 62  YIQQLMAKVLTGKQRPLHYLIMVGIYQLVYTRIPPHAALAETVNGAVALKRPQ-LKGLIN 120

Query: 126 SILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL----- 176
            +LR+  R++ +L +R        + P W  +RL+  Y ++   +  ++    P+     
Sbjct: 121 GVLRQFQRQEDQLKERAQNNECRFLHPSWLLKRLQQAYPQQWESIVDANNQRPPMWLRVN 180

Query: 177 --------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                   Y+ L  K +I  +AH    +A+ L        E    +  LPGF +G   VQ
Sbjct: 181 RLHHSRDEYLALLAKAEINAFAHPQFPDAICL--------EEASPVGRLPGFEQGWVTVQ 232

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLD 284
           DASA   V L    N   +LDLC APGGKT  ++ +  K  V A+DV + RL +++ NL 
Sbjct: 233 DASAQHCVDLLDPQNGEQILDLCCAPGGKTTHILEAAPKAHVLAVDVDENRLRRVKENLH 292

Query: 285 RLHLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL   AE       +   +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 RLQQQAEVKCGDGRYPEKWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAA 352

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q++++      +K GG++V++ CS+  +++ + +++ L   P
Sbjct: 353 LQKEIIEAIWPHLKSGGVMVYATCSVLPEENAQQMREFLSRHP 395


>gi|117918492|ref|YP_867684.1| sun protein [Shewanella sp. ANA-3]
 gi|117610824|gb|ABK46278.1| sun protein [Shewanella sp. ANA-3]
          Length = 429

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 132/451 (29%), Positives = 213/451 (47%), Gaps = 53/451 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     +    L S +D+ L+  +    +R LP+I+
Sbjct: 2   MNLRALAAKAIFEVLEKGVSLSVALP----EQQKHLASGKDKALLAELCYGVMRTLPQIE 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 58  KRVAECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 116

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y       I  +   P        
Sbjct: 117 NGVLRNIQRQLTPLSTESETLSYNTPGWLIKRLKAAYPDNWQEIIQQSHERPPMWLRNNR 176

Query: 176 ------LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
                  Y+    + +IE       +  L    I L   P+ + +LP F EG   VQD +
Sbjct: 177 LSQSRDAYLAALSELEIEA------SAGLSDDAILLAH-PKDVATLPRFHEGAASVQDGA 229

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A     L     N  VLD CAAPGGK+  L+      ++ A+D   +RLE+++ NLDRL 
Sbjct: 230 AQWAATLLAPQANELVLDACAAPGGKSCHLLELEPSIQLVAVDFDAKRLERVQQNLDRLS 289

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L AE +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 290 LKAE-VIHGDAANIDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAELQ 348

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSIDM 403
           R++L     ++KPGG ++++ CS+  Q++ + +   L R++   ++ +   ++   S D+
Sbjct: 349 RQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLARTADAKLDTLAQQAS---SQDI 405

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
                  GW +ITP            MDGF+
Sbjct: 406 -------GW-QITPGQ--------HNMDGFY 420


>gi|229508832|ref|ZP_04398323.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           B33]
 gi|229517103|ref|ZP_04406549.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           RC9]
 gi|229606604|ref|YP_002877252.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           MJ-1236]
 gi|255746774|ref|ZP_05420720.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholera
           CIRS 101]
 gi|229346166|gb|EEO11138.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           RC9]
 gi|229354107|gb|EEO19039.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           B33]
 gi|229369259|gb|ACQ59682.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           MJ-1236]
 gi|255735531|gb|EET90930.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholera
           CIRS 101]
          Length = 426

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMGKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 235 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLELTA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 391


>gi|116747600|ref|YP_844287.1| sun protein [Syntrophobacter fumaroxidans MPOB]
 gi|116696664|gb|ABK15852.1| sun protein [Syntrophobacter fumaroxidans MPOB]
          Length = 449

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 134/436 (30%), Positives = 214/436 (49%), Gaps = 60/436 (13%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L +RD+ L+  +V   LR+  R+D  +D +  +   +   +++ LLR+++ QIL LD + 
Sbjct: 36  LEERDRALLTELVYGVLRWQGRLDWHIDQLSRTRPEKIDPAVRILLRLALYQILMLDRIP 95

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELL---------QRIAGISIIPE 150
           D+A V+ AV  AK   +  +  K VN +LR   R +   +         + IA  +  P 
Sbjct: 96  DHAAVNEAVNMAK-TTQPAYLVKFVNGVLREALRRRSRWIWPEAGEEPGKYIAVTTAHPI 154

Query: 151 WFKERLENFYGKERVLAISDA--CISPLYIDLT-VKFDIET---WAHKLNAVMLPTG--- 201
           W+ ERL + +G E  L I +A   ++P+ + +  +K  I+T   W  +      P+G   
Sbjct: 155 WYVERLLHEFGFEETLDICNANNTVAPMTLRVNALKTSIDTILQWCAEHGIDAEPSGVVP 214

Query: 202 -GIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL- 259
             +RL  L   +     + +G+  VQD ++ I   L        VLDLCA  GGK+  L 
Sbjct: 215 TAVRLSGLRRDLAETSIYRDGLVQVQDEASQIVSTLVAPRAGERVLDLCAGFGGKSTHLG 274

Query: 260 IVSG--AKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAP 315
           I+ G   +V A+D S  +LE+LR N  R  L        D F++ P  + LFD VL+DAP
Sbjct: 275 ILMGDRGEVVAVDNSAWKLEELRKNARRQGLRIIKPRTADLFEFSPGTEDLFDRVLLDAP 334

Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375
           CS  GT+RR+PD+ W R   D  +    Q+++L     FVKPGG +V+S C+L +++++ 
Sbjct: 335 CSGFGTLRRNPDIKWRRHLKDPRRFGRIQKEMLDHAARFVKPGGALVYSACTLFQEENDA 394

Query: 376 VVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSG------ 429
           V +    S P            W+       + P G     PD+ +   G++SG      
Sbjct: 395 VAEHFAASHP-----------DWQ-------IEPVG-----PDLPDACRGMASGPFFRTW 431

Query: 430 -----MDGFFAVALRR 440
                +DGFFA  L+R
Sbjct: 432 PHRHQVDGFFAARLKR 447


>gi|260774556|ref|ZP_05883469.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           metschnikovii CIP 69.14]
 gi|260610462|gb|EEX35668.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           metschnikovii CIP 69.14]
          Length = 426

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/404 (30%), Positives = 202/404 (50%), Gaps = 36/404 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++ + L  KK     L+ V + Q+ Y+ +  +A V   VE A +       + L+
Sbjct: 56  SIAGQLMDNPLKGKKRVFHHLILVGLYQLSYMRIPSHAAVAETVE-ATKTLRGPSLSGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R++  L    +   AG+   P W  + L+  Y ++ + +  ++   +P+   
Sbjct: 115 NAVLRSYLRDQEALDAFAVSHNAGLYAHPSWLLKLLQEAYPQQWQTIIEANNSKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y+ L     IE   H   A       I+L   P  +  LPGF  G   VQ
Sbjct: 175 VNRQHHSREAYLALLDNEQIEYTVHPQAA-----DAIKLAS-PCDVTLLPGFDRGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + +      +   +LD CAAPGGKTA ++      +V A+D    RLE++  NL+
Sbjct: 229 DAAAQLAIDYLQPQDGELILDCCAAPGGKTAHILEHTQDTEVVAIDSDAARLERVYDNLE 288

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A D+I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R   DI   A
Sbjct: 289 RLQLRA-DVICGDARYPEEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRASDIEALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
             Q ++L      +K GG +V++ CS+  Q++ + ++  L  +P
Sbjct: 348 ELQSEILDAMWKQLKIGGTLVYATCSITPQENSQQIKAFLARTP 391


>gi|229508329|ref|ZP_04397833.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae BX
           330286]
 gi|262155855|ref|ZP_06028977.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           INDRE 91/1]
 gi|262166898|ref|ZP_06034619.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           RC27]
 gi|229354602|gb|EEO19524.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae BX
           330286]
 gi|262024669|gb|EEY43349.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           RC27]
 gi|262030307|gb|EEY48949.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           INDRE 91/1]
          Length = 426

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMGKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 235 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLELTA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 391


>gi|223994911|ref|XP_002287139.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220976255|gb|EED94582.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 1014

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 134/491 (27%), Positives = 231/491 (47%), Gaps = 103/491 (20%)

Query: 35   DSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRK-KYS--LQQLLRVSVA 91
            D  +  +  RD+   R +V    R L +ID VL   +    P+K K+S  +Q  LR  VA
Sbjct: 546  DEHYNEMEARDRAFARLLVATVERRLGQIDGVLGSCIEKYPPKKGKHSHLIQATLRTGVA 605

Query: 92   QILYLDVADYAVVDLAVEQAKRDKENRHFAK------------LVNSILRRVSREKIELL 139
            Q+L+LD   +A     V+  +    + H +K             VN + R++S      +
Sbjct: 606  QLLFLDTPPFAANKETVQVLRM---HHHLSKTSTYPVPEPMVKFVNGVFRKLSEPLAADI 662

Query: 140  QRIAGISIIPE--------------------WFKERLENFYGK-------ERVLAISDAC 172
              ++    IP+                    W  +R EN +G        E ++ + ++ 
Sbjct: 663  DEMSTDDDIPKHLFGHQLLRESTTSKDNIAPWLLKRWENDWGDDLATLICEEMMPVDESS 722

Query: 173  ISPLYIDLTVKF---------DIETWAHKL------NAVMLPTGGIRL-KELPESIVSLP 216
             +P  IDL+ K+         D E    ++      ++ +L  G IR+   L   + S P
Sbjct: 723  FTP-RIDLSTKYSLGVVLKKQDDEGMMQQMLEELGGDSTLLSQGSIRVGTSLKGDVKSWP 781

Query: 217  GFAEGVWWVQDASASIPVQLFGT------------LNNLSVLDLCAAPGGKTAQLIVSG- 263
            G+ +G WWVQDAS+++P  +               L++++V+D+CAAPGGKTA L+ +G 
Sbjct: 782  GYDDGTWWVQDASSTLPALVLSQALYDKNGSDESVLSDINVVDMCAAPGGKTAALLSAGF 841

Query: 264  AKVTALDVSKRRLEKLRCNLDRLHLYAE-DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTI 322
             +VTA++ + RR  +L  NL+RL L  +  ++  +  ++ P +    +LVD PCS+TGT 
Sbjct: 842  GRVTAIEANARRSRRLVENLERLKLSEKCQVVVEEGQNWIPSEKVHGILVDVPCSATGTG 901

Query: 323  RRHPDVLWTRDTD--------DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSE 374
             R PDVL  RD +        +I+ + C          + +  GG++V++ CS+ K++SE
Sbjct: 902  ARRPDVL-RRDPNLKELLTIQEILANHCAD--------NVLDEGGLMVYATCSILKEESE 952

Query: 375  EVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
            + V K+++   +  E +P+        +   A+   GW+R+ P +L+   G     DGFF
Sbjct: 953  DQVHKLIKRGSM--ETLPIQPHEVPGFE--GAIDENGWLRVLPGVLK---GDLRSTDGFF 1005

Query: 435  AVALRRLIQPK 445
                 RL++ K
Sbjct: 1006 VA---RLVKTK 1013


>gi|238758791|ref|ZP_04619965.1| Ribosomal RNA small subunit methyltransferase B [Yersinia aldovae
           ATCC 35236]
 gi|238703088|gb|EEP95631.1| Ribosomal RNA small subunit methyltransferase B [Yersinia aldovae
           ATCC 35236]
          Length = 429

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 126/423 (29%), Positives = 222/423 (52%), Gaps = 46/423 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  +S V+ +  SL+ +L +L+      + +S +D+ L++ +    LR 
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPELQ------KNISDKDRALLQELCFGALRV 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   L  K+     L+ V + Q++Y  +  +A +   VE A   K  + 
Sbjct: 55  LPQLEWCIQQLMARPLTGKQRIFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDAC-- 172
              L+N +LR+  R+++ELL+R A      + P W   R++  Y  +  ++L  ++    
Sbjct: 114 LKGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKQAYPDQWQQILEANNQKPP 173

Query: 173 ----ISPL------YIDLTVKFDIETWAHKL--NAVMLPTGGIRLKELPESIVSLPGFAE 220
               +S L      Y++L  + +I+   H    +AV L T        P ++  LPGF  
Sbjct: 174 MWLRVSRLHHSRNEYLELLKQANIDALPHDFYSDAVRLIT--------PCAVNDLPGFEL 225

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEK 278
           G   VQDASA   V L    +   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL +
Sbjct: 226 GWVTVQDASAQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVLAIDIDEQRLSR 285

Query: 279 LRCNLDRLHLYAEDIIEMD----AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           ++ NL RL+L+A  ++ +       ++C  + FD +L+DAPCS+TG IRRHPD+ W R  
Sbjct: 286 VKENLQRLNLHA--VVRVGDGRTPDEWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRD 343

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSSPIPVELVPL 393
            DI   A  Q +++      +K GG++V++ CS L  ++ +++   + R S    ELV  
Sbjct: 344 SDIADLAKLQSEIVEAIWPKLKKGGVMVYATCSILPDENQQQIAAFLQRHS--EAELVET 401

Query: 394 NSA 396
            +A
Sbjct: 402 GTA 404


>gi|322615051|gb|EFY11975.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617338|gb|EFY14239.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625560|gb|EFY22385.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626402|gb|EFY23211.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632086|gb|EFY28839.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635035|gb|EFY31758.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643264|gb|EFY39831.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646652|gb|EFY43159.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649998|gb|EFY46417.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652715|gb|EFY49055.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659528|gb|EFY55772.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665530|gb|EFY61717.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670424|gb|EFY66563.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670497|gb|EFY66631.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675073|gb|EFY71156.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681610|gb|EFY77639.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685954|gb|EFY81943.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195824|gb|EFZ80997.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196420|gb|EFZ81571.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202705|gb|EFZ87744.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207310|gb|EFZ92260.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211254|gb|EFZ96099.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216037|gb|EGA00768.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223472|gb|EGA07800.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226798|gb|EGA10988.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231840|gb|EGA15950.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233207|gb|EGA17302.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237274|gb|EGA21339.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245509|gb|EGA29508.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249015|gb|EGA32937.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250638|gb|EGA34519.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256867|gb|EGA40581.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263016|gb|EGA46563.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266016|gb|EGA49511.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272773|gb|EGA56176.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 429

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 118/403 (29%), Positives = 208/403 (51%), Gaps = 27/403 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  + S A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVASEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTP 394


>gi|154707343|ref|YP_001423631.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|165922514|ref|ZP_02219685.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           RSA 334]
 gi|154356629|gb|ABS78091.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii Dugway
           5J108-111]
 gi|165916719|gb|EDR35323.1| ribosomal RNA small subunit methyltransferase B [Coxiella burnetii
           RSA 334]
          Length = 430

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 129/419 (30%), Positives = 219/419 (52%), Gaps = 50/419 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ L++ V++K+ SLT LL            ++ +Q L++ +   TLR+  ++ 
Sbjct: 1   MNTRATAAILVNQVVQKKRSLTALLSA----------NKNNQSLIQELCYGTLRWYFKLK 50

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK-L 123
            + + +L + L  K + +  L+     Q+ YL++  + +V+  V  A+  K  + +AK L
Sbjct: 51  LIAEKLLHAPLRDKDHDIFCLILTGFYQLNYLNIPTHTIVNQTVGAAEILK--KPWAKGL 108

Query: 124 VNSILRRVSREKIELL----QRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYI 178
           +N +LRR   EK ELL    + I G    P WF + ++  +      + I++    P+  
Sbjct: 109 INKLLRRFIAEKDELLTFTEKTIEGQYAHPLWFIQHIKKAWPDHWESILIANNARPPM-- 166

Query: 179 DLTVKFDIETWAHKLNAVMLPTGGIRLK-----------ELPESIVSLPGFAEGVWWVQD 227
             T++ ++   + ++   ML    I  K           E P S+  LPGF EG  ++QD
Sbjct: 167 --TLRVNLTKISREIYLEMLDQKNISAKPLDFLPAAIQLEKPCSVHQLPGFNEGYCYIQD 224

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCNLD 284
           A+      L    NN +VLD CAAPG KT+ ++     +    A+D +K+RL +++ N+ 
Sbjct: 225 AAGQFAAYLLKLENNQTVLDACAAPGSKTSHILEVNPHLKTLVAIDNNKQRLNRIKENIT 284

Query: 285 RLHLYAE-------DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           RL L  E       D+ ++D   +   +LFD +L+DAPCS+TG IRRHPD+   R   DI
Sbjct: 285 RLGLRQEHLQCLLADVSQID--QWSSGELFDRILLDAPCSATGVIRRHPDIKLLRQPGDI 342

Query: 338 VKSACFQRKL-LLQGI-SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             S   Q+KL LL  + + +K GG +++S CS+   ++E+V+++ L S+   VEL P N
Sbjct: 343 --SQYHQKKLQLLNALWTVLKAGGFLLYSTCSVLPDENEKVIEEFL-STHDKVELSPTN 398


>gi|161616434|ref|YP_001590399.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|197262016|ref|ZP_03162090.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|224493265|sp|A9N8B3|RSMB_SALPB RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|161365798|gb|ABX69566.1| hypothetical protein SPAB_04249 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197240271|gb|EDY22891.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
          Length = 429

 Score =  161 bits (408), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 223/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVVAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|251788002|ref|YP_003002723.1| 16S rRNA methyltransferase B [Dickeya zeae Ech1591]
 gi|247536623|gb|ACT05244.1| sun protein [Dickeya zeae Ech1591]
          Length = 431

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 129/407 (31%), Positives = 208/407 (51%), Gaps = 35/407 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ +L  V+ +  SL+ LL +   D     +S++D+ L++ I    LR L
Sbjct: 1   MKSTYNLRSIAATVLVQVVEQGQSLSQLLPVFQRD-----ISEKDRGLLQEICFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  L  ++   L  K+  L  LL V + Q+++  +  +A +   V  A   K  +  
Sbjct: 56  PQLDWYLRQLMAKPLTGKQKVLHYLLMVGIYQLIHTRIPPHAALAETVNAAVTLKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFYGKERVLAISDACISP-- 175
             L+N +LR+  R++ EL QR+   +     P+W  +RL+  Y  +    I      P  
Sbjct: 115 KGLINGVLRQFQRQQEELQQRLQNNTARYSHPDWLLQRLKKAYPDQWEQIIDANNQHPPM 174

Query: 176 ------------LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y+ L  +  IE   H        T  IRL   P ++  LPGF +G  
Sbjct: 175 WLRVNRLHHSREAYLVLLQEKGIEAHPHPFY-----TDAIRLIT-PCAVSGLPGFDQGWV 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRC 281
            VQDASA   +      N+  +LDLCAAPGGKT  ++ +   A+V A+DV ++RL++++ 
Sbjct: 229 TVQDASAQGCIHWLSPKNHEDILDLCAAPGGKTTHILEAAPQARVLAVDVDEQRLKRVKE 288

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL RL L+A D+   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLQRLRLHA-DVKCGDGRTPEAWCADQCFDRILLDAPCSATGVIRRHPDIKWLRRDSDIA 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           + A  Q+ +L      +K GG +V++ CS+  +++ + +   L+  P
Sbjct: 348 ELASLQQAILEAIWPRLKNGGTLVYATCSVLPEENSQQIAAFLQHHP 394


>gi|198244494|ref|YP_002217372.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|224493260|sp|B5FJI4|RSMB_SALDC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|197939010|gb|ACH76343.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|326625153|gb|EGE31498.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
          Length = 429

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 224/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLC+APGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCSAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DIV+ A 
Sbjct: 293 LGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIVELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|114045538|ref|YP_736088.1| sun protein [Shewanella sp. MR-7]
 gi|113886980|gb|ABI41031.1| sun protein [Shewanella sp. MR-7]
          Length = 429

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 132/451 (29%), Positives = 213/451 (47%), Gaps = 53/451 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     +    L S +D+ L+  +    +R LP+I+
Sbjct: 2   MNLRALAAKAIFEVLEKGVSLSVALP----EQQKHLASGKDKALLAELCYGVMRTLPQIE 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 58  KRVAECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 116

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y       I  +   P        
Sbjct: 117 NGVLRNIQRQLTPLSTESETLSYNTPGWLIKRLKAAYPDNWQEIILQSHERPPMWLRNNR 176

Query: 176 ------LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
                  Y+    + +IE       +  L    I L   P+ + +LP F EG   VQD +
Sbjct: 177 LSQSRDAYLATLSELEIEA------SAGLSDDAILLAH-PKDVATLPRFHEGAASVQDGA 229

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A     L     N  VLD CAAPGGK+  L+      ++ A+D   +RLE+++ NLDRL 
Sbjct: 230 AQWAATLLAPQANELVLDACAAPGGKSCHLLELEPSIQLVAVDFDAKRLERVQQNLDRLS 289

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L AE +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 290 LKAE-VIHGDAANIDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAELQ 348

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSIDM 403
           R++L     ++KPGG ++++ CS+  Q++ + +   L R++   ++ +   ++   S D+
Sbjct: 349 RQILDHSWKWLKPGGTLLYATCSILPQENRDQISAFLARTADAKLDTLAQQAS---SQDI 405

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
                  GW +ITP            MDGF+
Sbjct: 406 -------GW-QITPGQ--------HNMDGFY 420


>gi|163803318|ref|ZP_02197196.1| methionyl-tRNA formyltransferase [Vibrio sp. AND4]
 gi|159172888|gb|EDP57727.1| methionyl-tRNA formyltransferase [Vibrio sp. AND4]
          Length = 427

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 123/402 (30%), Positives = 208/402 (51%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSNALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+   
Sbjct: 115 NAVLRNYQRSQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y+ L    +I++  H   ++A+ L          P  +++LPGF +G   
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHSQAMDALKLAA--------PCDVMTLPGFEKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A + +      +   +LD CAAPGGKTA ++   SG++V A+D    RL+++  N
Sbjct: 227 VQDAAAQLSINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHEN 286

Query: 283 LDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL+L A+ ++  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI  
Sbjct: 287 LKRLNLQAK-VVCGDARHPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++     + +KPGG +V++ CS+  Q++ E V+  L
Sbjct: 346 LAALQSEIFDAMWTQLKPGGTMVYATCSITPQENVEQVKAFL 387


>gi|16762874|ref|NP_458491.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144361|ref|NP_807703.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213425783|ref|ZP_03358533.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213859535|ref|ZP_03385239.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289806045|ref|ZP_06536674.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|46396982|sp|Q8Z1X1|RSMB_SALTI RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|25303750|pir||AH1009 sun protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16505181|emb|CAD09177.1| sun protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139999|gb|AAO71563.1| sun protein [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
          Length = 429

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 223/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|15640076|ref|NP_229703.1| sun protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121587275|ref|ZP_01677048.1| sun protein [Vibrio cholerae 2740-80]
 gi|121727862|ref|ZP_01680921.1| sun protein [Vibrio cholerae V52]
 gi|147675284|ref|YP_001218368.1| sun protein [Vibrio cholerae O395]
 gi|153817606|ref|ZP_01970273.1| sun protein [Vibrio cholerae NCTC 8457]
 gi|227080281|ref|YP_002808832.1| sun protein [Vibrio cholerae M66-2]
 gi|298501227|ref|ZP_07011026.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           MAK 757]
 gi|46397040|sp|Q9KVU5|RSMB_VIBCH RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|9654437|gb|AAF93222.1| sun protein [Vibrio cholerae O1 biovar El Tor str. N16961]
 gi|121548521|gb|EAX58577.1| sun protein [Vibrio cholerae 2740-80]
 gi|121629806|gb|EAX62221.1| sun protein [Vibrio cholerae V52]
 gi|126511874|gb|EAZ74468.1| sun protein [Vibrio cholerae NCTC 8457]
 gi|146317167|gb|ABQ21706.1| sun protein [Vibrio cholerae O395]
 gi|227008169|gb|ACP04381.1| sun protein [Vibrio cholerae M66-2]
 gi|227011953|gb|ACP08163.1| sun protein [Vibrio cholerae O395]
 gi|297540099|gb|EFH76161.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae
           MAK 757]
          Length = 434

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 9   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 63

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 64  SISQALMGKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 122

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 123 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 182

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 183 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 243 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLELTA 302

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 303 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 361

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 362 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 399


>gi|168234465|ref|ZP_02659523.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|194470953|ref|ZP_03076937.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194457317|gb|EDX46156.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|205331616|gb|EDZ18380.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
          Length = 429

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 223/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|153821915|ref|ZP_01974582.1| sun protein [Vibrio cholerae B33]
 gi|254851609|ref|ZP_05240959.1| sun protein [Vibrio cholerae MO10]
 gi|126520535|gb|EAZ77758.1| sun protein [Vibrio cholerae B33]
 gi|254847314|gb|EET25728.1| sun protein [Vibrio cholerae MO10]
          Length = 434

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 9   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 63

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 64  SISQALMGKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 122

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 123 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 182

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 183 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 243 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLELTA 302

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 303 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 361

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 362 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 399


>gi|153830135|ref|ZP_01982802.1| sun protein [Vibrio cholerae 623-39]
 gi|254225568|ref|ZP_04919177.1| sun protein [Vibrio cholerae V51]
 gi|254291095|ref|ZP_04961892.1| sun protein [Vibrio cholerae AM-19226]
 gi|125621888|gb|EAZ50213.1| sun protein [Vibrio cholerae V51]
 gi|148874399|gb|EDL72534.1| sun protein [Vibrio cholerae 623-39]
 gi|150422940|gb|EDN14890.1| sun protein [Vibrio cholerae AM-19226]
          Length = 434

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 9   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 63

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 64  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 122

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 123 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 182

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 183 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 243 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 302

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 303 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 361

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 362 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 399


>gi|119471679|ref|ZP_01614064.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Alteromonadales
           bacterium TW-7]
 gi|119445458|gb|EAW26745.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Alteromonadales
           bacterium TW-7]
          Length = 431

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 127/416 (30%), Positives = 206/416 (49%), Gaps = 36/416 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R +++  L  V+ K  SL   L       A + L  +D+ L++ I    LR+L
Sbjct: 1   MNKVQNVRALAAETLYNVVDKGASLNQELPF-----ASQGLPPKDKALLQQICYGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P ++     ++ S L  K+   Q LL V + Q+ ++ V  +A +   V  A         
Sbjct: 56  PSLENYCQHLVESPLKGKRRIFQFLLYVGIYQLQHMRVPPHAAISETVN-ALGQMRALGL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE-RVLAISDACISP 175
             L+N+ILR   R++ EL ++   I +     P WF ++++  Y +    +   +   +P
Sbjct: 115 KGLINAILRSFQRQQAELEEKAKLIPVCLYNHPNWFIKQVKEAYPENWEAILEENQQQAP 174

Query: 176 L-------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
           +             Y D+    DIE   H LN   +   GI+L + P  + SLP F  G 
Sbjct: 175 MWLRVNQSQFSTQEYSDMLTANDIE---HTLNPNFI--DGIKLAK-PRDVFSLPEFDTGA 228

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRC 281
             VQDA+A +  +     ++  +LD CAAPGGKT  ++ ++ A V ALD    RLE+++ 
Sbjct: 229 CSVQDAAAQLAARFLEPKDDDVILDACAAPGGKTCHILELADADVLALDSDATRLERVKQ 288

Query: 282 NLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           NL R+ L A D+   DA     +   + FD +L+D PCS+TG IRRHPD+ W R   DI 
Sbjct: 289 NLTRIGLGA-DLQCGDASQPHTWWDDEQFDRILLDVPCSATGVIRRHPDIKWLRRASDIE 347

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             A  Q  +L      +KPGG +V++ CS+  +++++ + K L ++   VE +PL+
Sbjct: 348 DLAALQGDILNSIWPLLKPGGTLVYATCSVLPKENQQQIAKFLANND-DVEHIPLH 402


>gi|86147131|ref|ZP_01065447.1| Sun protein [Vibrio sp. MED222]
 gi|218711000|ref|YP_002418621.1| ribosomal RNA small subunit methyltransferase B [Vibrio splendidus
           LGP32]
 gi|85835015|gb|EAQ53157.1| Sun protein [Vibrio sp. MED222]
 gi|218324019|emb|CAV20381.1| Ribosomal RNA small subunit methyltransferase B [Vibrio splendidus
           LGP32]
          Length = 426

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 199/392 (50%), Gaps = 36/392 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ +SL  KK     L+ V + Q+ ++ +  +A V   VE A +       + L+
Sbjct: 56  SIANELMENSLKGKKRVFHHLILVGIYQLSFMRIPSHAAVAETVE-ATKTLRGPSLSGLI 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R++ EL ++     AG    P W  + L+  Y  +   L  ++   +P+   
Sbjct: 115 NAVLRSYLRDQEELDEKAVSHNAGKYSHPSWILKMLQESYPDQWEQLVEANNSKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y++L    +IE   H   A       I+L   P  +  LPGF  G   VQ
Sbjct: 175 VNRQHHTRDEYVELLKNENIEYTLHPEAA-----DAIKLAS-PCDVTLLPGFDRGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + V      +   +LD CAAPGGKTA ++      +V A+D   +RL+++  NL+
Sbjct: 229 DAAAQLSVDFLTPKDGELILDCCAAPGGKTAHILEHTQDTEVVAIDSDIKRLDRVYDNLE 288

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A D+I  DA    ++     FD +L+DAPCS+TG IRRHPD+ W R   DI   A
Sbjct: 289 RLQLRA-DVICGDARYPEEWWTGSQFDRILLDAPCSATGVIRRHPDIKWLRRASDIDALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
             Q ++L      +K GG +V++ CS+  Q++
Sbjct: 348 ELQSEILDAMWRQLKEGGTMVYATCSITPQEN 379


>gi|56415328|ref|YP_152403.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364258|ref|YP_002143895.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81360778|sp|Q5PIT6|RSMB_SALPA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493266|sp|B5BGV5|RSMB_SALPK RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|56129585|gb|AAV79091.1| sun protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|197095735|emb|CAR61305.1| sun protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
          Length = 429

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 223/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDTVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|218778410|ref|YP_002429728.1| sun protein [Desulfatibacillum alkenivorans AK-01]
 gi|218759794|gb|ACL02260.1| sun protein [Desulfatibacillum alkenivorans AK-01]
          Length = 455

 Score =  161 bits (407), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 141/474 (29%), Positives = 222/474 (46%), Gaps = 82/474 (17%)

Query: 20  RKRISLTCLLD-LEYGDSAFRL-----------LSQRDQILVRAIVNVTLRFLPRIDAVL 67
           + RI+   +LD LE GD    +           L+++D+ LV A+V   LR   RID ++
Sbjct: 9   KSRITAARILDRLESGDQVLDVVLDRALDKEPGLTRKDRALVMALVYGVLRNRGRIDWII 68

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNS 126
                + L + +  +  +LR+ V Q+L+LD V     VD +VE AK+       +K VN 
Sbjct: 69  SSFSKTKLKKIQPEILNILRMGVFQLLFLDRVPPALAVDSSVEMAKK-AAPVFVSKFVNG 127

Query: 127 ILRRVSREKIEL---------LQRIAGISIIPEWFKERLENFYGKERVLAISDAC--ISP 175
           +LR V R+   L         L+ I      PEW  +R    +G E  L +  A   I+P
Sbjct: 128 LLRNVERKGRGLQLPDFAKDPLKAICVAESYPEWMVKRWIKRFGAEETLELCKAGNRIAP 187

Query: 176 LYI-----------------DLTVKFDIETW---AHKLNAVMLPTGGIRLKELPESIVSL 215
           + I                 D     ++  W   A   +A ++P            +  L
Sbjct: 188 ITIRVNSLAATRDEAADEIRDQVKNLELHDWPPMALSFSAPLVP------------VFEL 235

Query: 216 PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVS 272
           PGF+EG + VQDA++ +            VLD CA  G KT   AQL+ +  ++ A D+ 
Sbjct: 236 PGFSEGKFSVQDAASQMTALCLDPRPGEKVLDACAGLGSKTSHIAQLMENTGEILAADLE 295

Query: 273 KRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK-----KLFDAVLVDAPCSSTGTIRRHPD 327
             +L+KL   + RL +    I++  A D+  +     + FD VLVDAPC+  G IRR+PD
Sbjct: 296 PGKLKKLEEEMARLKV---SIVKTHALDFTRELSLEPQGFDKVLVDAPCTGLGVIRRNPD 352

Query: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-I 386
             W++  + I K A  Q  +L +    V+PGG++++S CS++ ++++ V++  LR++   
Sbjct: 353 SKWSKTLNSIHKHAKLQGMILSRAAELVRPGGLILYSVCSMEPEETDGVIKAFLRNNEDF 412

Query: 387 PVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +E  PL     K  D  M L  +G +R  P           GMDGFFA  +RR
Sbjct: 413 TLEPSPLP----KDGDQTM-LDEQGCMRTFPH--------RQGMDGFFAARMRR 453


>gi|218439986|ref|YP_002378315.1| sun protein [Cyanothece sp. PCC 7424]
 gi|218172714|gb|ACK71447.1| sun protein [Cyanothece sp. PCC 7424]
          Length = 452

 Score =  161 bits (407), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 123/425 (28%), Positives = 206/425 (48%), Gaps = 43/425 (10%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L   D+ LV  +V   +R    +D ++  +      ++   L+ +L + + Q+ YLD + 
Sbjct: 39  LGNLDRGLVTELVYGIVRRQRTLDEIISQLGTKKANQQPPDLRLILHIGLYQLRYLDQIP 98

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE----------LLQRIAGISIIP 149
             A V+ +VE AK++K  +  + +VN ILR+  R K +           +  +  +   P
Sbjct: 99  PSAAVNTSVELAKKNKLGK-LSGVVNGILRQYDRIKEQGKDPLKFPSDPVNHLGVLHSFP 157

Query: 150 EWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELP 209
            W  +   + +G+E+   + +    P  ID+ V   ++T   K+ A +    G+++K +P
Sbjct: 158 NWIIQLWLDEFGQEQTEQLCEWFNQPAMIDIRVNL-LKTTVEKV-ASIFSDVGVKVKPIP 215

Query: 210 E------------SIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT- 256
                        SI  LPGF EG W VQD+SA +   L     +  ++D CAAPGGKT 
Sbjct: 216 HLPQSLRLIGGTRSIQQLPGFEEGWWTVQDSSAQLVTHLLDPQPDEIIIDACAAPGGKTT 275

Query: 257 --AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVD 313
             AQL+     + A D    RL K++ N +RL L +  I E D+      ++  D VL+D
Sbjct: 276 HIAQLMGDRGTIWACDRVPSRLRKVQQNAERLQLNSIRICEGDSRHLTQFRETADRVLLD 335

Query: 314 APCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
           APCS  GT+ + PD+ W +  + I + +  Q +LL +  ++VKP GI+V++ C+L+  ++
Sbjct: 336 APCSGLGTLHKRPDIRWRQTPEKIAELSQLQTELLEETATWVKPKGILVYATCTLNPLEN 395

Query: 374 EEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGF 433
           E V+   L   P      P +        +A   +P GWI++ P   +        MDGF
Sbjct: 396 ERVIAAFLDRHPSWHIQTPSSDNT-----VAAFATPSGWIKVLPHQHQ--------MDGF 442

Query: 434 FAVAL 438
           F V L
Sbjct: 443 FMVKL 447


>gi|146313354|ref|YP_001178428.1| 16S rRNA methyltransferase B [Enterobacter sp. 638]
 gi|224493252|sp|A4WF97|RSMB_ENT38 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|145320230|gb|ABP62377.1| 16S rRNA m(5)C-967 methyltransferase [Enterobacter sp. 638]
          Length = 428

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 115/365 (31%), Positives = 190/365 (52%), Gaps = 27/365 (7%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           +S +D+ L++ +    LR LP+ + ++  ++   +  K+ ++  L+ V   Q+L+  +  
Sbjct: 35  VSDKDKALLQELCFGVLRTLPQQEWLISKLMSRPMTGKQRTIHYLIMVGFYQLLHTRIPP 94

Query: 101 YAVVDLAVEQA---KRDKENRHFAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKE 154
           +A +   VE A   KR +       L+N +LR+  R++ ELL   A      + PEW  +
Sbjct: 95  HAALAETVEGAVVIKRPQ----LKGLINGVLRQFQRQQEELLAEFADSDKRFLHPEWLLK 150

Query: 155 RLENFY-GKERVLAISDACISPLYIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRL 205
           RL+  Y  K   +  ++    P+++ +       + W   L    +           IRL
Sbjct: 151 RLQKAYPSKWEAIVEANNQRPPMWLRVNRNHHTRDEWLALLETAEMNGFTHDAYPDAIRL 210

Query: 206 KELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSG 263
              P  + +LPGF +G   VQDASA   +      N   +LDLCAAPGGKT  +  I   
Sbjct: 211 AS-PAPVQALPGFEQGWVTVQDASAQGCMTYLEPQNGDHILDLCAAPGGKTTHILEIAPK 269

Query: 264 AKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTG 320
           A V A+DV ++RL ++  NL RL + AE + + D     ++C  + FD +LVDAPCS+TG
Sbjct: 270 ASVMAVDVDEQRLSRVYDNLKRLGMKAE-VKQGDGRTPGEWCGDEQFDRILVDAPCSATG 328

Query: 321 TIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQK 379
            IRRHPD+ W R   DI + A  Q ++L      +KPGG +V++ CS L +++S+++   
Sbjct: 329 VIRRHPDIKWLRRDRDINELAQLQSEILDAVWPHLKPGGTLVYATCSVLPEENSQQIAAF 388

Query: 380 VLRSS 384
           + R+S
Sbjct: 389 LKRTS 393


>gi|304415449|ref|ZP_07396098.1| 16S rRNA m5C967 methyltransferase (SAM-dependent) [Candidatus
           Regiella insecticola LSR1]
 gi|304282713|gb|EFL91227.1| 16S rRNA m5C967 methyltransferase (SAM-dependent) [Candidatus
           Regiella insecticola LSR1]
          Length = 390

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 116/369 (31%), Positives = 196/369 (53%), Gaps = 33/369 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++ +++ V+ K  SL+ +L      +  + +S +D+ L++ +   TLR L
Sbjct: 1   MKTTYNIRAIAAKVINNVLNKGKSLSVVLP-----ALQQNISDKDRTLLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P ++  +  +++  +  KK  L  LL + + Q++Y  +  +A +   V  A   K  +  
Sbjct: 56  PTLEFCIQQLMVRPMEGKKRILHYLLMIGIYQLIYTRIPAHAALAETVAGATTLKWPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             LVN +LR+  R++I LL++    +   + P W  ER++  Y ++ + + +++    P+
Sbjct: 115 KGLVNGVLRQFQRQQIMLLEQATNDNSHYLHPNWLLERIKKAYPEQWQQIVVANNTKPPM 174

Query: 177 -------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y+ L  +  IE  +H + A       IRL  LP  +  LPGF++G  
Sbjct: 175 WLRVNRIHHSRSQYLALLQQAGIEAISHPVYA-----DAIRL-TLPCPVGQLPGFSQGWV 228

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRC 281
            VQDASA   + L    N   +LDLCAAPGGKT  +  +   A+V A+D+ K+RL  ++ 
Sbjct: 229 TVQDASAQGCIDLLHPKNGEYILDLCAAPGGKTTYILEVAPKAEVLAVDIDKQRLRCVKE 288

Query: 282 NLDRLHLYAE-DIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           NL RL L A   I +    D +C ++LFD +L+DAPCS+TG IRRHPD+ W R   DI +
Sbjct: 289 NLQRLQLQARIKIGDGRTPDIWCGEQLFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAE 348

Query: 340 SACFQRKLL 348
               Q +++
Sbjct: 349 LTKLQAEIM 357


>gi|229520215|ref|ZP_04409642.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae TM
           11079-80]
 gi|229342809|gb|EEO07800.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae TM
           11079-80]
          Length = 426

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 201/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE   +D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVE-GTQDLKGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 235 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 391


>gi|285019616|ref|YP_003377327.1| tRNA and rRNA cytosine-c5-methylase [Xanthomonas albilineans GPE
           PC73]
 gi|283474834|emb|CBA17333.1| putative trna and rrna cytosine-c5-methylase protein [Xanthomonas
           albilineans]
          Length = 437

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 123/356 (34%), Positives = 181/356 (50%), Gaps = 26/356 (7%)

Query: 44  RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAV 103
           RD+ LV AI    LR  P  +A L   L   LP++   L+ LL    AQ+  L +A +A 
Sbjct: 46  RDRALVEAICFAVLRRRPAYEAALRLWLQKQLPQRDAELRALLLAGFAQLDVLGLAPHAA 105

Query: 104 VDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKE 163
           +   VE A R  E    A LVN++LRR  R+ +  +   AG    P W ++ +   +  E
Sbjct: 106 LSATVE-ATRALERPRQAGLVNALLRRALRDGLPEVPADAGW---PLWLRDAVCADW-PE 160

Query: 164 RVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLK---------ELPESIVS 214
           +  AI  A   P  + L V     T A  L A+       +            +P ++ +
Sbjct: 161 QAEAIFAASQQPAPLWLRVNRQRGTRATYLQALADAGIAAQAASALADAVCLHVPMAVSA 220

Query: 215 LPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV--TALDVS 272
           LPGFAEG   VQDASA     +        VLD CAAPGGK+A L+     +  TALDV 
Sbjct: 221 LPGFAEGWVSVQDASAQQVADVLAPAPGARVLDACAAPGGKSAHLLERDPTLCLTALDVD 280

Query: 273 KRRLEKLRCNLDRLHLYAEDIIEM-DA------FDYCPKKLFDAVLVDAPCSSTGTIRRH 325
            RRL+++R   +R+    +  +++ DA      +D  P   FDAVL+DAPCS+TG +RR 
Sbjct: 281 ARRLQRVRETFERIGSGTQARLQVADAAQPQTWWDGVP---FDAVLLDAPCSATGIVRRQ 337

Query: 326 PDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           PDVL  R  +D++     Q +LL  G   ++PGG++V++ CSL + ++   +Q +L
Sbjct: 338 PDVLLHRRGEDLIALQALQARLLDAGWQVLRPGGVLVYATCSLLQDENARQLQALL 393


>gi|238913877|ref|ZP_04657714.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 429

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 131/457 (28%), Positives = 221/457 (48%), Gaps = 50/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    +           +RL E P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                  
Sbjct: 353 QAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP------------------ 394

Query: 404 AMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
             ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|54310619|ref|YP_131639.1| putative Sun protein [Photobacterium profundum SS9]
 gi|46915062|emb|CAG21837.1| Putative Sun protein [Photobacterium profundum SS9]
          Length = 431

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 119/394 (30%), Positives = 202/394 (51%), Gaps = 24/394 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L      +A + + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAAQVVFQVVDQGQSLSAALP-----AAQQNIRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+ +   L+ V + Q+ ++ +  +A V   V  A +D +      L+
Sbjct: 56  SITTHLMDKPLKGKQRAFHHLILVGLYQLGHMRIPAHAAVAETVN-ATKDLKKTQLRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N+ILR   R++ +L    +   AG    P W  + L+  Y ++   +  ++   +P+++ 
Sbjct: 115 NAILRNYQRQQEQLDAQSVSHDAGKYGHPSWLLKMLKASYPEQLEAIVTANNTKAPMWLR 174

Query: 180 LTVKFDI-ETWAHKLNAV-----MLPTGGIRLKEL-PESIVSLPGFAEGVWWVQDASASI 232
           +  +    + +   LN V     + P     L+ L P  +  LPGFA+G   VQD +A +
Sbjct: 175 VNRQHHTRDEYRALLNDVGIETDLHPEAADALRLLSPCDVSKLPGFADGWSSVQDGAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            V          +LD CAAPGGKTA ++     AKV A+D  +RRL ++  NL RL L A
Sbjct: 235 AVDFLQPQAGELILDCCAAPGGKTAHIMERQPTAKVVAIDCDERRLTRVYENLARLKLDA 294

Query: 291 EDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
             ++  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R   DI   A  Q ++
Sbjct: 295 T-VLCADARYPADWWHGEKFDRILLDAPCSATGVIRRHPDIKWLRRASDIEALAILQAEI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
                  +K GG +V++ CS+  Q++ E V+  L
Sbjct: 354 FDAMWLQLKSGGTLVYATCSITPQENSEQVKAFL 387


>gi|120552984|ref|YP_957335.1| sun protein [Marinobacter aquaeolei VT8]
 gi|120322833|gb|ABM17148.1| 16S rRNA m(5)C-967 methyltransferase [Marinobacter aquaeolei VT8]
          Length = 433

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 137/447 (30%), Positives = 206/447 (46%), Gaps = 52/447 (11%)

Query: 21  KRISLTCLLDLEYGDS-------AFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLIS 73
           + I+   LL +E G S       A   L    +  ++AI   T R+  R++  L+  L  
Sbjct: 9   RAIAANVLLAVEQGQSLSQCLPPALNQLPPEQRPQLQAICYGTCRWFHRLEGELNQRLKK 68

Query: 74  SLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSR 133
            L +    +  L+ V++ Q+ Y + A YAV++  VE A R  +  H   LVN +LR   R
Sbjct: 69  PLRKPDRIIHHLMLVALFQLRYSEQATYAVLNETVE-ACRALDKPHLTGLVNGVLRAAER 127

Query: 134 EKIELLQRIAGISIIPEWFKERL-ENFYGKERVLAISDACISPL-------------YID 179
           E     +  +G    P W  E+L  N+ G  + +  ++   +P+             Y+ 
Sbjct: 128 EGAPEPKDDSGRFSHPAWMVEKLRHNWPGYWQTILEANNQQAPMTLRVNALRFKRDEYLK 187

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
           L  +  IE      +A      GI+L E P  +  LP F +G   VQD +A +   L   
Sbjct: 188 LLSEAGIEA-----HATRFAPNGIQL-ERPVPVDRLPWFEDGAASVQDEAAQLCTTLLDL 241

Query: 240 LNNLSVLDLCAAPGGKTAQLI-VSGA--KVTALDVSKRRLEKLRCNLDRLHLYAEDIIEM 296
                VLD CAAPGGKT  ++   GA  +V A+D S  RL +++ NLDRL L+A  + + 
Sbjct: 242 QPGQRVLDACAAPGGKTCAILEACGALDEVVAIDESAERLPRVQENLDRLDLHAT-LTQA 300

Query: 297 DAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           DA D   +     FD +L+D PCS+TG IRRHPD+   R   DIV  A  Q  LL    S
Sbjct: 301 DAADIDSWWDGTPFDRILLDVPCSATGVIRRHPDIKLLRRESDIVPLASIQLGLLEAMWS 360

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWI 413
            +KPGG +V++ CS+  Q++  ++Q+ L+           N A  K I+           
Sbjct: 361 ILKPGGRLVYATCSVFPQENHRIIQRFLKQQ---------NQATLKCIEADWGRDMNTGR 411

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRR 440
           ++ PD            DGFF   L +
Sbjct: 412 QLFPD--------PDSHDGFFYAVLEK 430


>gi|168239759|ref|ZP_02664817.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194736151|ref|YP_002116352.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|224493267|sp|B4TXB2|RSMB_SALSV RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194711653|gb|ACF90874.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197287575|gb|EDY26967.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 429

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 224/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT+ +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTSHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|162148166|ref|YP_001602627.1| ribosomal RNA small subunit methyltransferase B [Gluconacetobacter
           diazotrophicus PAl 5]
 gi|161786743|emb|CAP56326.1| putative ribosomal RNA small subunit methyltransferase B
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 433

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 128/389 (32%), Positives = 189/389 (48%), Gaps = 32/389 (8%)

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
           LR +     VL+  L    P     ++ +L + VAQIL+LD   +A V  AV  A+R + 
Sbjct: 71  LRHMGTAGMVLEPFLKKEPP---LPVRTVLLIGVAQILFLDTPAHAAVGTAVSLARR-RG 126

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLA--ISDACI 173
              FA LVN++LRRV++     L+ +    + +P W        +G    LA  +++A  
Sbjct: 127 LVPFAGLVNAVLRRVAQAGAGALEGLDQARLDVPPWL-------WGAWGSLARPVAEALG 179

Query: 174 SPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
               +DLT++  +         VMLPTG +RL      +  LPG+A+G +WVQDA+A++P
Sbjct: 180 QEAPLDLTLRPGLPEAERPPGGVMLPTGTLRLPAG-TRVADLPGYAQGAFWVQDAAAALP 238

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE-D 292
            +L        + DLCAAPGGKTAQL V+GA+VTA++    RL +L+ N           
Sbjct: 239 ARLLAPRAGERIADLCAAPGGKTAQLAVAGAEVTAIEREPGRLARLKENWTASDWPTGCK 298

Query: 293 IIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
           +++ DA  + P    DAVL+DAPCS+TGT  RHPDVLW +       +    R+     +
Sbjct: 299 LVQGDAATWRPDAPLDAVLLDAPCSATGTAHRHPDVLWIKRPRLTALTEGQDRRRATCCV 358

Query: 353 SFVKPGGIV-VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEG 411
               P G+  V +                L   P   E + +         +  AL+ EG
Sbjct: 359 PC--PAGLCGVLAPARRRAGTRTRGRGDGLEPDPFTAEELAV---------LPEALTKEG 407

Query: 412 WIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           W+R  P +  +      GMDGFFA   RR
Sbjct: 408 WLRTHPGLWTE----QGGMDGFFAARFRR 432


>gi|153802771|ref|ZP_01957357.1| sun protein [Vibrio cholerae MZO-3]
 gi|124121684|gb|EAY40427.1| sun protein [Vibrio cholerae MZO-3]
          Length = 434

 Score =  160 bits (406), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 9   MNVRAAAASALYQVVDLGHSLSDALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 63

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 64  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 122

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 123 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 182

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 183 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 243 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 302

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 303 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 361

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 362 LDAMWQQLKPGGSLVYATCSITPQENRLQVKAFLERTP 399


>gi|330447314|ref|ZP_08310964.1| ribosomal RNA small subunit methyltransferase B [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491505|dbj|GAA05461.1| ribosomal RNA small subunit methyltransferase B [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 426

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/395 (30%), Positives = 200/395 (50%), Gaps = 26/395 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L     D     + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRATAAKVIYQVVDQGQSLSAALPAAQQD-----IRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    L+
Sbjct: 56  SITQALMDKPLKGKQRVFHHLILVGLYQLGYMRIPAHAAVAETVNATKTLKKPQ-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKERVLAISDA--CISPLYI 178
           N+ILR   R++ EL    +   AG    P W  + L+  Y  E+  AI +A    +P+++
Sbjct: 115 NAILRNYQRQQEELDAKAISHDAGKLGHPSWLLKLLKESY-PEQFEAICEANNTKAPMWL 173

Query: 179 DLTVKFDIETW------AHKLNAVMLPTGGIRLKEL-PESIVSLPGFAEGVWWVQDASAS 231
            +  + +          A  +   + P     L+ L P  +  LPGF++G   VQDA+A 
Sbjct: 174 RVNRQHNTRDAYRALLDAEGIATELHPQAADALRLLSPCDVTKLPGFSDGWVSVQDAAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
           + V          +LD CAAPGGKTA ++  V   KV A+D  + RL+++  NL RL+L 
Sbjct: 234 LAVDYLQPQAGELILDCCAAPGGKTAHIMEHVPSTKVVAIDCDENRLKRVHENLARLNLD 293

Query: 290 AEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
           A  ++  DA     +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q +
Sbjct: 294 AT-VLCADARYPEQWWKGDKFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALATLQAE 352

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           +       +KPGG +V++ CS+  Q++ + V+  L
Sbjct: 353 IFDAMWLQLKPGGTLVYATCSITPQENCDQVKAFL 387


>gi|206577662|ref|YP_002236309.1| ribosomal RNA small subunit methyltransferase B [Klebsiella
           pneumoniae 342]
 gi|224493255|sp|B5XNC2|RSMB_KLEP3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|206566720|gb|ACI08496.1| ribosomal RNA small subunit methyltransferase B [Klebsiella
           pneumoniae 342]
          Length = 431

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 210/402 (52%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNKINLRSLAAQAIEQVIEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLVEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVDANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLKEAGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLLPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L      +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNSTWEHLKPGGTLVYATCSILPEENSQQISAFLARTP 394


>gi|148978298|ref|ZP_01814803.1| Sun protein [Vibrionales bacterium SWAT-3]
 gi|145962457|gb|EDK27735.1| Sun protein [Vibrionales bacterium SWAT-3]
          Length = 426

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/392 (30%), Positives = 202/392 (51%), Gaps = 36/392 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +S RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSHALP-----AAQKTISPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ + L  KK     L+ V + Q+ ++ +  +A V   VE  K  +     + L+
Sbjct: 56  SIANELMENPLKGKKRVFHHLILVGIYQLSFMRIPSHAAVAETVEGTKTLR-GPSLSGLI 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R++ EL ++     AG    P W  + L+  Y ++   L  ++   +P+   
Sbjct: 115 NAVLRSYLRDQEELDEKAVSHNAGKYGHPSWILKMLQESYPEQWEQLIEANNSKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y++L    +IE   H   A       I+L   P  +  LPGF +G   VQ
Sbjct: 175 VNRQHHTRDEYVELLKNENIEYTLHSEAA-----DAIKLAS-PCDVTLLPGFDKGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + V      +   +LD CAAPGGKTA ++   +  +V A+D   +RL+++  NL+
Sbjct: 229 DAAAQLSVDYLTPKDGELILDCCAAPGGKTAHILEHTNDTEVVAIDCDIKRLDRVYDNLE 288

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A D+I  DA    ++     FD +L+DAPCS+TG IRRHPD+ W R   DI   A
Sbjct: 289 RLQLRA-DVICGDARYPEEWWMGDKFDRILLDAPCSATGVIRRHPDIKWLRRASDIEALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
             Q +++      +K GG +V++ CS+  Q++
Sbjct: 348 ELQSEIMDAMWRQLKEGGTMVYATCSITPQEN 379


>gi|84393439|ref|ZP_00992196.1| Sun protein [Vibrio splendidus 12B01]
 gi|84375955|gb|EAP92845.1| Sun protein [Vibrio splendidus 12B01]
          Length = 426

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 199/392 (50%), Gaps = 36/392 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ +SL  KK     L+ V + Q+ ++ +  +A V   VE A +       + L+
Sbjct: 56  SIANELMENSLKGKKRVFHHLILVGIYQLSFMRIPSHAAVAETVE-ATKTLRGPSLSGLI 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R++ EL ++     AG    P W  + L+  Y  +   L  ++   +P+   
Sbjct: 115 NAVLRSYLRDQEELDEKAVSHNAGKYSHPSWILKMLQESYPDQWEQLVEANNNKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y++L    +IE   H   A       I+L   P  +  LPGF  G   VQ
Sbjct: 175 VNRQHHTRDEYVELLKNENIEYTLHPEAA-----DAIKLAS-PCDVTLLPGFDRGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + V      +   +LD CAAPGGKTA ++      +V A+D   +RL+++  NL+
Sbjct: 229 DAAAQLSVDFLTPKDGELILDCCAAPGGKTAHILEHTQDTEVVAIDSDIKRLDRVYDNLE 288

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A D+I  DA    ++     FD +L+DAPCS+TG IRRHPD+ W R   DI   A
Sbjct: 289 RLQLRA-DVICGDARYPEEWWTGSQFDRILLDAPCSATGVIRRHPDIKWLRRASDIDALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
             Q ++L      +K GG +V++ CS+  Q++
Sbjct: 348 ELQSEILDAMWRQLKEGGTMVYATCSITPQEN 379


>gi|168823234|ref|ZP_02835234.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205354964|ref|YP_002228765.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858650|ref|YP_002245301.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224493261|sp|B5R1E5|RSMB_SALEP RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493262|sp|B5RH47|RSMB_SALG2 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|205274745|emb|CAR39801.1| sun protein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205340499|gb|EDZ27263.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|206710453|emb|CAR34811.1| sun protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326630113|gb|EGE36456.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 429

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 131/457 (28%), Positives = 221/457 (48%), Gaps = 50/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    +           +RL E P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                  
Sbjct: 353 QAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP------------------ 394

Query: 404 AMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
             ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|297570244|ref|YP_003691588.1| sun protein [Desulfurivibrio alkaliphilus AHT2]
 gi|296926159|gb|ADH86969.1| sun protein [Desulfurivibrio alkaliphilus AHT2]
          Length = 501

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 134/453 (29%), Positives = 201/453 (44%), Gaps = 68/453 (15%)

Query: 43  QRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADY 101
           +RD+ LVRA+V   LR    +D V+       L + K      LR+ +AQ+LY D +   
Sbjct: 52  RRDRQLVRALVYEVLRRRGFLDHVVARYAKHPLAKMKPLTLAALRLGLAQLLYFDRLPPA 111

Query: 102 AVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISI----IPEWFKERLE 157
           A +D  +   K  ++ R     VN +LR  +RE+ ELL R+A        +P W ++R E
Sbjct: 112 AAIDETIRALKAARQPRWITGFVNGLLRNAARERAELL-RLAAEQCDWLSVPAWLRQRRE 170

Query: 158 NFYGKERVLAISDACISPLYIDL---TVKFDIETWAHKL--NAV-----MLPTGGIRLKE 207
              G+ER    S A   P  + L   T K +  T A +L  N +           +RL  
Sbjct: 171 QQLGQERAYHRSRAENQPPPLVLRVNTAKINCATLAEQLQHNGIEVEESTFAPAALRLPS 230

Query: 208 LPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLS----VLDLCAAPGGKTA---QLI 260
               +  LPGF EG + VQD +A +   L     +       LD CA  GGKTA   +L+
Sbjct: 231 YHGRVEELPGFNEGWFAVQDEAAQLVTMLLQKEPDPEPGALFLDACAGLGGKTAHLAELL 290

Query: 261 VSGAKVTALDVSKRRLEKLRCNLDRL------------------HLYAEDIIEMDAFDYC 302
            + +++ AL+    R   L  NL RL                   L      +      C
Sbjct: 291 PAESRLVALEPHTGRFALLAENLARLGHKFFKLPPDGPPEELARRLQTAAAGKPAPLLLC 350

Query: 303 PKKL---------------FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           P+ L               F  +L+DAPCS  G +RRHPD+ W R  +D+ +    Q  L
Sbjct: 351 PQTLASFARLLDSASVAPAFQGILLDAPCSGLGVVRRHPDIRWNRQPEDLPRYCKQQIAL 410

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L Q    + PGG++V++ CS + +++ EV+Q +    P   EL   +   W     A  +
Sbjct: 411 LDQAAKLLAPGGVLVYAVCSNEPEENREVIQALTSRHP---ELEVTDPRPWLPPPAATLV 467

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             EG++R TP+         +G+DGFFA  L+R
Sbjct: 468 DDEGYLRSTPE---------TGLDGFFAARLQR 491


>gi|62181914|ref|YP_218331.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|168264711|ref|ZP_02686684.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|224585203|ref|YP_002639002.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75480382|sp|Q57J62|RSMB_SALCH RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766862|sp|C0PZV1|RSMB_SALPC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|62129547|gb|AAX67250.1| putative rRNA methylase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|205346881|gb|EDZ33512.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|224469731|gb|ACN47561.1| sun protein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|322716400|gb|EFZ07971.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 429

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 131/458 (28%), Positives = 223/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|288933298|ref|YP_003437357.1| sun protein [Klebsiella variicola At-22]
 gi|288888027|gb|ADC56345.1| sun protein [Klebsiella variicola At-22]
          Length = 431

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 210/402 (52%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNKINLRSLAAQAIEQVIEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLVEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVDANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLKEAGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLLPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L      +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNATWEHLKPGGTLVYATCSILPEENSQQISAFLARTP 394


>gi|168245235|ref|ZP_02670167.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168468035|ref|ZP_02701872.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194447684|ref|YP_002047433.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|200388990|ref|ZP_03215602.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|224493263|sp|B4TJX9|RSMB_SALHS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194405988|gb|ACF66207.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|195628892|gb|EDX48302.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|199606088|gb|EDZ04633.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205336021|gb|EDZ22785.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
          Length = 429

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 131/457 (28%), Positives = 221/457 (48%), Gaps = 50/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    +           +RL E P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                  
Sbjct: 353 QAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP------------------ 394

Query: 404 AMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
             ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|16766697|ref|NP_462312.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167995183|ref|ZP_02576273.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|46396986|sp|Q8ZLM5|RSMB_SALTY RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|16421964|gb|AAL22271.1| putative rRNA methylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205327090|gb|EDZ13854.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|261248565|emb|CBG26403.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995617|gb|ACY90502.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159951|emb|CBW19470.1| 16S rRNA methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914431|dbj|BAJ38405.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321226460|gb|EFX51510.1| Ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323131766|gb|ADX19196.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990260|gb|AEF09243.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 429

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 131/457 (28%), Positives = 221/457 (48%), Gaps = 50/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    +           +RL E P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                  
Sbjct: 353 QAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP------------------ 394

Query: 404 AMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
             ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|71278391|ref|YP_266800.1| sun protein [Colwellia psychrerythraea 34H]
 gi|71144131|gb|AAZ24604.1| sun protein [Colwellia psychrerythraea 34H]
          Length = 440

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 128/422 (30%), Positives = 211/422 (50%), Gaps = 43/422 (10%)

Query: 44  RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAV 103
           +D+ L++ I    LR+LP ++  +  ++   +  K+     LL V V QI Y+ + D+A 
Sbjct: 37  KDKGLLQEICYGVLRYLPELENDVSQLVQKPIKGKQRVFHFLLLVGVYQIRYMRIPDHAA 96

Query: 104 VDLAVEQAKRDKENRHFAKLVNSILRRVSRE-KIELLQRIAGISIIPE--------WFKE 154
           V   V   K  K N H   LVN++LR   R  + E  Q       IP+        WF +
Sbjct: 97  VSETVAATKTLK-NDHMKGLVNAVLRGFLRALEAENKQVNKTDKKIPDPIKYNHPGWFIK 155

Query: 155 RLENFYGKERVLAISDACIS--PLYIDLTVKFD--------IETWAHKLNAVMLPTGGIR 204
           +++  Y  ++  AI DA     P+++ +  +          +E    ++  V   +  I 
Sbjct: 156 KIQQAYS-DQWQAILDANQQKPPMWLRVNQQHHTSEQYQALLEEAEIEIAHVEPNSQAIE 214

Query: 205 LKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG- 263
           L + P  +  LPGF +G   +QD +A    +L     N  VLD CAAPGGKT  +I    
Sbjct: 215 LAK-PLDVAKLPGFDDGWVSIQDGAAQQAARLLDCQPNDIVLDCCAAPGGKTCHIIEQTP 273

Query: 264 --AKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSST 319
             A +TA+D+ + RL ++  NLDRL+L A ++I  DA   ++   + FD +L+DAPCS T
Sbjct: 274 DIASMTAIDIEEGRLTRVHENLDRLNLTA-NVITADAATQNWWSGEQFDRILLDAPCSGT 332

Query: 320 GTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQK 379
           G IRRHPD+ W R  DDI K    Q+++L    S +KPGG ++++ CS+  +++   + +
Sbjct: 333 GVIRRHPDIKWLRKADDIDKLVVLQQQILDNIWSLLKPGGTLLYATCSVLPEENSLQISR 392

Query: 380 VLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
            +  +    +L+ +N    ++   A+     GW ++ PD        +  MDGF+   L 
Sbjct: 393 FIEQNQ-DAQLIAINGNTPETDKNAI-----GW-QLLPD--------AENMDGFYYAKLL 437

Query: 440 RL 441
           +L
Sbjct: 438 KL 439


>gi|52426258|ref|YP_089395.1| Sun protein [Mannheimia succiniciproducens MBEL55E]
 gi|52308310|gb|AAU38810.1| Sun protein [Mannheimia succiniciproducens MBEL55E]
          Length = 470

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/369 (32%), Positives = 187/369 (50%), Gaps = 31/369 (8%)

Query: 44  RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAV 103
           +D  L++ I     R LPR++ ++  ++   L  K   +  LL V + QILY  +  +A 
Sbjct: 63  QDLPLLQEICFGVCRVLPRLEQIIKKLVDKPLKGKTRIVHCLLLVGLYQILYTRIPAHAA 122

Query: 104 VDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAG--ISIIPEWFKERLENFYG 161
           VD  V  A    ++ +F  LVN +LRR  RE+ E+L  +     ++ PEWF  +L+  Y 
Sbjct: 123 VDEVVN-ATSALKSENFRGLVNGVLRRFLREQQEILAVVDKNWQTLHPEWFVNKLKKAYP 181

Query: 162 KERVLAISDACISPLYIDLTVKF-DIETW------AHKLNAVMLPT-GGIRLKELPESIV 213
             R +  ++    P++I +  +    E +        +L++        +RL + P ++ 
Sbjct: 182 NWREIIEANNQKPPMWIRVNQQLCTTENYRTLLLTEQELDSFKDENPNALRLAQ-PTAVQ 240

Query: 214 SLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDV 271
           +LP F EG   VQD  A     L    N   +LD CAAPGGKT  ++     AKV ALDV
Sbjct: 241 NLPHFTEGWVTVQDVHAQWSALLLEAKNGDLILDACAAPGGKTTHILELAPQAKVIALDV 300

Query: 272 SKRRLEKLRCNLDRLH----LYAEDIIEMDAFDYCPKKL-----------FDAVLVDAPC 316
            + RL ++  NL RL+    L   D  + D  D+ P              FD +L+DAPC
Sbjct: 301 EQSRLNRVAENLARLNQQAVLICGDATKPD--DWLPNAAERLIGKKTDLQFDRILLDAPC 358

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           S+TG IRRHPD+ W R   DI + A  Q+++L      +KP GI++++ CSL  Q++ E 
Sbjct: 359 SATGVIRRHPDIKWLRQEQDIGQLAALQQQILTALWKKLKPNGILLYATCSLLPQENSEQ 418

Query: 377 VQKVLRSSP 385
           ++  L ++P
Sbjct: 419 IRTFLANTP 427


>gi|212211692|ref|YP_002302628.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii CbuG_Q212]
 gi|212010102|gb|ACJ17483.1| 16S rRNA m(5)C 967 methyltransferase [Coxiella burnetii CbuG_Q212]
          Length = 430

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 128/419 (30%), Positives = 218/419 (52%), Gaps = 50/419 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ L++ V++K+ SLT LL            ++ +Q L++ +   TLR+  ++ 
Sbjct: 1   MNTRATAAILVNQVVQKKRSLTALLSA----------NKNNQSLIQELCYGTLRWYFKLK 50

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK-L 123
            + + +L + L  K + +  L+     Q+ YL++  + +V+  V  A+  K  + +AK L
Sbjct: 51  FIAEKLLHAPLRDKDHDIFCLILTGFYQLNYLNIPTHTIVNQTVGAAEILK--KPWAKGL 108

Query: 124 VNSILRRVSREKIELL----QRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYI 178
           +N +LRR   EK EL     + I G    P WF + ++  +      + I++    P+  
Sbjct: 109 INKLLRRFIAEKDELFTFTEKTIEGQYAHPLWFIQHIKKAWPDHWESILIANNARPPM-- 166

Query: 179 DLTVKFDIETWAHKLNAVMLPTGGIRLK-----------ELPESIVSLPGFAEGVWWVQD 227
             T++ ++   + ++   ML    I  K           E P S+  LPGF EG  ++QD
Sbjct: 167 --TLRVNLTKISREIYLEMLDQKNISAKPLDFLPAAIQLEKPCSVHQLPGFNEGYCYIQD 224

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCNLD 284
           A+      L    NN +VLD CAAPG KT+ ++     +    A+D +K+RL +++ N+ 
Sbjct: 225 AAGQFAAYLLKLENNQTVLDACAAPGSKTSHILEVNPHLKTLVAIDNNKQRLNRIKENIT 284

Query: 285 RLHLYAE-------DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           RL L  E       D+ ++D   +   +LFD +L+DAPCS+TG IRRHPD+   R   DI
Sbjct: 285 RLGLRQEHLQCLLADVSQID--QWSSGELFDRILLDAPCSATGVIRRHPDIKLLRQPGDI 342

Query: 338 VKSACFQRKL-LLQGI-SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
             S   Q+KL LL  + + +K GG +++S CS+   ++E+V+++ L S+   VEL P N
Sbjct: 343 --SQYHQKKLQLLNALWAVLKSGGFLLYSTCSVLPDENEKVIEEFL-STHDKVELSPTN 398


>gi|254423387|ref|ZP_05037105.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           PCC 7335]
 gi|196190876|gb|EDX85840.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           PCC 7335]
          Length = 491

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 121/433 (27%), Positives = 211/433 (48%), Gaps = 53/433 (12%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           LS +D+ LV  +V  ++R    +DA++D        ++   L Q+LR+   Q+ YLD V 
Sbjct: 76  LSSQDKGLVTELVYGSVRRRRTLDALIDQFGKRPASKQHRDLLQILRLGFYQLRYLDHVP 135

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKI--------------ELLQRIAGI 145
            +AVVD  V+ AK  +  +  + +VN++LR+ +RE +              E  +R+  +
Sbjct: 136 VHAVVDTTVQLAKSQRLGK-LSGVVNAMLRQYAREAMPAANVIADPLKLPEERTRRLGIL 194

Query: 146 SIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKL------NAVMLP 199
              P+W  +   +    ++V A+ +      Y++L +    ++ +  +          LP
Sbjct: 195 HSYPDWIIDVWRSMLPDDQVEALCEYFNRSPYLELRINLQRQSLSAAIALFADAGIEALP 254

Query: 200 TGGI----RLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGK 255
             G+    RL     ++  LPG+AEG W VQD+SA +   L        ++D CAAPGGK
Sbjct: 255 IEGVPSALRLTTHAGAVTQLPGYAEGWWAVQDSSAQLVSYLLDPQPGEVIIDACAAPGGK 314

Query: 256 T---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLF----D 308
           +   A+L+ +   V + D +  R +K++ N+DRL      I+     D   +  F    D
Sbjct: 315 SLHIAELMRNEGTVWSCDRTSSRTKKIQQNIDRL---GATIVRPIMGDSRNQPTFLGQGD 371

Query: 309 AVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSL 368
            VL+D PCS  GT+ RH D  W +  D +      Q+++L+   ++VKPGG++V++ C+L
Sbjct: 372 RVLLDVPCSGLGTLNRHADARWRQTPDSVDSLVTLQQEILMHASTWVKPGGVLVYATCTL 431

Query: 369 DKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
             Q++E  ++  L +++   +E  P +          +  +  GWI++ P +        
Sbjct: 432 HPQENEAQIKTFLSQNAGWTIEAPPPS--------FGIEPTEAGWIKVWPHIQH------ 477

Query: 428 SGMDGFFAVALRR 440
             MDGFF V LRR
Sbjct: 478 --MDGFFIVKLRR 488


>gi|262191295|ref|ZP_06049489.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae CT
           5369-93]
 gi|262032833|gb|EEY51377.1| ribosomal RNA small subunit methyltransferase B [Vibrio cholerae CT
           5369-93]
          Length = 426

 Score =  160 bits (405), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 119/398 (29%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGHSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 235 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG ++++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGSLLYATCSITPQENRLQVKAFLERTP 391


>gi|290512100|ref|ZP_06551468.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp.
           1_1_55]
 gi|289775890|gb|EFD83890.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp.
           1_1_55]
          Length = 431

 Score =  160 bits (404), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 115/402 (28%), Positives = 210/402 (52%), Gaps = 25/402 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNKINLRSLAAQAIEQVVEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +RL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLVEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVDANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    L           +RL   P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRNHHSRDEWLALLKEAGLEGFTHPDYPDAVRLA-TPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRYLLPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++L      +KPGG +V++ CS+  +++ + +   L  +P
Sbjct: 353 QAEILNATWEHLKPGGTLVYATCSILPEENSQQISAFLARTP 394


>gi|153953997|ref|YP_001394762.1| hypothetical protein CKL_1372 [Clostridium kluyveri DSM 555]
 gi|219854611|ref|YP_002471733.1| hypothetical protein CKR_1268 [Clostridium kluyveri NBRC 12016]
 gi|146346878|gb|EDK33414.1| Hypothetical protein CKL_1372 [Clostridium kluyveri DSM 555]
 gi|219568335|dbj|BAH06319.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 443

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 126/434 (29%), Positives = 211/434 (48%), Gaps = 54/434 (12%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L+++D+ L+  +V  TL++   ID +L   + S+L +    +  +LR+S+ Q+ YLD + 
Sbjct: 35  LNKKDRALITELVYGTLKYKYTIDCILKNFIKSNLEKMNKDILNMLRISICQLRYLDKIP 94

Query: 100 DYAVVDLAVEQAKRDKENRHF--AKLVNSILRRVSREKIELL-----QRIAGISI---IP 149
           ++AVV+ AVE +K    N  F  +KLVN +LR   R K          +I GI      P
Sbjct: 95  EFAVVNEAVEFSK----NISFKLSKLVNGVLRNYLRNKSNSFGGNKEDKIEGICFEYSFP 150

Query: 150 EWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET----WAHKLNAVMLPTGGIRL 205
            W  E   N YG++    +    +  L +   V   I T    + H  N +++    ++ 
Sbjct: 151 RWMAELFINQYGED----LGKFIMGSLNVVPKVTVRINTLKTDYKHAWNELIVNGYDVKR 206

Query: 206 KELPESIVSL---------PGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
             + +  V +         P F +G   VQD SA +         N+++LDLC+APGGK+
Sbjct: 207 GNVYKEAVIINKGSNIELNPLFEKGHITVQDESAMLVSYFMDVEENMTILDLCSAPGGKS 266

Query: 257 ---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK--KLFDAVL 311
               +L+ +   V   D+ + +L  +R N +RL +      ++DA  Y  K     D VL
Sbjct: 267 CHIGELMKNTGNVHCYDLYESKLSLVRHNAERLGIKNITCKKLDAAKYLEKLKDTADRVL 326

Query: 312 VDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQ 371
           +D PCS  G IR+ P++ W +  D +      QRK++L    +VK GG +V+S C+L+K+
Sbjct: 327 IDVPCSGLGIIRKKPEIKWNKKEDSLKDLIEIQRKIILNAARYVKVGGKLVYSTCTLNKK 386

Query: 372 DSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMD 431
           ++EE +   +  +P   +L  L    + +I        EG++ I PD         + MD
Sbjct: 387 ENEENINWFISRNP-QYKLDKLYCGDFHNI----IYHEEGYMTILPD---------NHMD 432

Query: 432 GFFAVALRRLIQPK 445
           GFF   + RLI+ +
Sbjct: 433 GFF---IARLIKQR 443


>gi|332710036|ref|ZP_08429991.1| ribosomal RNA small subunit methyltransferase RsmB [Lyngbya
           majuscula 3L]
 gi|332351179|gb|EGJ30764.1| ribosomal RNA small subunit methyltransferase RsmB [Lyngbya
           majuscula 3L]
          Length = 477

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 134/449 (29%), Positives = 213/449 (47%), Gaps = 63/449 (14%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L+  D+ LV  +V  ++R    +DA+LD +      ++   L+ +L + + Q+ Y   + 
Sbjct: 45  LTGADRGLVTELVYGSVRRQRTLDALLDQLGKKKANQQPPDLRTILHLGLYQLRYQGRIP 104

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSR------EKIEL----LQRIAGISIIP 149
             A V+  V+ AK +   +  A +VN +LR  +R      + +EL    ++R+  +   P
Sbjct: 105 ASAAVNTTVDLAKNNG-FKGLAGVVNGLLRNYARLAANSPDPLELPAGDMERLGILHSFP 163

Query: 150 EWFKERLENFYGKERVLAISDACISPLYIDLTV---KFDIETWAHKLNAVML-----PT- 200
           +W  E      G E    +         IDL +   K  IE     + +  L     PT 
Sbjct: 164 DWMIELWLQQLGLEETEQLCQWFNQSPTIDLRINPLKVSIEEVEAGMQSAELAIQRVPTL 223

Query: 201 --------GGI-----RLKELPES---------IVSLPGFAEGVWWVQDASASIPVQLFG 238
                   G I        +LP++         I  LPGF EG W VQD SA +   L  
Sbjct: 224 VSHQDEGNGEIIPMFSNPAQLPQALRIVGGVGAIQELPGFKEGWWTVQDCSAQLVSYLLD 283

Query: 239 TLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
                 V+D CAAPGGKT   A+L+    K+ A D S  RL+K++ N  RL L +  I  
Sbjct: 284 PQPGDVVIDACAAPGGKTTHIAELMADQGKIWACDRSASRLKKVQQNAQRLELQSIQIST 343

Query: 296 MDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
            D+ D CP+   + +AVL+DAPCS  GT+ R PD+ W    + + +    Q++LL    +
Sbjct: 344 GDSRD-CPEFTNVANAVLLDAPCSGNGTLHRRPDIRWRMTPEKVQELTVLQKELLEHTAT 402

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWI 413
           +VKPGG++V++ C+L+ Q++E V+Q  L       ++ P   ++ K        +PEGW+
Sbjct: 403 WVKPGGVLVYATCTLNPQENEAVIQWFLEGHS-QWQIEPPTVSFLKEFS-----TPEGWL 456

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           ++ P            MDGFF V L+R+I
Sbjct: 457 KVVP--------YRDQMDGFFMVRLKRMI 477


>gi|297581922|ref|ZP_06943842.1| sun protein [Vibrio cholerae RC385]
 gi|297533789|gb|EFH72630.1| sun protein [Vibrio cholerae RC385]
          Length = 434

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 9   MNVRAAAASALYQVVDLGRSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 63

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 64  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 122

Query: 125 NSILRRVSREK----IELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++     +     AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 123 NAVLRNYQRDQEGLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 182

Query: 180 LTVKFDIETWAHKL--NAVMLPTGGIRLK-----ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +         L   A ++ T   + +     E P  +  LPGFAEG   VQDA+A +
Sbjct: 183 VNHQHHTRAEYQALLEQAGIVTTPHAQAEDALCLETPCDVHQLPGFAEGWVSVQDAAAQL 242

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL+++R NL RL L A
Sbjct: 243 ALTYLAPQAGELILDCCAAPGGKTAHILERTPESQVVAIDCDETRLKRVRENLQRLQLTA 302

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 303 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREI 361

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 362 LDAMWQQLKPGGSLVYATCSITPQENLLQVKAFLERTP 399


>gi|194443414|ref|YP_002042660.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|224493264|sp|B4SUR0|RSMB_SALNS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194402077|gb|ACF62299.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
          Length = 429

 Score =  160 bits (404), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 131/457 (28%), Positives = 221/457 (48%), Gaps = 50/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L    +           +RL E P  + +LPGFAEG   VQDA
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                  
Sbjct: 353 QAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTP------------------ 394

Query: 404 AMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
             ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|149910330|ref|ZP_01898973.1| Putative Sun protein [Moritella sp. PE36]
 gi|149806578|gb|EDM66546.1| Putative Sun protein [Moritella sp. PE36]
          Length = 431

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 139/455 (30%), Positives = 221/455 (48%), Gaps = 45/455 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ +L  V+ K  SLT  L +     A +LL  +D+ L++ I    LR+LPR++
Sbjct: 1   MKTRASAAKVLYQVVDKGQSLTTALPI-----AQQLLPAKDRALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            +   ++   L  K+  +  L+ V + Q+ Y+ +  +A V   V   K  K  +  + LV
Sbjct: 56  FMSRQLMSKPLIGKQRPVHFLILVGLYQLKYMRIPAHAAVAETVNAIKVLKSPK-LSGLV 114

Query: 125 NSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N+ILR   R++ +L     G        P W  +R++  Y K+ + + +++    P++I 
Sbjct: 115 NAILRNYQRQQDDLETLADGNDACKFGHPGWLIKRIKAAYPKQWQDVLMANNERPPMWIR 174

Query: 180 LTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
           +  +   +     L A        V      +RL + P  +  L GFAEG   VQD +A 
Sbjct: 175 VNQQHHNQADYQALLAADEIVAEIVDSADSALRLAK-PTDVYKLAGFAEGHSSVQDGAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA---KVTALDVSKRRLEKLRCNLDRLHL 288
              Q         VLD CAAPGGKTA ++        + A+D    RL +++ NL R+ L
Sbjct: 234 FAAQFLDAQPGELVLDACAAPGGKTAHILERQPALKHLVAVDFDATRLSRVQENLTRMQL 293

Query: 289 YAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
            AE +I  DA    D+     FD +L+DAPCS+TG IRRHPD+ W R   DI      Q 
Sbjct: 294 DAE-LIHGDASKPEDWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAPLVQLQA 352

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L      +KPGG ++++ CS+   ++ E +   +  +P  V LVPLN+    S D A 
Sbjct: 353 EILDAMWLQLKPGGTLLYATCSILPAENSEQISSFVARTPDAV-LVPLNA---DSNDQAF 408

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +     W +I P+        + GMDGFF   L++
Sbjct: 409 S-----W-QILPN--------TQGMDGFFYAKLQK 429


>gi|170724406|ref|YP_001758432.1| sun protein [Shewanella woodyi ATCC 51908]
 gi|169809753|gb|ACA84337.1| sun protein [Shewanella woodyi ATCC 51908]
          Length = 425

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 126/446 (28%), Positives = 215/446 (48%), Gaps = 36/446 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L     +      S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALP----EQQKHCESGKDKALLAELSYGVMRQLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  L QLL V   Q+ +  +  +A +    E  ++ K +    K++
Sbjct: 57  KLISDCMAKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAEACRQLKFD-GLVKVI 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACI-SPLYIDLTV 182
           N++LR + R++  L      ++   P W  + L+  Y       I ++    P+++   V
Sbjct: 116 NAVLRNIQRQEKPLPTDNDTLTYNTPAWIIKSLKQAYPDSWQTVIENSHQRPPMWLRNNV 175

Query: 183 KFDI--ETWAHKLNAVMLPTGGIR----LKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
           +     E  A    A +  + G      L E P+ ++ LPGF +G   VQD +A     L
Sbjct: 176 RSQTRDEYLALLAEAEISASAGQSSDAILLESPKDVMQLPGFEQGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIV-SGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE 295
               +   +LD CAAPGGKT  ++  +  ++ A+D    RLE+++ NLDRL L A+ ++ 
Sbjct: 236 LAPADGELILDACAAPGGKTCHILERADTELVAVDFDANRLERVQQNLDRLSLNAK-LVH 294

Query: 296 MDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
            DA D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q K+L    
Sbjct: 295 GDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIEELAQLQSKILDHCW 354

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++++ CS+  Q++ + +   L  +         + A   +I         GW
Sbjct: 355 KWLKPGGTLLYATCSILPQENAQQISAFLERT---------HDATLIAISQQPNPDDIGW 405

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVAL 438
            +ITP         +  MDGF+   L
Sbjct: 406 -QITPG--------TENMDGFYYARL 422


>gi|170769473|ref|ZP_02903926.1| ribosomal RNA small subunit methyltransferase B [Escherichia
           albertii TW07627]
 gi|170121530|gb|EDS90461.1| ribosomal RNA small subunit methyltransferase B [Escherichia
           albertii TW07627]
          Length = 429

 Score =  159 bits (403), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 209/401 (52%), Gaps = 25/401 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMTRPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +    +  ++W   L    +           +RL E+P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHNSRDSWLALLEKAGMKGFLHANYPDAVRL-EIPAPVHALPGFDEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVMAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRSPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           Q ++L      +K GG +V++ CS+  +++ + ++  L+ +
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSILPEENSQQIKAFLQRT 393


>gi|326790876|ref|YP_004308697.1| sun protein [Clostridium lentocellum DSM 5427]
 gi|326541640|gb|ADZ83499.1| sun protein [Clostridium lentocellum DSM 5427]
          Length = 445

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 120/446 (26%), Positives = 221/446 (49%), Gaps = 74/446 (16%)

Query: 37  AFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL 96
           A + +  +D+  V  +V  TL++  ++D +L+    + + R K  ++ ++R+S+ Q+LYL
Sbjct: 30  ALQDIDAKDKGFVTEVVYGTLKYQIKLDYILNQFSKTPVHRMKPLIRNVMRMSLYQMLYL 89

Query: 97  D-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELL------QRIAGISI-- 147
           D V   A+++ AV+  K+ K  ++ +  VN +LR + R++ +++        +  +SI  
Sbjct: 90  DKVPTSAIINEAVKIVKKRK-FQNLSGFVNGLLRNIDRQREQIIYPDETKNLVLAMSIHY 148

Query: 148 -IPEWFKERLENFYGKERVLAISDAC-----ISPLYIDL-TVKFDIETWAHKLNAVMLPT 200
            IPEW  E     Y +E V +I +A      +   Y  L T K + E          L  
Sbjct: 149 AIPEWMIEEWLKVYKEEEVKSICEALNERAEVCARYNTLKTNKLEFEE--------TLKV 200

Query: 201 GGIRLKE---LPES--------IVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLC 249
            GI+LKE   L E+        + + P F +G W VQD SA +   +        +LD+C
Sbjct: 201 EGIQLKEGAFLEEAFYLKGVDNLQNSPSFKKGEWTVQDESAMLVAHVMAPQKGDCILDMC 260

Query: 250 AAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF--DYCPK 304
           +APGGK+   A+L+ +  ++ + D+   +LE ++ N +R+ +   +    D    + C  
Sbjct: 261 SAPGGKSIHMAELMENAGRIVSCDIHPHKLELIKKNAERMGITIIEPTLQDGTLKNECYV 320

Query: 305 KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFS 364
           + FD VL+DAPCS  G ++R PD+   +  + +++    Q+KL L  IS++KPGG +V+S
Sbjct: 321 EAFDKVLLDAPCSGLGIMKRKPDIRTHKSKEGLLEIVALQKKLALAAISYLKPGGRLVYS 380

Query: 365 NCSLDKQDSEEVV----------QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIR 414
            C++  +++E +V          + ++ + P P               +  A+  +G I+
Sbjct: 381 TCTISHEENEGMVSYIKALGLELENIVDTIPSP---------------LKRAIKEKGMIQ 425

Query: 415 ITPDMLEKIDGVSSGMDGFFAVALRR 440
           I P M        +G DGFF  + ++
Sbjct: 426 ILPHM--------AGTDGFFIASFKK 443


>gi|320087854|emb|CBY97617.1| Ribosomal RNA small subunit methyltransferase B rRNA
           (cytosine-C(5)-)-methyltransferase; 16S rRNA m5C967
           methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 429

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 133/461 (28%), Positives = 220/461 (47%), Gaps = 58/461 (12%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQR----DQILVRAIVNVT 56
           MK   N R +++  +  V+ +  SL+         + F  L Q+    D+ L++ +    
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLS---------NVFPPLQQKVADKDKALLQELCFGV 51

Query: 57  LRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKE 116
           LR L +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K 
Sbjct: 52  LRTLSQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKR 111

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAI-SDAC 172
            +    L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I ++  
Sbjct: 112 PQ-LKGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQ 170

Query: 173 ISPLYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWW 224
             P+++ +       + W   L    +           +RL E P  + +LPGFAEG   
Sbjct: 171 RPPMWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVT 229

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCN 282
           VQDASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  N
Sbjct: 230 VQDASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDN 289

Query: 283 LDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI +
Sbjct: 290 LKRLGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAE 348

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P              
Sbjct: 349 LAQLQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTP-------------- 394

Query: 400 SIDMAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
                 ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 ----DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|167554205|ref|ZP_02347946.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205321540|gb|EDZ09379.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
          Length = 429

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 130/458 (28%), Positives = 223/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  L+   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLINEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|262280615|ref|ZP_06058399.1| 16S rRNA m5C967 SAM-dependent methyltransferase [Acinetobacter
           calcoaceticus RUH2202]
 gi|262258393|gb|EEY77127.1| 16S rRNA m5C967 SAM-dependent methyltransferase [Acinetobacter
           calcoaceticus RUH2202]
          Length = 434

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 120/386 (31%), Positives = 202/386 (52%), Gaps = 25/386 (6%)

Query: 10  VSSHLLSCVMRKRISLTCLLDLEYGDSAFRLL-------SQRDQILVRAIVNVTLRFLPR 62
           VSS+     +R ++  T LL ++ G S   +L       ++RD+ L   +V  TLR    
Sbjct: 4   VSSNSSRFNLRAQVVQT-LLKVQQGQSLASILNTQLNQVAERDRALFHELVLGTLRQWFA 62

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           + ++    L+S  P    +++  L V + Q+L   +A +A +   V+ A +       + 
Sbjct: 63  LKSI-SLPLLSK-PLNNETVETCLYVGLYQVLCTRIAAHAAISETVD-ATKQLGFPALSG 119

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYIDLT 181
           +VN+ILRR +RE  E  Q +     +P W  +R++  +G++   L  S   ++PL + + 
Sbjct: 120 IVNAILRRATRETDEFQQGLQQAHGLPSWLYKRVKKDWGEQTESLCQSLKQVAPLTLRVN 179

Query: 182 VKF--------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
            +          +++   K  A +L   GI L++  + I  LPGF EG + VQD  A + 
Sbjct: 180 QRHIGRDAYLAKLQSSEIKARACILSEAGIVLEQSVQ-ITQLPGFEEGWFSVQDEHAQLC 238

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHL--Y 289
             L   LNN +V+D CAAPGGKTA L+     AK+ A+D    RL ++  NL+RL L   
Sbjct: 239 ATLLPDLNNKTVIDACAAPGGKTAHLLEKFKPAKLIAIDQDSNRLVRVTENLNRLALDQT 298

Query: 290 AEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLL 349
             +I+  DA  + P +  D +++DAPCS+TG IRRHPD+   R + DI ++   Q+++L 
Sbjct: 299 HTEILAADATQWVPAQPVDCIVLDAPCSATGVIRRHPDIRLLRQSSDIAQTIELQKQILQ 358

Query: 350 QGISFVKPGGIVVFSNCSLDKQDSEE 375
                +K GG +++  CS+ K ++E+
Sbjct: 359 HMWQQLKAGGTLLYITCSVLKAENEQ 384


>gi|261213231|ref|ZP_05927513.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. RC341]
 gi|260837505|gb|EEX64208.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. RC341]
          Length = 426

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 201/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGQSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++  L        AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQERLDTQATSHDAGRYGHPGWLLKLLKESYPQQWQQIVEANNSKAPMWLR 174

Query: 180 LT----VKFDIETWAHKLNAVMLPTGGIR---LKELPESIVSLPGFAEGVWWVQDASASI 232
           +      + + +    + +    P          E P  +  LPGFA+G   VQDA+A +
Sbjct: 175 VNHQHHTRAEYQALLEQADIACTPHSQAEDALCLETPCDVHQLPGFADGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++    G++V A+D  + RL++++ NL RL L A
Sbjct: 235 ALTYLAPKAGELILDCCAAPGGKTAHILEHTPGSQVVAIDCDETRLKRVQENLQRLQLNA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA     +   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++
Sbjct: 295 Q-VICGDARYPQQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDITALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGTLVYATCSITPQENCLQVKAFLERTP 391


>gi|24371630|ref|NP_715672.1| sun protein [Shewanella oneidensis MR-1]
 gi|46396921|sp|Q8EKR0|RSMB_SHEON RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|24345386|gb|AAN53117.1|AE015454_11 sun protein [Shewanella oneidensis MR-1]
          Length = 428

 Score =  159 bits (403), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 215/456 (47%), Gaps = 55/456 (12%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     +    L S +D+ L+  +    +R LP+I+
Sbjct: 1   MNLRALAAKAIFDVLEKGVSLSVALP----EQQKHLASGKDKALLAELCYGVMRTLPQIE 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
                 L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KRTAECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y       I  +   P        
Sbjct: 116 NGVLRNIQRQLTPLSNESETLSYNTPGWLIKRLKTAYPGNWQEIIQQSHERPPMWLRNNR 175

Query: 176 ------LYIDLTVKFDIETWAH-KLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                  Y+    K +I+  A    +A++L          P+ + +LP F EG   VQD 
Sbjct: 176 LSQSRDEYLAALDKLEIDASAGLSDDAILLAA--------PKDVATLPLFLEGAASVQDG 227

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           +A     L     N  +LD CAAPGGK+  L+      K+ A+D   +RLE+++ NLDRL
Sbjct: 228 AAQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIKLIAVDFDAKRLERVQQNLDRL 287

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L AE +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 288 SLKAE-VIHGDAANIDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAEL 346

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSID 402
           QR++L     ++KPGG ++++ CS+  Q++ + +   L R++   ++ +   ++   S D
Sbjct: 347 QRQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLARTADAKLDTLVQQAS---SQD 403

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
           +       GW +ITP            MDGF+   L
Sbjct: 404 I-------GW-QITPGQ--------HNMDGFYYARL 423


>gi|237806927|ref|YP_002891367.1| sun protein [Tolumonas auensis DSM 9187]
 gi|237499188|gb|ACQ91781.1| sun protein [Tolumonas auensis DSM 9187]
          Length = 433

 Score =  159 bits (402), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 136/457 (29%), Positives = 217/457 (47%), Gaps = 45/457 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ ++  V+ +  SL+  L +     A +L++ +D+ L++ I   TLR+L R++
Sbjct: 1   MKIRATAAKVIFQVVEQGQSLSSALPV-----AQQLIAAKDRALLQEICYGTLRWLNRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + D +L   L  K  SL  L+   + Q+ Y  +  +AV+   V  A        F KL+
Sbjct: 56  FIADQLLDRQLKGKHRSLHYLILAGLYQLFYTRIPPHAVLAETVN-ASGLLNGDSFRKLI 114

Query: 125 NSILRRVSREKIELLQRIAGISII----PEWFKERLENF--YGKERVLAISDACISPLYI 178
           N +LR   R++ ELLQ            P W  ++++    YG   VL   +    P+++
Sbjct: 115 NGVLRNAQRQQEELLQAADKNEPTRFSYPRWLLKKIKQSCQYGYVSVLQAGNE-YPPMWL 173

Query: 179 DLTV-KFDIETWAHKLNAVML---PTGGIRLKELPES---IVSLPGFAEGVWWVQDASAS 231
            + + K   + +  +L AV +   P        L E    +  LPGFA+G   VQDA+A 
Sbjct: 174 RVNLSKQSRDEYQRQLAAVEIQSTPHASCESALLLEKACDVSKLPGFADGACSVQDAAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA---KVTALDVSKRRLEKLRCNLDRLHL 288
               L     N  +LD CAAPGGKTA ++       ++ A+D    RL ++  NL R+ L
Sbjct: 234 HAAWLLDPQPNELILDACAAPGGKTAHILERQPALKQLVAVDSDANRLSRVAENLQRIQL 293

Query: 289 YAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
            A  +I  DA     +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q 
Sbjct: 294 EA-TLINGDASHPEQWWQGPQFDRILLDAPCSATGVIRRHPDIKWLRRPEDIAELAHLQH 352

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
            +L      +KPGG ++++ CS+   ++   ++  L  +   +  VPLN       +   
Sbjct: 353 DILNAMWQQLKPGGTLLYATCSILSDENSSQIKSFLERTADAIH-VPLN-------EKDT 404

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           AL P GW         +I      MDGFF   L + +
Sbjct: 405 ALQP-GW---------QIHPGEQHMDGFFYAKLTKQV 431


>gi|113968373|ref|YP_732166.1| sun protein [Shewanella sp. MR-4]
 gi|113883057|gb|ABI37109.1| sun protein [Shewanella sp. MR-4]
          Length = 429

 Score =  159 bits (402), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 132/455 (29%), Positives = 214/455 (47%), Gaps = 53/455 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L     +    L S +D+ L+  +    +R LP+I+
Sbjct: 2   MNLRALAAKAIFEVLEKGVSLSVALP----EQQKHLASGKDKALLAELCYGVMRTLPQIE 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L   L  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 58  KRVAECLAKPLKGKQRIIHQLLIVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGMVKVV 116

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISP-------- 175
           N +LR + R+   L      +S   P W  +RL+  Y       I  +   P        
Sbjct: 117 NGVLRNIQRQLTPLSTESETLSYNTPGWLIKRLKAAYPDNWQEIILQSHERPPMWLRNNR 176

Query: 176 ------LYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
                  Y+    + +IE       +  L    I L   P+ + +LP F EG   VQD +
Sbjct: 177 LSQSRDEYLAALSELEIEA------SAGLSDDAILLAH-PKDVTTLPRFHEGAASVQDGA 229

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A     L     N  +LD CAAPGGK+  L+      ++ A+D   +RLE+++ NLDRL 
Sbjct: 230 AQWAATLLAPQANELILDACAAPGGKSCHLLELEPSIQLVAVDFDAKRLERVQQNLDRLS 289

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L AE +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 290 LKAE-VIHGDAANIDSWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRKNHDIEELAELQ 348

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKSIDM 403
           R++L     ++KPGG ++++ CS+  Q++ + +   L R++   ++ +   ++   S D+
Sbjct: 349 RQILDHCWKWLKPGGTLLYATCSILPQENRDQISAFLARTADAKLDTLAQQAS---SQDI 405

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
                  GW +ITP            MDGF+   L
Sbjct: 406 -------GW-QITPG--------QHNMDGFYYARL 424


>gi|113474586|ref|YP_720647.1| sun protein [Trichodesmium erythraeum IMS101]
 gi|110165634|gb|ABG50174.1| sun protein [Trichodesmium erythraeum IMS101]
          Length = 443

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 135/474 (28%), Positives = 225/474 (47%), Gaps = 76/474 (16%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQI-----LVRAIVNVTLRFL 60
           N R ++  +L  + RK++     LD        R L + D I     LV  +V   +R  
Sbjct: 4   NPRQLAFIILQEIYRKQVFTDVALD--------RHLKKNDLIDANRRLVTELVYGCVRRQ 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +DA++D +     P++   L+ +L + + Q+ YL+ + + A VD  VE AK++K    
Sbjct: 56  RSLDAIIDQLAKKKSPQQHPYLRIILHIGLYQLSYLEQIPESAAVDTTVELAKQNK---- 111

Query: 120 FAKL---VNSILRRVSREKIEL------LQRIAGISIIPEWFKERLENFYGKERVLAISD 170
           FAKL   VN +LR   R+ + +      +Q++      P W  +    ++ +E  L +++
Sbjct: 112 FAKLAGFVNGLLREYIRQNLTINLPENPVQKLGISYSFPNWIVK----YWIEE--LGLTE 165

Query: 171 ACISPLYIDLTVKFDI-----ETWAHKLNAVMLPTG-----------GIRLKELPESIVS 214
           A     + +L+   D+     +T   ++   M   G            +RL      I  
Sbjct: 166 AEKLCYWFNLSPSIDLRINPLKTSVEEVEIAMKNIGISVSRILQVPQALRLNGAVGQIQK 225

Query: 215 LPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDV 271
           LPG+ EG W +QD+SA +   L        ++D CAAPGGKT    +L+    K+ A+D+
Sbjct: 226 LPGYNEGWWSIQDSSAQLVCYLLNPQPGEIIIDACAAPGGKTTHIGELMGDNGKIFAIDM 285

Query: 272 SKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK-KLFDAVLVDAPCSSTGTIRRHPDVLW 330
           +  RL+KL  N +RL L +  I   D+ +        D VL+D PCS  GT+ R  D  W
Sbjct: 286 TASRLKKLESNTERLQLKSISISRGDSRNLTEFINQADRVLLDVPCSGLGTLHRRADARW 345

Query: 331 TRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVEL 390
            +  ++I + A  Q +LL     +VKPGG++V++ C++   ++E V++K L         
Sbjct: 346 RKTLENIGELAKLQGELLENAAKWVKPGGVLVYATCTIYPLENEGVIEKFL--------- 396

Query: 391 VPLNSAYWK----SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              N+  W+    ++D  ++   EGWI+I P   +        MDGFF V LRR
Sbjct: 397 --TNNYEWEIEAPTVDFMVSPCREGWIKIWPHREQ--------MDGFFMVKLRR 440


>gi|197249972|ref|YP_002148329.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|224493258|sp|B5F7R5|RSMB_SALA4 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|197213675|gb|ACH51072.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
          Length = 429

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 130/458 (28%), Positives = 222/458 (48%), Gaps = 52/458 (11%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q ++L      + PGG +V++ CS+  +++ + ++  L+ +P                 
Sbjct: 352 LQAEILDAVWPRLNPGGTLVYATCSVLPEENRDQIKAFLQRTP----------------- 394

Query: 403 MAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
              ALS  G    TPD    + + G   G DGFF   L
Sbjct: 395 -DAALSETG----TPDQPGQQNLPGGEEG-DGFFYAKL 426


>gi|312882737|ref|ZP_07742472.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369595|gb|EFP97112.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 426

 Score =  159 bits (402), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 121/402 (30%), Positives = 201/402 (50%), Gaps = 40/402 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A   +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSNALP-----AAQTTIKPRDYALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +  + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  STANQLMDKPLKGKQRVFHHLILVGLYQLSFMRIPAHAAVGETVEATKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N++LR   R + +L    +   AG    P W  + L+  Y  + + +  ++   +P+   
Sbjct: 115 NAVLRNYQRNQEQLDAQAVSHDAGKYGHPSWLLKLLQASYPTDWQQIVAANNTKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHK--LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
                     Y++L  +  IE   H+   +A+ L +        P  +  LPGF +G   
Sbjct: 175 VNQHHHQRQDYLELLKESGIECEIHEEAQDAIKLLS--------PCDVTQLPGFDKGWVS 226

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQDA+A +        +   +LD CAAPGGKTA ++      KV A+D    RL+++  N
Sbjct: 227 VQDAAAQLSSDFLNAQDGELILDCCAAPGGKTAHILERAPNCKVVAIDCDDTRLQRVHDN 286

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL L A  +I  DA +   +   + FD +L+DAPCS+TG IRRHPD+ W R  +DI  
Sbjct: 287 LQRLQLNAT-VICGDARNPEEWWQGEKFDRILLDAPCSATGVIRRHPDIKWLRRAEDIHA 345

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  Q ++L      +KPGG +V++ CS+  Q++++ V+  L
Sbjct: 346 LAQLQSEILDAMWQQLKPGGTLVYATCSITPQENKDQVKAFL 387


>gi|90415406|ref|ZP_01223340.1| hypothetical protein GB2207_08821 [marine gamma proteobacterium
           HTCC2207]
 gi|90332729|gb|EAS47899.1| hypothetical protein GB2207_08821 [marine gamma proteobacterium
           HTCC2207]
          Length = 439

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 134/465 (28%), Positives = 234/465 (50%), Gaps = 53/465 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R+  + +++ V+R + SL+ LL  EY         ++D  L + +   TLR+ P I+
Sbjct: 1   MNTRVAVAEVIAQVLRGK-SLSALLP-EYASKVV----EKDVGLFKQLCFGTLRWYPAIE 54

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK-L 123
            +L  ++   +  K++ +Q LL   + Q+++  +AD+A ++  V    + K  R +AK L
Sbjct: 55  LLLQELMQKPMREKEFEIQGLLACGLYQLMHTRIADHAAINETVTAVTKLK--RPWAKGL 112

Query: 124 VNSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE---RVLAISDACISPL 176
           VN++LR   R++ EL  ++A   +     P+W    L   +G      VLA ++   +P+
Sbjct: 113 VNAVLRNFLRQRTELETKLAKNPVFVRAHPQWLLNDLFTSWGSAVAIDVLAANNEQ-APM 171

Query: 177 YIDLT-VKFDIETWAHKLNA-------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
            + +  ++   + +  +L+A             GI+L+   + + +LPG+  G   VQD 
Sbjct: 172 TLRVNQLQGSRDEYLQQLSAADIRAQTTQFSEQGIQLQSAID-VATLPGWDSGAVSVQDE 230

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG---AKVTALDVSKRRLEKLRCNLDR 285
           +A +   L     +  VLD C APGGKT  ++ +    +K+ A+++  RR+ ++  NL R
Sbjct: 231 AAQLTAALLELEPDQQVLDACCAPGGKTCHILETQPQLSKLVAVELESRRMPRVEENLRR 290

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L A D++  DA    D+   K F  +L+DAPCS++G IRRHPD+   R T DIVK A 
Sbjct: 291 LGLKA-DLVVNDASATADWWDGKPFQRILLDAPCSASGVIRRHPDIKLLRKTTDIVKLAE 349

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPV----ELVPLNSAYW 398
            Q +LL      +  GGI++++ CS+  Q++++V++  L  + +      EL  + + + 
Sbjct: 350 LQLQLLHSLWQTLDEGGILLYATCSVLPQENDQVIETFLAETSLATTSAAELYSIEAEWG 409

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                   L P            KID    G DGF+   LR+  Q
Sbjct: 410 TKTAFGRQLFP------------KID----GNDGFYYSRLRKTSQ 438


>gi|33152966|ref|NP_874319.1| Fmu protein [Haemophilus ducreyi 35000HP]
 gi|46396801|sp|Q7VKC4|RSMB_HAEDU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|33149191|gb|AAP96708.1| SUN protein [Haemophilus ducreyi 35000HP]
          Length = 435

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 141/457 (30%), Positives = 225/457 (49%), Gaps = 51/457 (11%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           ++R +++ ++  V+    SL+ L+      +A + L  +D  LV+ I     R LPR++A
Sbjct: 7   SSRAIAAQIMLQVLDHGKSLSTLIP-----AAQQQLDAKDIPLVQEITFGICRVLPRLEA 61

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++  ++   L  K   +  LL V + Q+LY+ +  +A VD  V   K  K +  F  L N
Sbjct: 62  IIQQLVTKPLKGKSRLVHCLLLVGLYQLLYMRIPVHAAVDEVVNATKLVKLDS-FRALTN 120

Query: 126 SILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            +LRR  RE+  +L ++     ++ PEW    L+  Y   R +  ++    P++I +  +
Sbjct: 121 GVLRRFLREQQTILAKVDKHWQTLHPEWLVNMLKQVYPNWREIMDANNQRPPMWIRVNTQ 180

Query: 184 F----DIETWAHKL------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
                D       L      ++  LP+  I+L   P S+  LP F+ G   VQD  A   
Sbjct: 181 HCTPQDYSALLGDLAVKTTNSSACLPSSAIQLVN-PLSVDKLPYFSRGWATVQDCHAQWS 239

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYAE 291
             L    N   +LD CAAPGGKT  ++     AKV ALD+ + RL ++R NL RL L A 
Sbjct: 240 ATLLAAKNGEMILDACAAPGGKTTHILEQAPQAKVIALDIEESRLVRVRENLARLGLTA- 298

Query: 292 DIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           D+   DA    P K      +FD +L+DAPCS+TG IRRHPD+ W R   DI +    Q 
Sbjct: 299 DVRCGDA--TTPTKWLADDVMFDRILLDAPCSATGVIRRHPDIKWLRQAGDISELVELQA 356

Query: 346 KLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           K+L      +KP G +V++ CS L  ++SE+++Q  + ++P   EL+ ++    K+I   
Sbjct: 357 KILSALWHRLKPNGTLVYATCSILPAENSEQIIQ-FITANP-DAELIEMDFNGEKAI--- 411

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                          +++     +G DGFF   LR+L
Sbjct: 412 ---------------MKQFLPQQNGGDGFFYAKLRKL 433


>gi|332996759|gb|EGK16384.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-272]
          Length = 429

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 113/385 (29%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++H +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAHAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +A ++    P+
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|90406716|ref|ZP_01214909.1| sun protein [Psychromonas sp. CNPT3]
 gi|90312169|gb|EAS40261.1| sun protein [Psychromonas sp. CNPT3]
          Length = 434

 Score =  159 bits (401), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 132/460 (28%), Positives = 217/460 (47%), Gaps = 52/460 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +L+ V+ +  SL+  L +   D     L+ +D+ L++ +    LR LPR+D
Sbjct: 1   MNVRALAAQVLNLVVEQGQSLSQALPVLQKD-----LTPKDKALLQVLCYGVLRTLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
                ++   L  K+     L+ V + Q+LY  +  +A V   V  AK     +    +V
Sbjct: 56  FFCRSLMQKPLKGKQRVFHFLILVGIYQLLYTRIPSHAAVGETVNGAKA-LNKQALKGMV 114

Query: 125 NSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKERVLAI--SDACISPLYI 178
           N +LR   RE+  L+++      +    P W  +RL++ YGKE+  +I   +   +P+++
Sbjct: 115 NGVLRNFLREQEALIEKADQQDTLLYCHPGWLVKRLQSAYGKEKAASIMLENNQQAPMWL 174

Query: 179 DLT-VKFDIETWAHKLNAVMLPTGGIRLKELPES-----------IVSLPGFAEGVWWVQ 226
            +  +  D++++   L    L   G RL    E+           +  LPGF +G   VQ
Sbjct: 175 RVNALHHDVKSYQALLTEKDL---GSRLALDSENKNALCLDKATDVYQLPGFEDGWVSVQ 231

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT---ALDVSKRRLEKLRCNL 283
           D +A +            VLD CAAPGGKT   +    K+    A+D   +RL ++R NL
Sbjct: 232 DGAAQLAAHYLDAQPGDLVLDACAAPGGKTVHSLERQPKIAQMVAVDADDKRLVRVRENL 291

Query: 284 DRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
           +RL+L A  +I  DA     +   + FD +L DAPCS+TG IRRHPD+ W R   DI + 
Sbjct: 292 ERLNLTAT-VIHGDASTPDVWWKGEKFDRILCDAPCSATGVIRRHPDIRWLRRDSDIKEL 350

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q+ +L      +K GGI++++ CS+   D  ++  K    +    +LVPL+  Y  S
Sbjct: 351 VSLQKSILNALWDKLKAGGILLYATCSI-LPDENDLQIKAFLETHADAKLVPLSKQY-AS 408

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +   L P                    MDGF+   L++
Sbjct: 409 TTVGRQLLPN----------------DDTMDGFYYAKLQK 432


>gi|53729217|ref|ZP_00348347.1| COG0144: tRNA and rRNA cytosine-C5-methylases [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|126209024|ref|YP_001054249.1| ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae L20]
 gi|165976991|ref|YP_001652584.1| SUN protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|190150891|ref|YP_001969416.1| ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|303252922|ref|ZP_07339079.1| SUN protein [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|307248606|ref|ZP_07530620.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|307250839|ref|ZP_07532767.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|307255464|ref|ZP_07537270.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307257633|ref|ZP_07539392.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|307259916|ref|ZP_07541629.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|307264244|ref|ZP_07545834.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
 gi|126097816|gb|ABN74644.1| ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 5b str. L20]
 gi|165877092|gb|ABY70140.1| SUN protein [Actinobacillus pleuropneumoniae serovar 3 str. JL03]
 gi|189916022|gb|ACE62274.1| ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 7 str. AP76]
 gi|302648230|gb|EFL78429.1| SUN protein [Actinobacillus pleuropneumoniae serovar 2 str. 4226]
 gi|306854817|gb|EFM87006.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 2 str. S1536]
 gi|306857089|gb|EFM89217.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 4 str. M62]
 gi|306861506|gb|EFM93494.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306863808|gb|EFM95732.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 10 str. D13039]
 gi|306865944|gb|EFM97819.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 11 str. 56153]
 gi|306870415|gb|EFN02169.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 13 str. N273]
          Length = 432

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 131/401 (32%), Positives = 202/401 (50%), Gaps = 32/401 (7%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V++ ++  V+ +  SL  L+       A   L  +D  LV+ I     R LPR++A
Sbjct: 5   NARAVAAQIILQVLDQGKSLATLIP-----EAQAKLEAKDLPLVQEITFGVCRTLPRLEA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           V+   +   L  K   +  LL V + Q+LY+ V ++A VD  V  A+  K + +F  L+N
Sbjct: 60  VIAQAVEKPLKGKTRLVHCLLLVGLYQLLYMRVPEFAAVDEVVNAARSLKLD-NFKALIN 118

Query: 126 SILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            +LRR  REK  LL +      ++ PEWF  +L+  Y   R +  ++    P++I   ++
Sbjct: 119 GVLRRFLREKDSLLAKFDKNWQTLHPEWFVNKLKKAYPNWREIIDANNQRPPMWIRSNIQ 178

Query: 184 -----------FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                       D+     +     +P   I L   P  +  L  F +G   VQDA A  
Sbjct: 179 RIKPQDYRVLLGDLVAKNSENTTACVPESAILLAN-PVPVNKLMNFEQGWATVQDAHAQW 237

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYA 290
              L    N   +LD CAAPGGKT  ++ +   AKV ALD+ + RL+++R NL RL   A
Sbjct: 238 SAALLEAQNGELILDACAAPGGKTTHILEAAPQAKVIALDIEESRLKRVRENLARLGQTA 297

Query: 291 EDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
             +I  DA    P +      +FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q
Sbjct: 298 -TVICGDASK--PAEWLDDGVMFDRILLDAPCSATGVIRRHPDIKWLRKENDIAELVALQ 354

Query: 345 RKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSS 384
            K+L      +KP G++V++ CS L +++ E++ + V   S
Sbjct: 355 AKILEALWGRLKPNGVLVYATCSVLPEENGEQITRFVASHS 395


>gi|78484536|ref|YP_390461.1| sun protein [Thiomicrospira crunogena XCL-2]
 gi|78362822|gb|ABB40787.1| Ribosomal RNA small subunit methyltransferase B [Thiomicrospira
           crunogena XCL-2]
          Length = 436

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 137/446 (30%), Positives = 217/446 (48%), Gaps = 68/446 (15%)

Query: 27  CLLDLEYGDSAFRLLSQ--------RDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRK 78
           CL  +E+G S  + L++        R++   + +V  TLR+  R++A+   +L   L  K
Sbjct: 13  CLTVIEHGRSLSQSLAEGLAQFSDRRERAFTQNLVLGTLRWQERLEAIRSHLLKKPLKAK 72

Query: 79  KYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK-LVNSILRRVSREKIE 137
              + QL+ + + QILY+D  ++A V   V   K  K  + +A+ L+N +LR   R+K  
Sbjct: 73  DEDVNQLILLGLYQILYMDTPEHAAVSETVNLTKSLK--KPWARGLINGVLRTFLRDKDS 130

Query: 138 LLQRI----AGISIIPEWFKERLENFYGK--ERVLAISDAC------ISPLY-------- 177
           + + +    A     P+WF + + N Y    E++L+ ++        ++PLY        
Sbjct: 131 ICEEVDKKPAYRYSHPQWFTKTIRNAYPDHWEQILSANNEPAPLTLRVNPLYQTREAFLA 190

Query: 178 --IDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
              D  V+ DI   A        P G +    L   I  LP + EG + VQDA+A     
Sbjct: 191 LLSDQAVEADIHPKA--------PQGIVLKNSL--DITQLPTYDEGGFSVQDAAAQQAAY 240

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIV---SGAKVTALDVSKRRLEKLRCNLDRLHLYAE- 291
           L     N  +LD CAAPGGKT  L+    + AKV AL+    R+E+L  NL RL L AE 
Sbjct: 241 LLAPQPNEFILDACAAPGGKTTHLLELSDNQAKVFALEKEPERIERLSENLYRLALTAEI 300

Query: 292 ---DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
              D  + D   + P+  FD +L+DAPCS+TG IRRHPD+ W R  +DI      Q  +L
Sbjct: 301 EVGDASQPD--QWWPEIQFDKILLDAPCSATGIIRRHPDIKWHRTPEDITVLTQLQAAIL 358

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG ++++ CS+  Q++ + + + L+ +P   E +P+ + +  +ID      
Sbjct: 359 QAIWPRLKPGGKLLYATCSVLPQENRDQISQFLQQTPDAKE-IPIGADWGITIDAPGR-- 415

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFF 434
                +I P           GMDGF+
Sbjct: 416 -----QILPGQ--------DGMDGFY 428


>gi|89074758|ref|ZP_01161216.1| Putative Sun protein [Photobacterium sp. SKA34]
 gi|89049522|gb|EAR55083.1| Putative Sun protein [Photobacterium sp. SKA34]
          Length = 426

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 118/402 (29%), Positives = 201/402 (50%), Gaps = 32/402 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L     D     + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRATAAKVIYQVVDQGQSLSAALPAAQQD-----IRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    L+
Sbjct: 56  SITQALMDKPLKGKQRVFHHLILVGLYQLGYMRIPAHAAVAETVNATKTLKKPQ-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKERVLAISDAC-----ISP 175
           N+ILR   R++  L    +   AG    P W  + L+  Y ++     +D C      +P
Sbjct: 115 NAILRNYQRQQETLDAQAISHDAGKYGHPSWLLKLLKESYPEQ----FADICEANNTKAP 170

Query: 176 LYIDLTVKFDIETW------AHKLNAVMLPTGGIRLKEL-PESIVSLPGFAEGVWWVQDA 228
           +++ +  + +          A  +   + P     L+ + P  +  LPGF++G   VQDA
Sbjct: 171 MWLRVNRQHNTRDAYRALLDAEDIATELHPQAADALRLVSPCDVTQLPGFSDGWVSVQDA 230

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRL 286
           +A + V       +  +LD CAAPGGKTA ++  V   KV A+D  + RL+++  NL RL
Sbjct: 231 AAQLAVDYLQPKADELILDCCAAPGGKTAHIMEHVPSTKVVAIDCDENRLKRVHENLARL 290

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           +L A  ++  DA     +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  
Sbjct: 291 NLDAT-VLCADARYPEQWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALATL 349

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           Q ++       +KPGG +V++ CS+  Q++ + V+  L  +P
Sbjct: 350 QAEIFDAMWLQLKPGGTLVYATCSITPQENCDQVKAFLARTP 391


>gi|329295652|ref|ZP_08252988.1| 16S rRNA methyltransferase B [Plautia stali symbiont]
          Length = 428

 Score =  158 bits (400), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 119/402 (29%), Positives = 200/402 (49%), Gaps = 34/402 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++ L+  V+ K  SL+ +L      +A + L+  D  L++ +     R L
Sbjct: 1   MKKATNLRSLAAQLIERVVDKGESLSAILP-----AAQKTLANNDGALLQELCFGVTRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A+++ ++   L  K+  L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALINKLMARPLTGKQRVLHYLIMVGLYQLLYTRVPPHAALAETVAGAEALKRA-NL 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++  LL  +         P W  +RL+  +  +  L +      P  
Sbjct: 115 KGLLNGVLRQFQRQQDALLAEVNQGPQRYWHPGWLLKRLQTAWPAQWQLIVEANNQRP-- 172

Query: 178 IDLTVKFDIETWAHKLNAVML-------------PTGGIRLKELPESIVSLPGFAEGVWW 224
              T+   +    H  +A +                  +RL E P  +  LPGF +G   
Sbjct: 173 ---TMWLRVNRQHHSRDAWLALLTQQDQNAFSADAPDALRL-EAPAPVSQLPGFEQGWVT 228

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCN 282
           VQD SA     L    N  ++LDLCAAPGGKT  +I     A+V A+D+  +RL ++  N
Sbjct: 229 VQDLSAQRCALLLAPENGETILDLCAAPGGKTTHIIEIALQARVLAVDIDAQRLSRVTEN 288

Query: 283 LDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           L RL + + D+ + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI +
Sbjct: 289 LQRLGMQS-DVRQGDGRTPAAWCDEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIDE 347

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            A  QR++L      +K GG ++++ CS+  Q++++ +   L
Sbjct: 348 LAALQREILAAIWPRLKSGGTLLYATCSVLPQENQQQIDAFL 389


>gi|261250606|ref|ZP_05943181.1| ribosomal RNA small subunit methyltransferase B [Vibrio orientalis
           CIP 102891]
 gi|260939175|gb|EEX95162.1| ribosomal RNA small subunit methyltransferase B [Vibrio orientalis
           CIP 102891]
          Length = 426

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 122/392 (31%), Positives = 198/392 (50%), Gaps = 36/392 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGQSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ + L  KK     L+ V + Q+ ++ +  +A V   VE  K  K       L+
Sbjct: 56  SIANELMENPLKGKKRVFHHLILVGIYQLSFMRIPAHAAVAETVEGTKTLK-GPSLRGLI 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERL-ENFYGKERVLAISDACISPL--- 176
           N++LR   R++ EL ++     AG    P W    L E++      L  ++   +P+   
Sbjct: 115 NAVLRSYLRDQEELDEKAVSHNAGKYGHPNWLLNMLRESYPDSWEQLIEANNSKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y++L    +IE   H   A       I+L   P  +  LPGF  G   VQ
Sbjct: 175 VNRQHHTRDEYLELLKDENIEFSIHPEAA-----DAIKLAS-PCDVTLLPGFDRGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + V      N   +LD CAAPGGKTA ++      +V A+D   +RL+++  NL+
Sbjct: 229 DAAAQLSVNYLQPQNGELILDCCAAPGGKTAHILEHTEDTEVVAIDCDAKRLDRVYDNLE 288

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A D+I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A
Sbjct: 289 RLQLRA-DVICGDARYPQEWWTGEKFDRILLDAPCSATGVIRRHPDIKWLRRANDIDALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
             Q +++      +K GG +V++ CS+  Q++
Sbjct: 348 ELQSEIMDAMWGQLKVGGTMVYATCSITPQEN 379


>gi|307246481|ref|ZP_07528553.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
 gi|306852544|gb|EFM84777.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 1 str. 4074]
          Length = 432

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 131/401 (32%), Positives = 201/401 (50%), Gaps = 32/401 (7%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V++ ++  V+ +  SL  L+       A   L  +D  LV+ I     R LPR++A
Sbjct: 5   NARAVAAQIILQVLDQGKSLATLIP-----EAQAKLEAKDLPLVQEITFGVCRTLPRLEA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           V+   +   L  K   +  LL V + Q+LY+ V ++A VD  V  A+  K + +F  L+N
Sbjct: 60  VIAQAVEKPLKGKTRLVHCLLLVGLYQLLYMRVPEFAAVDEVVNAARSLKLD-NFKALIN 118

Query: 126 SILRRVSREKIELLQRIAG--ISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            +LRR  REK  LL +      ++ PEWF  +L+  Y   R +  ++    P++I   ++
Sbjct: 119 GVLRRFLREKDSLLAKFDKNWQTLHPEWFVNKLKKAYPNWREIIDANNQRPPMWIRSNIQ 178

Query: 184 -----------FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                       D+     +      P   I L   P  +  L  F +G   VQDA A  
Sbjct: 179 RIKPQDYRVLLGDLVAKNSENTTACAPESAILLAN-PVPVNKLMNFEQGWATVQDAHAQW 237

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYA 290
              L    N   +LD CAAPGGKT  ++ +   AKV ALD+ + RL+++R NL RL   A
Sbjct: 238 SAALLEAQNGELILDACAAPGGKTTHILEAAPQAKVIALDIEESRLKRVRENLARLGQTA 297

Query: 291 EDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
             +I  DA    P +      +FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q
Sbjct: 298 -TVICGDASK--PAEWLDDGVMFDRILLDAPCSATGVIRRHPDIKWLRKENDIAELVALQ 354

Query: 345 RKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSS 384
            K+L      +KP G++V++ CS L +++ E++ + V   S
Sbjct: 355 AKILEALWGRLKPNGVLVYATCSVLPEENGEQITRFVASHS 395


>gi|117618823|ref|YP_854784.1| ribosomal RNA small subunit methyltransferase B [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117560230|gb|ABK37178.1| ribosomal RNA small subunit methyltransferase B [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 430

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 127/413 (30%), Positives = 205/413 (49%), Gaps = 34/413 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ ++  V+ +  SL+ +L      +A   ++ RD+ L++ +   TLR+LPR+D
Sbjct: 1   MKTRAQAALVIQQVLDQGQSLSAVLP-----AAQEKVAPRDRALLQELCYGTLRWLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A +  ++   L  K      L+ V + Q++Y  +  +A V   V   K  K       L+
Sbjct: 56  AAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKLLK-GTSLRGLI 114

Query: 125 NSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N +LR   R    +L RI  +  I    PEW  +RL   Y  E   +  ++    P++I 
Sbjct: 115 NGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPDEWEFIMEANNQRPPMWI- 173

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIR-----------LKELPESIVSLPGFAEGVWWVQDA 228
              + + +  + +   V +   GI            L E P  +  LPGF  G   VQD 
Sbjct: 174 ---RNNSQRQSREQMLVRMAEAGINAMAGEEGEDCILLERPCDVTKLPGFEAGDCSVQDG 230

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG---AKVTALDVSKRRLEKLRCNLDR 285
           +A     L        VLD CAAPGGKTA L+      A V A+D    RL++++ NLDR
Sbjct: 231 AAQQAAALLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDADDNRLKRVQENLDR 290

Query: 286 LHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           + L A+ +I  DA     + P+  FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 291 IGLTAK-VIHGDASTPDLWWPEGQFDRILLDAPCSATGVIRRHPDIKWLRRDQDIRELAE 349

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            Q ++L    S +K GG ++++ CS+  +++ + ++  L ++P    LVPL++
Sbjct: 350 LQHRILGALWSKLKSGGTLLYATCSVLPEENRDQIRAFLAATP-DATLVPLHA 401


>gi|324009054|gb|EGB78273.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 57-2]
          Length = 429

 Score =  158 bits (399), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 113/385 (29%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|307262046|ref|ZP_07543700.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
 gi|306868225|gb|EFN00048.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 12 str. 1096]
          Length = 432

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 131/401 (32%), Positives = 202/401 (50%), Gaps = 32/401 (7%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V++ ++  V+ +  SL  L+       A   L  +D  LV+ I     R LPR++A
Sbjct: 5   NARAVAAQIILQVLDQGKSLATLIP-----EAQAKLEAKDLPLVQEITFGVCRTLPRLEA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           V+   +   L  K   +  LL V + Q+LY+ V ++A VD  V  A+  K + +F  L+N
Sbjct: 60  VIAQAVEKPLKGKTRLVHCLLLVGLYQLLYMRVPEFAAVDEVVNAARSLKLD-NFKALIN 118

Query: 126 SILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            +LRR  REK  LL ++     ++ PEWF  +L+  Y   R +  ++    P++I   ++
Sbjct: 119 GVLRRFLREKDSLLAKLDKNWQTLHPEWFVNKLKKAYPNWREIIDANNQRPPMWIRSNIQ 178

Query: 184 -----------FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                       D+     +     +P   I L   P  +  L  F +G   VQDA A  
Sbjct: 179 RIKPQDYRVLLGDLVAKNSENMTACVPESAILLAN-PVPVNKLMNFEQGWATVQDAHAQW 237

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
              L    N   +LD CAAPGGKT  +  +   AKV ALD+ + RL+++R NL RL   A
Sbjct: 238 SAALLEAQNGELILDACAAPGGKTTHILEVAPQAKVIALDIEESRLKRVRENLARLGQTA 297

Query: 291 EDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
             +I  DA    P +      +FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q
Sbjct: 298 -TVICGDASK--PAEWLDDGVMFDRILLDAPCSATGVIRRHPDIKWLRKENDIAELVALQ 354

Query: 345 RKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSS 384
            K+L      +KP G++V++ CS L +++ E++ + V   S
Sbjct: 355 AKILEALWGRLKPNGVLVYATCSVLPEENGEQITRFVASHS 395


>gi|90581174|ref|ZP_01236973.1| Putative Sun protein [Vibrio angustum S14]
 gi|90437695|gb|EAS62887.1| Putative Sun protein [Vibrio angustum S14]
          Length = 426

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 199/398 (50%), Gaps = 32/398 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L     D     + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRATAAKVIYQVVDQGQSLSAALPAAQQD-----IRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    L+
Sbjct: 56  SITQALMDKPLKGKQRVFHHLILVGLYQLGYMRIPAHAAVAETVNATKTLKKPQ-LRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKERVLAISDAC-----ISP 175
           N+ILR   R++ EL    +   AG    P W  + L+  Y ++     +D C      +P
Sbjct: 115 NAILRNYQRQQEELDTKAISHDAGKYGHPSWLLKLLKESYPEQ----FADICEANNTKAP 170

Query: 176 LYIDLTVKFDIETW------AHKLNAVMLPTGGIRLKEL-PESIVSLPGFAEGVWWVQDA 228
           +++ +  + +          A  +   + P     L+ + P  +  LPGF++G   VQDA
Sbjct: 171 MWLRVNRQHNTRDAYRALLDAEDIATELHPQAADALRLVSPCDVTKLPGFSDGWVSVQDA 230

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRL 286
           +A + V          +LD CAAPGGKTA ++  V   KV A+D  + RL+++  NL RL
Sbjct: 231 AAQLAVDYLQPKAGELILDCCAAPGGKTAHIMEHVPSTKVVAIDCDENRLKRVHENLARL 290

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           +L A  ++  DA     +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  
Sbjct: 291 NLDAT-VLCADARYPEQWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALATL 349

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
           Q ++       +KPGG +V++ CS+  Q++ + V+  L
Sbjct: 350 QAEIFDAMWLQLKPGGTLVYATCSITPQENCDQVKAFL 387


>gi|300721396|ref|YP_003710667.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627884|emb|CBJ88430.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Xenorhabdus
           nematophila ATCC 19061]
          Length = 437

 Score =  157 bits (398), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 128/468 (27%), Positives = 228/468 (48%), Gaps = 63/468 (13%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+  N R +++  ++ V+ +  SL+ ++ +L+      + +S +D+ L++ +    +R 
Sbjct: 1   MKNTYNLRSIAAKAITQVLEQGQSLSSVIPELQ------QRVSDKDKALLQELCFGVMRV 54

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++  +  ++   L  K+     L+ V + Q+ Y  +  +A +   V  A   K  + 
Sbjct: 55  LPQLEWFMSQLMAKPLKGKQRIFHYLIMVGLYQLTYTRIPAHAALAETVNGAINLKRPQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKERVLAISDACISPL 176
              L+N +LR+  R++ EL++R        + P+W +ER++  Y +     I      P 
Sbjct: 114 LKGLINGVLRQFQRQQQELVERSNKHINQHLHPKWLQERIQKSYPQNWQTIIDANNQKPP 173

Query: 177 --------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
                         Y+ L    +IE    +L+        IRL   P  + SLPGF +G 
Sbjct: 174 MWLRVNQLHHTANEYLSLLENANIEA---ELDTKH--PNAIRLLN-PCPVHSLPGFNQGW 227

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLR 280
             +QD SA    +L    N   +LDLCAAPGGKT  +  I   +KV A+D+ ++RL++++
Sbjct: 228 VTIQDRSAQGCAELLTPCNGEFILDLCAAPGGKTTHILEIAPKSKVLAIDIDEQRLKRVK 287

Query: 281 CNLDRLHLYAEDIIEMD----AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
            NL RL+L+A  +++        ++   + FD +L+DAPCS+TG IRRHPD+ W R  +D
Sbjct: 288 ENLQRLNLHA--VVKTGDGRLPHEWAAGEQFDRILLDAPCSATGVIRRHPDIKWLRRNED 345

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           I +    Q ++L     ++K  G +V++ CS+  Q++ E ++  L+     V        
Sbjct: 346 IDQLVTLQSEILDAIWPYLKKNGTLVYATCSILPQENSEQIKAFLKRHTDAV-------- 397

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
               +    +L   G  +I P++         G DGFF     RLI+P
Sbjct: 398 ----LSETGSLEKPG-TQIIPEV--------EGGDGFFYA---RLIKP 429


>gi|331649085|ref|ZP_08350171.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M605]
 gi|330909333|gb|EGH37847.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           AA86]
 gi|331041583|gb|EGI13727.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M605]
          Length = 429

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 113/385 (29%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       +TW   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDTWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|225024416|ref|ZP_03713608.1| hypothetical protein EIKCOROL_01291 [Eikenella corrodens ATCC
           23834]
 gi|224942797|gb|EEG24006.1| hypothetical protein EIKCOROL_01291 [Eikenella corrodens ATCC
           23834]
          Length = 419

 Score =  157 bits (398), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 121/361 (33%), Positives = 188/361 (52%), Gaps = 22/361 (6%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           LS +++  ++ I     RF   + A+LD +L   LPR    ++ L+  ++ Q+ Y   A 
Sbjct: 37  LSAQERGALQDIAYGCQRFSGSLRALLDLMLNKPLPRA--DIRSLILAALYQLAYSRNAA 94

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIA----GISIIPEWFKERL 156
           +AVV+ AV  A +  + ++ A L N++LRR  RE+  L+Q+      G   +P W+ ERL
Sbjct: 95  HAVVNEAVRAAGKIGKGQYKA-LTNALLRRFLRERDSLMQQAQQSPEGRYNLPNWWLERL 153

Query: 157 ENFYGKERVLAISDACIS--PLYIDLTVKF-DIETW-----AHKLNAVMLPTGGIRLKEL 208
           +  Y  E  L I++A  S  P+ + +  +  D E +      H + A +L +  + L   
Sbjct: 154 QRDY-PEHWLQITEAFNSHPPMTLRINRRHTDAEGYLKILDEHGMQAEILGSHAVMLAT- 211

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV-SGAKVT 267
           P  + +LP FAEGV  VQD  A          N   VLD CAAPGGK+  L+  +   +T
Sbjct: 212 PVPVSALPLFAEGVVSVQDWGAQQAAAWLNVQNGERVLDACAAPGGKSGHLLEWADCTLT 271

Query: 268 ALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP---KKLFDAVLVDAPCSSTGTIRR 324
           A+D+   RL+++R NL RL+L AE +   DA  +       LF+AVL D PC+++G   R
Sbjct: 272 AIDIDPTRLQQVRDNLSRLNLSAE-LHAADARQWASCYDGLLFNAVLADVPCTASGVACR 330

Query: 325 HPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           HPD+ W R   D   +A  Q  LL      +KPGG ++ S CSL  +++   +Q  L+  
Sbjct: 331 HPDIKWLRRPQDAKNTAAQQTDLLDALWRTLKPGGRMLLSTCSLFTEENGSQLQAFLQRH 390

Query: 385 P 385
           P
Sbjct: 391 P 391


>gi|295096932|emb|CBK86022.1| 16S rRNA m(5)C-967 methyltransferase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 420

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 189/362 (52%), Gaps = 20/362 (5%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           +S +D+ L++ +    LR L +++ +++ ++   +  K+ ++  L+ V   Q+L+  +  
Sbjct: 27  VSDKDKALLQELCFGVLRTLSQLEWLINKLMSRPMSGKQRTVHYLIMVGFYQLLHTRIPP 86

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLE 157
           +A +   VE A   K  +    L+N +LR+  R++ ELL   A      + PEW   RL+
Sbjct: 87  HAALAETVEGAVSIKRPQ-LKGLINGVLRQFQRQQDELLAEFAQSEARFLHPEWLLNRLK 145

Query: 158 NFYGKE-RVLAISDACISPLYIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKEL 208
             Y ++ + +A ++    P+++ +       + W   L    +           +RL   
Sbjct: 146 KAYPQQWQDIADANNQRPPMWLRVNRNHHTRDAWLALLEEAGMSGFTHAAYPDAVRLAS- 204

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKV 266
           P  + +LPGF EG   VQDASA   +      +   +LDLCAAPGGKT  +  +   A V
Sbjct: 205 PALVHALPGFEEGWLTVQDASAQGCMTWLEPKDGEQILDLCAAPGGKTTHILEVAPQASV 264

Query: 267 TALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIR 323
            A+DV ++RL ++  NL RL + A+ + + D     D+C    FD +L+DAPCS+TG IR
Sbjct: 265 MAVDVDEQRLSRVYDNLKRLGMKAQ-VKQGDGRKPADWCGDTRFDRILLDAPCSATGVIR 323

Query: 324 RHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS 383
           RHPD+ W R   DI + A  Q ++L      +KPGG +V++ CS+  +++ + +   L+ 
Sbjct: 324 RHPDIKWLRRDRDIKELAQLQSEILDAIWPHLKPGGTLVYATCSVLPEENSQQIAAFLKR 383

Query: 384 SP 385
           +P
Sbjct: 384 TP 385


>gi|303249608|ref|ZP_07335814.1| SUN protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|307253218|ref|ZP_07535093.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
 gi|302651541|gb|EFL81691.1| SUN protein [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
 gi|306859306|gb|EFM91344.1| Ribosomal RNA small subunit methyltransferase B [Actinobacillus
           pleuropneumoniae serovar 6 str. Femo]
          Length = 432

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 131/401 (32%), Positives = 202/401 (50%), Gaps = 32/401 (7%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V++ ++  V+ +  SL  L+       A   L  +D  LV+ I     R LPR++A
Sbjct: 5   NARAVAAQIILQVLDQGKSLATLIP-----EAQAKLEAKDLPLVQEITFGVCRTLPRLEA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           V+   +   L  K   +  LL V + Q+LY+ V ++A VD  V  A+  K + +F  L+N
Sbjct: 60  VIAQAVEKPLKGKTRLVHCLLLVGLYQLLYMRVPEFAAVDEVVNAARSLKLD-NFKALIN 118

Query: 126 SILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            +LRR  REK  LL +      ++ PEWF  +L+  Y   R +  ++    P++I   ++
Sbjct: 119 GVLRRFLREKDSLLAKFDKNWQTLHPEWFVNKLKKAYPNWREIIDANNQRPPMWIRSNIQ 178

Query: 184 -----------FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                       D+     +     +P   I L   P  +  L  F +G   VQDA A  
Sbjct: 179 RIKPQDYRVLLGDLVAKNSENMTACVPESAILLAN-PVPVNKLMNFEQGWATVQDAHAQW 237

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYA 290
              L    N   +LD CAAPGGKT  ++ +   AKV ALD+ + RL+++R NL RL   A
Sbjct: 238 SAALLEAQNGELILDACAAPGGKTTHILEAAPQAKVIALDIEESRLKRVRENLARLGQTA 297

Query: 291 EDIIEMDAFDYCPKK------LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
             +I  DA    P +      +FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q
Sbjct: 298 -TVICGDASK--PAEWLDDGVMFDRILLDAPCSATGVIRRHPDIKWLRKENDIAELVALQ 354

Query: 345 RKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEVVQKVLRSS 384
            K+L      +KP G++V++ CS L +++ E++ + V   S
Sbjct: 355 EKILEALWGRLKPRGVLVYATCSVLPEENGEQITRFVASHS 395


>gi|74316034|ref|YP_313774.1| Fmu, rRNA SAM-dependent methyltransferase [Thiobacillus
           denitrificans ATCC 25259]
 gi|74055529|gb|AAZ95969.1| Fmu, rRNA SAM-dependent methyltransferase [Thiobacillus
           denitrificans ATCC 25259]
          Length = 418

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 126/388 (32%), Positives = 198/388 (51%), Gaps = 33/388 (8%)

Query: 19  MRK--RISLTCLLDLEYGDSAFRLLSQRDQIL--------VRAIVNVTLRFLPRIDAVLD 68
           MRK  +I+   L D+  G +  ++L    ++L        ++ +V  +LR L RIDA LD
Sbjct: 1   MRKLQKIAADALEDVLAGAALHQVLPAGQRLLTTPGERGALQDLVYGSLRQLGRIDAWLD 60

Query: 69  FVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSIL 128
            +L    P     L+ LLR+++ Q+ Y     +A+V  AV  A           L N++L
Sbjct: 61  ALL--ERPLTDPHLESLLRIALYQMAYTRAPAHAIVHNAVSAAGGGWRR----GLANAVL 114

Query: 129 RRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKERVLAISDACI--SPLYIDLTV 182
           R   R + EL      +       PEW+ E+L   Y  ER  AI  A +   P  + ++ 
Sbjct: 115 RNFQRRRAELDALAEAKPGARWSHPEWWIEKLRAAY-PERWQAILAASLLHPPFTLRVSS 173

Query: 183 KF-DIETWAHKLNAVMLPT--GGIRLKELPESIVS--LPGFAEGVWWVQDASASIPVQLF 237
           +  D+ ++  +LN   LP    G +   L +++    LPGFAEG   VQDA A    +L 
Sbjct: 174 RHGDVASYLAELNEAGLPAHRSGQQAVTLEKAVPVQLLPGFAEGRVSVQDAGAQHAARLL 233

Query: 238 GTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEM 296
           G      VLD CAAPGGKT  ++ ++   + ALDV   RL +++ NLDRL L+A  ++E 
Sbjct: 234 GAKPGERVLDACAAPGGKTGHILELADVDLVALDVDAARLARVQENLDRLRLHAT-LVEG 292

Query: 297 DAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
           DA     +   + FD +L D PCS++G +RR+PD+ W R   DI + A  Q  ++     
Sbjct: 293 DAARPEAWWDGRPFDRILADVPCSASGVVRRNPDIKWLRRPGDIAQFAAQQAVIVEALWR 352

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVL 381
            ++PGG ++++ CS+  +++E  VQ  L
Sbjct: 353 LLRPGGTLLYATCSIFHEENEGQVQAFL 380


>gi|172035456|ref|YP_001801957.1| Fmu, rRNA SAM-dependent methyltransferase [Cyanothece sp. ATCC
           51142]
 gi|171696910|gb|ACB49891.1| Fmu, rRNA SAM-dependent methyltransferase [Cyanothece sp. ATCC
           51142]
          Length = 452

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 130/461 (28%), Positives = 219/461 (47%), Gaps = 44/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR ++  +L  + RK       LD  +  +    L+  D+ L   +V   +R    +D 
Sbjct: 9   NARQLTLDILRQIDRKNSYTDIALDRAFNQTH---LNPSDRSLCTELVYGIIRHQRTLDT 65

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D +      ++   L+++L + + Q+ YLD +   A V+ +V  AK  K NR  + +V
Sbjct: 66  LIDQLGKKKAKQQPPDLRRILHIGLYQLRYLDNIPPSAAVNTSVNLAKEYKLNR-LSGVV 124

Query: 125 NSILRRVSREK----------IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           N ILR+  R               +++IA     P+W  E     +G+     +      
Sbjct: 125 NGILRQYLRSSETDGDPLILPPNPIEKIAIQYSFPDWMIETWVQQWGEATTEQLCHWFNQ 184

Query: 175 PLYIDLTV---KFDIETWAHKL-----NAVMLPT--GGIRLKELPESIVSLPGFAEGVWW 224
              ID+ +   K  +ET   +L     NA   P     +RL+    SI +LPGF +G W 
Sbjct: 185 TPTIDIRINPLKTTLETLQTQLTEAGINATPFPPLPCTLRLQGKIGSIQTLPGFHQGHWT 244

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRC 281
           +QD+SA +   L       +++D CAAPGGKT   A+L+     + A D +  RL+K++ 
Sbjct: 245 IQDSSAQLVSYLLDPQPGETIIDACAAPGGKTTHMAELMGDQGTIIACDRTPSRLKKVQQ 304

Query: 282 NLDRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           N  RL L +   I  D+  + P+     D VLVD PCS  GT+ RHPD+ W +  + I +
Sbjct: 305 NAQRLQLNSIQTILGDS-RHLPQLINTADRVLVDVPCSGLGTLHRHPDIRWRQTPEKIQE 363

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            +  Q+++L Q   +VKP G +V++ C+L+  +++++++  L   P    L P  S +W 
Sbjct: 364 LSRLQQEILTQAAQWVKPQGTLVYATCTLNPTENQQIIESFLTHHPQ-WNLKP-PSVHWL 421

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
               +  ++   WI+I P             DGFF V L++
Sbjct: 422 ---FSPFMTSSKWIQILPH--------EHHTDGFFMVKLKK 451


>gi|307822766|ref|ZP_07652997.1| sun protein [Methylobacter tundripaludum SV96]
 gi|307736370|gb|EFO07216.1| sun protein [Methylobacter tundripaludum SV96]
          Length = 435

 Score =  157 bits (397), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 136/456 (29%), Positives = 230/456 (50%), Gaps = 54/456 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAF-RLLSQRDQILVRAIVNVTLRFLPRI 63
           MN RLV++ +LS V++   SLT  LD     +AF  + S +D+  ++A+     R   R+
Sbjct: 1   MNTRLVAARVLSRVLQDGQSLTAALD-----NAFPSIESSKDRAFIQALCYGVCRQYHRL 55

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK- 122
           D +L  +L    P K   ++ L  V + Q+ ++ V  +A V   V  A++    + +AK 
Sbjct: 56  DFILSQLL--DKPLKDTDVKSLALVGLYQLKFMRVKPHAAVSETVLAARK----KPWAKS 109

Query: 123 LVNSILRRVSREKIELLQR-----IAGISIIPEWFKERLENFYGKERV-LAISDACISPL 176
           L+N++LR   RE+  L  +     +A +S  P+W  +++E  + ++ + + + +    P+
Sbjct: 110 LINAVLRTYLREQEGLEHKADKCQVAALSH-PDWLIKQIEQDWPEQALNIFLENNQQPPM 168

Query: 177 -------------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVW 223
                        Y+ L    DI         V      IRL + P  +  LPGF++G+ 
Sbjct: 169 VLRVNLSKTSREDYLQLLAGQDIAA-----EPVSFCRSAIRLDK-PVPVDLLPGFSDGLV 222

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLR 280
            VQD +A +   L        VLD+CAAPGGKTA ++ S  ++    A+D+ + R++++ 
Sbjct: 223 SVQDTAAQLAAGLLDVRPGHRVLDVCAAPGGKTAHILESQQQLKELVAVDIDESRMQRVS 282

Query: 281 CNLDRLHLYAEDII--EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
            NL RL+L+A  ++    +   +   K FD +L+DAPCS+ G IRRHPD+   R  +DI 
Sbjct: 283 ENLQRLNLHATLVVGDAANPASWWDGKPFDRILLDAPCSALGVIRRHPDIKLLRRAEDIG 342

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           +    Q+ +L      + PGG+++++ CS+ KQ++E+ VQ  L      VEL PL S   
Sbjct: 343 QLQALQKNILQAVWPLLAPGGLMLYATCSILKQENEQQVQAFLAEHSDAVEL-PLFS--- 398

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
              D ++  +  G   I      +I    S MDGF+
Sbjct: 399 ---DSSLGTTAWG---INGACGRQILTGESAMDGFY 428


>gi|67924848|ref|ZP_00518244.1| Fmu, rRNA SAM-dependent methyltransferase [Crocosphaera watsonii WH
           8501]
 gi|67853307|gb|EAM48670.1| Fmu, rRNA SAM-dependent methyltransferase [Crocosphaera watsonii WH
           8501]
          Length = 452

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 137/472 (29%), Positives = 225/472 (47%), Gaps = 60/472 (12%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           S  NAR ++  +L  + RK       L+     S    LS  D+ L   +V   +R    
Sbjct: 6   STSNARQLALKILLKIDRKNSYTDVALNRALNQSN---LSSSDRSLCTELVYGIIRHQRT 62

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +D+++D +      ++  +L+++L + + Q+ YLD +   A V+ +V+ AK +K  R  +
Sbjct: 63  LDSLIDQLGKKKAQQQPPNLRRILHIGLYQLRYLDHIPPSAAVNTSVDLAKDNKLQR-LS 121

Query: 122 KLVNSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
            +VN ILR+  R             + L+++A     P+W  E     +G+E    +   
Sbjct: 122 GVVNGILRQYIRSIQGNHDPLILPNDTLKKLAIQYSFPDWIIETWLQKWGEETTEKMCHW 181

Query: 172 CISPLYIDLTV---KFDIETWAHKLNAV---MLPTG----GIRLKELPESIVSLPGFAEG 221
                 ID+ V   K ++ET   +L +    + P G     +RLK    +I +LPGF++G
Sbjct: 182 FNQSPNIDIRVNPLKTNLETLQTQLTSAGVNVTPLGRFPCALRLKGKIGTIPTLPGFSQG 241

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEK 278
            W VQD SA +           +++D CAAPGGKT   A+L+     + A D +  RL+K
Sbjct: 242 HWTVQDTSAQLVSYFLDPQPGETIIDACAAPGGKTTHIAELMGDQGTIFACDRTPSRLKK 301

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKLF----DAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           ++ N  RL L   + IE    D    + F    D VLVD PCS  GT+ RHPD+ W +  
Sbjct: 302 VQENAQRLEL---NCIETVVGDSRYLQQFINKGDRVLVDVPCSGLGTLHRHPDIRWRQTP 358

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
           ++I +    Q ++L Q   +VKP G +V+S C+L+  +++E++Q  L +           
Sbjct: 359 ENIRELTSLQLEILNQAAQWVKPQGTLVYSTCTLNPPENQEIIQTFLST----------- 407

Query: 395 SAYWK--SIDMAMALSP----EGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            ++WK    +   A SP      WI++ P    K D      DGFF V L++
Sbjct: 408 HSHWKIEPPNPHWAFSPFVTSSQWIQMLP---HKQDS-----DGFFMVKLKK 451


>gi|320195380|gb|EFW70007.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           WV_060327]
          Length = 429

 Score =  157 bits (397), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C K+ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGKQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|91212715|ref|YP_542701.1| 16S rRNA methyltransferase B [Escherichia coli UTI89]
 gi|117625571|ref|YP_858894.1| 16S rRNA methyltransferase B [Escherichia coli APEC O1]
 gi|218560350|ref|YP_002393263.1| 16S rRNA methyltransferase B [Escherichia coli S88]
 gi|237703018|ref|ZP_04533499.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|123265979|sp|Q1R644|RSMB_ECOUT RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493249|sp|A1AGI0|RSMB_ECOK1 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766854|sp|B7MCQ4|RSMB_ECO45 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|91074289|gb|ABE09170.1| SUN protein [Escherichia coli UTI89]
 gi|115514695|gb|ABJ02770.1| Sun protein [Escherichia coli APEC O1]
 gi|218367119|emb|CAR04893.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli S88]
 gi|226902282|gb|EEH88541.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|294490375|gb|ADE89131.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           IHE3034]
 gi|307628323|gb|ADN72627.1| 16S rRNA methyltransferase B [Escherichia coli UM146]
 gi|315284577|gb|EFU44022.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 110-3]
 gi|323950202|gb|EGB46084.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H252]
 gi|323954589|gb|EGB50372.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H263]
          Length = 429

 Score =  157 bits (396), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSM 377


>gi|262273082|ref|ZP_06050899.1| ribosomal RNA small subunit methyltransferase B [Grimontia hollisae
           CIP 101886]
 gi|262222838|gb|EEY74146.1| ribosomal RNA small subunit methyltransferase B [Grimontia hollisae
           CIP 101886]
          Length = 426

 Score =  157 bits (396), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 123/403 (30%), Positives = 200/403 (49%), Gaps = 34/403 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R V++ ++  V+ +  SL+  L       A + ++ RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAVAAQVIYQVVDQGQSLSAALP-----PAQQKVAPRDGALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    LV
Sbjct: 56  SITQSLMDKPLKGKQRVFHHLILVGLYQLSYMRIPAHAAVAETVNATKVLKKPQ-LRGLV 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGK--ERVLAISDACISPLYI 178
           N++LR   R +  L    +   AG    P W    L+  Y    E+V+  +    +P+++
Sbjct: 115 NAVLRSYQRNQETLDAASVAHDAGKYGHPGWLLTLLQQAYPTQWEQVVEANHE-KAPMWL 173

Query: 179 DLTVKFDIETWAHKLNAVMLPTGGIRLKELPES-----------IVSLPGFAEGVWWVQD 227
            +         A+K    +L   GI     PE+           + +LPGF+EG   VQD
Sbjct: 174 RVNRTHHTRE-AYK---ALLDQAGIETSVHPEAEDALKLATPCDVTALPGFSEGWVSVQD 229

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS--GAKVTALDVSKRRLEKLRCNLDR 285
           A+A + V          +LD CAAPGGKT  ++     A V A+DV   RL ++  N+ R
Sbjct: 230 AAAQLAVDYLKPQAGELILDCCAAPGGKTCHILEHEPSANVVAMDVDAARLTRVEDNVKR 289

Query: 286 LHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L A  +I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI +   
Sbjct: 290 LKLKAR-VICGDARTPDEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIDQLVS 348

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q ++L    + +K GG +V++ CS+  Q++ E V+  L  +P
Sbjct: 349 LQSEILDAMWAQLKSGGTLVYATCSVTPQENAEQVKAFLTRTP 391


>gi|330831512|ref|YP_004394464.1| ribosomal RNA small subunit methyltransferase B [Aeromonas veronii
           B565]
 gi|328806648|gb|AEB51847.1| Ribosomal RNA small subunit methyltransferase B [Aeromonas veronii
           B565]
          Length = 430

 Score =  157 bits (396), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 205/412 (49%), Gaps = 32/412 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ ++  V+ +  SL+ +L      +A   ++ RD+ L++ +   TLR+LPR+D
Sbjct: 1   MKTRAQAALVIQQVLDQGQSLSAVLP-----AAQEKVAPRDRALLQELCYGTLRWLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A ++ ++   L  K      L+ V + Q++Y  +  +A V   V   K  K       L+
Sbjct: 56  AAVNEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKLLK-GTSLRGLI 114

Query: 125 NSILRRVSREKIELLQRIAGISII----PEWFKERLENFYGKE-RVLAISDACISPLYI- 178
           N +LR   R    +L RI  +  I    PEW  +RL   Y  E   +  ++    P++I 
Sbjct: 115 NGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYHDEWEFIMEANNQRPPMWIR 174

Query: 179 --------DLTVKFDIETWAHKLNAVMLPTG-GIRLKELPESIVSLPGFAEGVWWVQDAS 229
                   D  +    E     +NAV    G    L E P  +  LPGF  G   VQD +
Sbjct: 175 NNSQRQSRDAMLARMAEA---GINAVAGEEGEDCILLERPCDVTKLPGFEVGDCSVQDGA 231

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK---VTALDVSKRRLEKLRCNLDRL 286
           A     L        VLD CAAPGGKTA L+    K   V A+D  + RL++++ NLDR+
Sbjct: 232 AQQAAALLDPQPGEWVLDACAAPGGKTAHLLERQPKLAGVVAVDADENRLKRVQENLDRI 291

Query: 287 HLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L A+ +I  DA     + P+  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 292 GLTAK-VIHGDAAAPEQWWPEGQFDRILLDAPCSATGVIRRHPDIKWLRRDQDIRELAEL 350

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           QR++L      +K GG ++++ CS+  +++ E ++  L ++    +LVPL+ 
Sbjct: 351 QRRILNALWGKLKSGGTLLYATCSVLPEENREQIRAFLAATK-DAKLVPLHE 401


>gi|254507306|ref|ZP_05119442.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus 16]
 gi|219549766|gb|EED26755.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus 16]
          Length = 426

 Score =  157 bits (396), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 118/396 (29%), Positives = 198/396 (50%), Gaps = 44/396 (11%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGQSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ + L  KK     L+ V + Q+ ++ +  +A V   VE  K  K       L+
Sbjct: 56  SIANELMDNPLKGKKRVFHHLILVGIYQLSFMRIPAHAAVAETVEGTKTLK-GPSLRGLI 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERLENFYGKE-RVLAISDACISPLYI- 178
           N++LR   R++  L ++     AG    P W    L   Y ++   L  ++   +P+++ 
Sbjct: 115 NAVLRSYLRDQEALDEKAVSHNAGKYGHPNWLLNMLRESYPEQWEQLVEANNSKAPMWLR 174

Query: 179 ----------------DLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGV 222
                           D  ++F I   A   +A+ L +        P  +  LPGF  G 
Sbjct: 175 VNRQHHTRDEYLELLKDANIEFSIHPEAE--DAIKLAS--------PCDVTLLPGFDRGW 224

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLR 280
             VQDA+A + V      N   +LD CAAPGGKTA ++      +V A+D   +RL+++ 
Sbjct: 225 VSVQDAAAQLSVNYLQPQNGELILDCCAAPGGKTAHILEHTEDTEVVAIDCDAKRLDRVY 284

Query: 281 CNLDRLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
            NL+RL L A D+I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  +DI
Sbjct: 285 DNLERLQLRA-DVICGDARYPQEWWSGEKFDRILLDAPCSATGVIRRHPDIKWLRRANDI 343

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
              A  Q +++      +K GG +V++ CS+  +++
Sbjct: 344 DALAELQSEIMDAMWGQLKAGGTMVYATCSITPKEN 379


>gi|119773183|ref|YP_925923.1| sun protein [Shewanella amazonensis SB2B]
 gi|119765683|gb|ABL98253.1| sun protein [Shewanella amazonensis SB2B]
          Length = 427

 Score =  157 bits (396), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 129/452 (28%), Positives = 218/452 (48%), Gaps = 40/452 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ + +SL+  L  +       L   +D+ L+  I    +R LP++D
Sbjct: 1   MNIRALAAKAIFDVLERGVSLSVALPTQ----QLWLRDGKDKALLAEICYGVMRSLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  + QLL V   Q+ +  V  +A +    E   R        K+V
Sbjct: 57  KLVSGYMQKPLKGKQRVVHQLLLVGAYQLYFTRVPAHAAISETAEGC-RALGFESLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGK--ERVLAISDACISPLYIDLT 181
           N +LR + R+   L +    +    P W   RL++ Y +  E ++  S     P+++   
Sbjct: 116 NGVLRNIQRQVPPLDESNDTLKYNFPAWIIRRLKDAYPETWENIIEASHQ-RPPMWLRNN 174

Query: 182 VKF---DIETWA---HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
            +    D    A    +++AV  P       E    +  LP FA+G   VQD +A     
Sbjct: 175 RRHQSRDAYLQALSDAEVSAVAGPGEDAICLEFATDVARLPHFADGASSVQDGAAQWAAS 234

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
           L    +   VLD CAAPGGK+  L+ ++  ++ A+D  ++RLE++  NL+RL L A  +I
Sbjct: 235 LLAPRDGELVLDACAAPGGKSCHLLELADIELVAVDFDQKRLERVSQNLERLKLDAR-VI 293

Query: 295 EMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQG 351
             DA D   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q+++L   
Sbjct: 294 HGDAGDIGSWWQGGKFDRILLDAPCSATGVIRRHPDIKWLRQNNDIAELAKLQQQILDNC 353

Query: 352 ISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP-IPVELVPLNSAYWKSIDMAMALSPE 410
             ++KPGG ++++ CS+  +++ E ++  L  +P   +E +P N A    I         
Sbjct: 354 WQWLKPGGTLLYATCSILPEENREQIKAFLERTPDATLETLP-NQANNNDI--------- 403

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           GW +I P            MDGF+   L++ +
Sbjct: 404 GW-QILPG--------QDDMDGFYYARLKKAL 426


>gi|215488588|ref|YP_002331019.1| 16S rRNA methyltransferase B [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312968386|ref|ZP_07782596.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           2362-75]
 gi|254766853|sp|B7UK12|RSMB_ECO27 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|215266660|emb|CAS11099.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312287211|gb|EFR15121.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           2362-75]
 gi|323189106|gb|EFZ74390.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           RN587/1]
          Length = 429

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C K+ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGKQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|85711007|ref|ZP_01042068.1| tRNA and rRNA methylase [Idiomarina baltica OS145]
 gi|85695411|gb|EAQ33348.1| tRNA and rRNA methylase [Idiomarina baltica OS145]
          Length = 437

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 129/403 (32%), Positives = 200/403 (49%), Gaps = 44/403 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G ++R V++  +  V+ +  SLT  L   Y +     LS  D+ L +AI    +R+LP 
Sbjct: 7   TGAHSRAVAAQAIHAVLEQGQSLTQAL-TTYSEQ----LSAEDKRLAQAISYGVMRYLPV 61

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +   +   L   L  K   +Q LL V   Q+  L   D+A V   VE +K  K  +  + 
Sbjct: 62  LTEKVSGKLDKPLKGKNQIIQSLLLVGTYQLFKLRTKDHAAVSATVEASKLLK-RKALSG 120

Query: 123 LVNSILRRVSRE--------KIELLQRIAGISIIPEWFKERLENFYGK--ERVLAISDAC 172
           LVN +LR+V RE        + EL     G    P W +E++   YG+  E V   +D+ 
Sbjct: 121 LVNGVLRQVLREAPTRNDDGERELPSAEGGNH--PRWLREKIRAAYGEKAEAVFTANDSQ 178

Query: 173 ISPLYIDLTVKFDIETWAHKLNAVMLPTG-----------GIRLKELPESIVSLPGFAEG 221
             PL++    +    T      A++   G            IRL + P  +  LP F  G
Sbjct: 179 -PPLWLRANRRH---TNVTDYTALLAENGIEAVADSQASDAIRLVK-PVPVTKLPHFEAG 233

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT---ALDVSKRRLEK 278
              VQD SA +   +        VLD CAAPGGKT  L+      T   A+DV ++RLE+
Sbjct: 234 WVSVQDRSAQLAADMVDAQPEHRVLDCCAAPGGKTVHLLERTEFQTPLIAIDVDEQRLER 293

Query: 279 LRCNLDRLHLYAE----DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDT 334
           +  NL R  L  E    D++++D+  +  K+ FD +L+DAPCS+TG IRRHPD+ W R +
Sbjct: 294 VSENLYRADLSCEVVCADVLDLDS--WWDKQPFDRILLDAPCSATGVIRRHPDIKWLRRS 351

Query: 335 DDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS-LDKQDSEEV 376
            DI +    Q+ +L +    +KPGG ++++ CS L +++SE++
Sbjct: 352 SDIDQLVELQQSMLERLWPTLKPGGQLIYATCSILPEENSEQI 394


>gi|315617091|gb|EFU97701.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           3431]
          Length = 429

 Score =  156 bits (395), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y K+ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPKQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKTGGTLVYATCSV 377


>gi|311277757|ref|YP_003939988.1| sun protein [Enterobacter cloacae SCF1]
 gi|308746952|gb|ADO46704.1| sun protein [Enterobacter cloacae SCF1]
          Length = 429

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 114/401 (28%), Positives = 206/401 (51%), Gaps = 25/401 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKHQNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDRALLQELSFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D ++  ++   +  K+ ++  L+ V + Q+L+  +  +A +   VE A   K  +  
Sbjct: 56  PQLDWLITQLMSRPMTGKQRTVHYLIMVGLYQLLHTRIPAHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +R+   Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFATSDSRFLHPDWLVKRIRKAYPQQWQAVLEANNQRPPM 174

Query: 177 YIDLT-VKFDIETW-----AHKLNAVMLP--TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W        L     P     +RL E P S+ +LPGF  G   VQDA
Sbjct: 175 WLRVNRTHHTRDAWLTLLETSGLKGYTHPRYPDAVRL-ETPTSVQALPGFDAGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   ++     N  ++LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMRFLMPENGETILDLCAAPGGKTTHILEVAPEANVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C  + FD +L+DAPCS+TG IRRH D+ W R   DI + A  
Sbjct: 294 GMKAE-VKQGDGRYPSQWCDGRQFDRILLDAPCSATGVIRRHSDIKWLRRDRDIAELALL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           Q ++L      +KPGG +V++ CS+  +++ E +   L+ +
Sbjct: 353 QAQILDAVWPHLKPGGTLVYATCSILPEENAEQIAAFLKRT 393


>gi|191174468|ref|ZP_03035969.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           F11]
 gi|300973968|ref|ZP_07172375.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 200-1]
 gi|306816369|ref|ZP_07450507.1| 16S rRNA methyltransferase B [Escherichia coli NC101]
 gi|190905276|gb|EDV64914.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           F11]
 gi|222034997|emb|CAP77740.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           LF82]
 gi|300308978|gb|EFJ63498.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 200-1]
 gi|305850765|gb|EFM51222.1| 16S rRNA methyltransferase B [Escherichia coli NC101]
 gi|312947839|gb|ADR28666.1| 16S rRNA methyltransferase B [Escherichia coli O83:H1 str. NRG
           857C]
 gi|324014965|gb|EGB84184.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 60-1]
          Length = 429

 Score =  156 bits (395), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|330720125|gb|EGG98529.1| Ribosomal RNA small subunit methyltransferase B [gamma
           proteobacterium IMCC2047]
          Length = 436

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 121/403 (30%), Positives = 212/403 (52%), Gaps = 27/403 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R  ++ +L+ V++ + SL  LL  +       +LS +DQ L++ +     R+ 
Sbjct: 1   MSKRFNLRAHATRILTSVVKNQQSLASLLPYQP-----EILSSQDQALLQELCFGVCRWY 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            R++A +D +L   L  K   ++ LL + + Q+ +  +  +A +   V+  K+ K+    
Sbjct: 56  QRLNAQIDMLLDKPLKAKDTDVKVLLLLGLYQLEFTRIPAHAAISETVQACKQLKKAS-A 114

Query: 121 AKLVNSILRRVSREKIELL----QRIAGISIIPEWFKERLENFYGKE-RVLAISDACISP 175
           + L+N+ILRR  REK  +L    ++   +   P W  +RL+  + +  + +  ++   +P
Sbjct: 115 SGLINAILRRSQREKEAMLDSLNKKTDYLYSHPYWLIKRLKQAWPEHWQQICAANNERAP 174

Query: 176 LYIDLT-VKFDIETWAHKLN-------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
           + + +  ++ +   +  KLN       A      GI L E P ++ +LPGF +G   VQD
Sbjct: 175 MSLRVNALRNNRADYLEKLNNANIKAQASPFSQHGINL-EKPTNVETLPGFTDGQCSVQD 233

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLD 284
            +A +   L     N  VLD CAAPGGKT  L+      A VTAL++   R +++  NL+
Sbjct: 234 EAAQLAATLLQLEPNQRVLDACAAPGGKTCHLLELQPQLASVTALELDADRAQRIHQNLE 293

Query: 285 RLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A  ++E DA     +  ++ +D +L+DAPCS+TG IRRHPD+   R  DDI + A
Sbjct: 294 RLQLSA-TVVEGDASQPNKWWDQQPYDRILLDAPCSATGVIRRHPDIKLLRRDDDITELA 352

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
             Q ++L      +KP GI++++ CS+  +++E+V+   L+  
Sbjct: 353 KLQLQILQALWPLLKPHGILLYATCSVLPEENEQVISTFLKQQ 395


>gi|258626112|ref|ZP_05720963.1| sun protein [Vibrio mimicus VM603]
 gi|258581638|gb|EEW06536.1| sun protein [Vibrio mimicus VM603]
          Length = 438

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 202/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ +L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 13  MNVRAAAASVLYQVVDLGQSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 67

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 68  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 126

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++  L        AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 127 NAVLRNYQRDQERLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 186

Query: 180 LTVKF----DIETWAHKLNAVMLPTGGIR---LKELPESIVSLPGFAEGVWWVQDASASI 232
           +  +     + +T   + +    P            P  +  LPGFAEG   VQDA+A +
Sbjct: 187 VNHQHHNRDEYQTLLEQADLASEPHSQAEDALCLASPCDVNQLPGFAEGWVSVQDAAAQL 246

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL++++ NL RL L A
Sbjct: 247 ALTYLAPKAGELILDCCAAPGGKTAHILERTPDSQVVAIDCDETRLKRVQENLQRLKLNA 306

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++
Sbjct: 307 Q-VICGDARYPQDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDIPALAELQREI 365

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 366 LDAMWQQLKPGGTLVYATCSITPQENSLQVKAFLERTP 403


>gi|192360951|ref|YP_001984033.1| ribosomal RNA small subunit methyltransferase B [Cellvibrio
           japonicus Ueda107]
 gi|190687116|gb|ACE84794.1| ribosomal RNA small subunit methyltransferase B [Cellvibrio
           japonicus Ueda107]
          Length = 432

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 130/452 (28%), Positives = 226/452 (50%), Gaps = 45/452 (9%)

Query: 8   RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVL 67
           R  ++ +L+ ++R++ SL+ LL      +    ++++D+ L++ +     R+ P++ A  
Sbjct: 5   RAAATQVLAQILRQQGSLSSLLP-----AMSVKIAEQDRPLLQQLCFGVCRYYPQLQAYT 59

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSI 127
             +L   L  K   +Q LL + + Q+++  + D+A +   VE   RD +     KLVN +
Sbjct: 60  SLLLDKPLRAKDSDVQALLLLGLYQLIHTRIPDHAAIGETVE-VTRDIKKAWATKLVNGV 118

Query: 128 LRRVSREKIELLQRIAG----ISIIPEWFKERLENFYGKER-VLAISDACISPLYIDLTV 182
           LR+  R++  L +++A      S  P+W +  L   + ++   L  ++    P  + L  
Sbjct: 119 LRQFQRDQQTLGEKLASDRAFSSNHPDWLEGMLRKSWPQQTDSLLAANNEHPPFTLRLNT 178

Query: 183 K-FDIETWAHKLNAVMLPTGGIRLKELPESIV------SLPGFAEGVWWVQDASASIPVQ 235
           +    + +  +L A+ +  G         ++V      SLPGFA+G+  VQD +A +   
Sbjct: 179 RHMSRDDYLAQLRALDIAAGATPFSPYGITLVQACDPRSLPGFAQGLISVQDEAAQLSGD 238

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE-- 291
           L      L VLD C APGGKT  L  I    KVTA+DV +RRL+++R NL RL + A+  
Sbjct: 239 LLQLAPGLRVLDACCAPGGKTGHLLEIEPRMKVTAMDVEERRLQRVRDNLGRLGVTADIR 298

Query: 292 --DIIEMDAF-DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
             D    +A+ D  P   +D +L+DAPCS+TG IRRHPD+   R  ++I + A  Q +LL
Sbjct: 299 CGDGTRPEAWWDGEP---YDRILLDAPCSATGIIRRHPDIKVLRTPEEIARLAQLQGQLL 355

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGGI++++ CS+  +++  VV+  ++  P          A   ++D+   L 
Sbjct: 356 DSLWPLLKPGGILLYATCSVMPRENTRVVEAFIQRQP---------EARCDTLDVPWGLL 406

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                ++ P           G DGF+   LR+
Sbjct: 407 QPCGRQLLPQ--------PEGHDGFYYARLRK 430


>gi|170077132|ref|YP_001733770.1| ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Synechococcus sp.
           PCC 7002]
 gi|169884801|gb|ACA98514.1| ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Synechococcus sp.
           PCC 7002]
          Length = 447

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 128/427 (29%), Positives = 207/427 (48%), Gaps = 43/427 (10%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VA 99
           L+  D+ LV  +V  T+R    +DA++D +    + ++   L+ LL++ + Q+ YLD + 
Sbjct: 35  LTGSDRALVAELVYGTVRRQKTLDAIIDQLGKKPIDQQPPDLRVLLQLGLYQLRYLDQIP 94

Query: 100 DYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREK------IEL----LQRIAGISIIP 149
             A V+ +VE AK +K  +  A +VN  LR   R++      ++L     +R+A     P
Sbjct: 95  PSAAVNTSVEIAKTNKLGQ-LAGVVNGCLRGYLRQRDKGHDPLQLPEAAAERLALQYSFP 153

Query: 150 EWFKERLENFYGKERVLAISDACISPLYIDLTV---KFDIETWAHKLN-------AVMLP 199
           EW   +    +G E    +      P  +DL V   + ++     KLN       A+   
Sbjct: 154 EWLIGQWLEQFGAEETEQLCQWFNRPAQLDLRVNPLRANVAAVQDKLNQAGVKAEAIANL 213

Query: 200 TGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT--- 256
              +RL E    I  LPG+ EG W +QDASA +   L        ++D CAAPGGKT   
Sbjct: 214 PNALRLVEKRGLIQDLPGYKEGWWTIQDASAQLVTHLLDPQPGEVIIDACAAPGGKTTHI 273

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAP 315
           A+ +     + A D  + R+ K+  N  RL L     +  D+  Y   + + D VL+D P
Sbjct: 274 AEKMQDRGTIWASDKYQARINKIEQNARRLKLSMIRTLIGDSRTYSQFRNMADRVLLDVP 333

Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375
           CS  GT+ + PD+ W ++   I +    Q +LL  G ++VKPGG +V++ C+L+  ++E 
Sbjct: 334 CSGLGTLHKRPDIRWQQNPQKIAQLTQLQGELLTTGATWVKPGGYLVYATCTLNPAENEA 393

Query: 376 VVQKVLRSSPIPVELVPLNSAYWKSIDM-AMALSPE-GWIRITPDMLEKIDGVSSGMDGF 433
           +  + L   P   ++VP       S D+ A   + E GWI++ P   +        MDGF
Sbjct: 394 IANQFLVEHP-DWQIVP------PSPDLPAFPYAQEQGWIQVLPQRHD--------MDGF 438

Query: 434 FAVALRR 440
           F V L+R
Sbjct: 439 FMVKLQR 445


>gi|293393280|ref|ZP_06637594.1| RNA methyltransferase Sun [Serratia odorifera DSM 4582]
 gi|291424190|gb|EFE97405.1| RNA methyltransferase Sun [Serratia odorifera DSM 4582]
          Length = 429

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 124/393 (31%), Positives = 207/393 (52%), Gaps = 23/393 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ +  SL+ +L      S  + +S +D+ L++ +   TLR L
Sbjct: 1   MKNNYNLRSIAAQAIGQVLDQGQSLSTILP-----SLQKNISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+ +L  LL V + Q+LY  +  +A +   V  A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPMVGKQRTLHYLLMVGMYQLLYTRIPAHAALAETVNGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ +LLQR A      + P W  +R++  Y ++   +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDQLLQRAANNDSRYLHPSWLLKRIQQAYPEQWEHIVEANNQKPPM 174

Query: 177 YIDLTVKFDIETWAHKL----NAVMLPTGGIR--LKEL-PESIVSLPGFAEGVWWVQDAS 229
           ++ +           KL         P    R  L+ L P ++  LPGFAEG   VQDAS
Sbjct: 175 WLRVNRLHHTRDEYLKLMEQAGIAAAPHAEYRDALRLLSPCAVNELPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++ +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLSRVNENLQRLR 294

Query: 288 LYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
             AE + + D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 FSAE-VKQGDGRTPQQWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELASLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
            +++      +KPGG++V++ CS+  Q++ E V
Sbjct: 354 AEIMDAIWPHLKPGGVMVYATCSILPQENNEQV 386


>gi|218550564|ref|YP_002384355.1| 16S rRNA methyltransferase B [Escherichia fergusonii ATCC 35469]
 gi|254766861|sp|B7LRQ5|RSMB_ESCF3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218358105|emb|CAQ90752.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia
           fergusonii ATCC 35469]
 gi|324111967|gb|EGC05946.1| ribosomal RNA small subunit methyltransferase B [Escherichia
           fergusonii B253]
          Length = 429

 Score =  156 bits (394), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  +  LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GGI++++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGILIYATCSV 377


>gi|289824193|ref|ZP_06543788.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
          Length = 403

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 115/396 (29%), Positives = 203/396 (51%), Gaps = 27/396 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE--RVLAISDACISP 175
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +  R++  ++    P
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQ-RPP 173

Query: 176 LYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQD 227
           +++ +       + W   L    +           +RL E P  + +LPGFAEG   VQD
Sbjct: 174 MWLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRL-ETPAPVHALPGFAEGWVTVQD 232

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA          N   +LDLCAAPGGKT  +  +   A V A+D+ ++RL ++  NL R
Sbjct: 233 ASAQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKR 292

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 293 LGMKA-TVKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 351

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQ 378
            Q ++L      +KPGG +V++ CS+  +++ + ++
Sbjct: 352 LQAEILDAVWPRLKPGGTLVYATCSVLPEENRDQIK 387


>gi|325498857|gb|EGC96716.1| 16S rRNA methyltransferase B [Escherichia fergusonii ECD227]
          Length = 429

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 207/401 (51%), Gaps = 25/401 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFHRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  +  LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           Q ++L      +K GGI++++ CS+  +++   ++  L+ +
Sbjct: 353 QSEILDAIWPHLKSGGILIYATCSVLPEENSLQIKAFLQRT 393


>gi|331659579|ref|ZP_08360517.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA206]
 gi|331052794|gb|EGI24827.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA206]
          Length = 429

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKISDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N ILR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGILRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|126668178|ref|ZP_01739139.1| Fmu, rRNA SAM-dependent methyltransferase [Marinobacter sp. ELB17]
 gi|126627327|gb|EAZ97963.1| Fmu, rRNA SAM-dependent methyltransferase [Marinobacter sp. ELB17]
          Length = 432

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 118/409 (28%), Positives = 199/409 (48%), Gaps = 35/409 (8%)

Query: 49  VRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAV 108
           ++A+   T R+  R+D  L   +   L      +  L+ V++ Q+ +   A YAV++  V
Sbjct: 43  LQALCYGTCRWFHRLDDELQGRMKKPLKNHDRVVHHLMLVALFQLRFSQQATYAVLNETV 102

Query: 109 EQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERL-ENFYGKERVLA 167
           E A R  +  H   LVN +LR   RE      +       P W  E+L  N+    + + 
Sbjct: 103 E-ACRAMDKPHLTGLVNGVLRSAEREGAPAAAKDTSRYSHPGWMIEKLRHNWPDDWQAIV 161

Query: 168 ISDACISPLYIDLT-VKFDIETWAHKL-------NAVMLPTGGIRLKELPESIVSLPGFA 219
            ++   +P+ + +  ++F  + +   L       +A      GI+L   P  + +LP FA
Sbjct: 162 DANNTQAPMTLRVNALRFSRDEYLQLLLDAGIDASATRFAPHGIQLAR-PVPVDALPWFA 220

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRL 276
           EG   VQD +A +   L        +LD CAAPGGKT  ++ S    A+V A+D S +RL
Sbjct: 221 EGAVSVQDEAAQLCTTLLDLAPGQRILDACAAPGGKTCAILESCPQAAEVVAIDESAQRL 280

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
            +++ NLDRL L+A  +++ DA D   +   + FD +L+D PCS++G IRRHPD+   R 
Sbjct: 281 PRVQENLDRLDLHAS-LLQADAADIDQWWDGQPFDRILLDLPCSASGVIRRHPDIKLLRR 339

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
             D+V  A  Q  LL+     ++PGG +V++ CS+  Q++  +VQ+  +      EL+ +
Sbjct: 340 ESDVVPLAQIQLGLLVAMWRILQPGGRLVYATCSVFPQENHRIVQRFCKQQ-TDSELITI 398

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
            + + +++     L P                ++ G DGFF   L + +
Sbjct: 399 EALWGRTMPAGRQLLP----------------LNDGHDGFFYAVLEKPV 431


>gi|82545651|ref|YP_409598.1| 16S rRNA methyltransferase B [Shigella boydii Sb227]
 gi|123728324|sp|Q31VY8|RSMB_SHIBS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|81247062|gb|ABB67770.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|320173933|gb|EFW49109.1| Ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae CDC 74-1112]
          Length = 429

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL +        + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|323966250|gb|EGB61685.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M863]
 gi|327250937|gb|EGE62630.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           STEC_7v]
          Length = 429

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 113/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  +  LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|283788076|ref|YP_003367941.1| ribosomal RNA small subunit methyltransferase B [Citrobacter
           rodentium ICC168]
 gi|282951530|emb|CBG91229.1| ribosomal RNA small subunit methyltransferase B [Citrobacter
           rodentium ICC168]
          Length = 429

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 129/463 (27%), Positives = 224/463 (48%), Gaps = 62/463 (13%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MNKKLNLRSIAAQAVEQVVEQGHSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ +L  L+ V   Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLIGKLMSRPMTGKQRTLHYLIMVGFYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R +  LL   A      + P W  +RL+  + ++   +  ++    P+
Sbjct: 115 KGLINGVLRQFQRNQDALLAEFAHSEARFLHPSWLLKRLQKAWPEQWESIVEANNQRPPM 174

Query: 177 YIDLTVKFDIETWAHKLNA--VMLPTGG------------IRLKELPESIVSLPGFAEGV 222
           ++ +          H  NA   +L   G            +RL + P  + +LPGF +G 
Sbjct: 175 WLRVNRTH------HTRNAWLALLEEAGMKGFTHPDYPDAVRL-DTPVPVHALPGFDKGW 227

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLR 280
              QDASA   V      N   +LDLCAAPGGKT  ++ +   AKV A+DV ++RL ++ 
Sbjct: 228 VTAQDASAQGCVAFLAPQNGEQILDLCAAPGGKTTHILEAAPDAKVLAVDVDEQRLSRVY 287

Query: 281 CNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
            NL RL + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI
Sbjct: 288 DNLKRLGMNA-TVKQGDGRYPLQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDI 346

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            + A  Q ++L      +KPGG +V++ CS+  +++ + ++  L+               
Sbjct: 347 AELAALQAEILDAVWPHLKPGGTLVYATCSVLPEENSQQIKAFLQ--------------- 391

Query: 398 WKSIDMAMALSPEGWIRITPDM--LEKIDGVSSGMDGFFAVAL 438
            ++ D    LS  G    TP++  L+ + G   G DGFF   L
Sbjct: 392 -RTAD--ATLSETG----TPELPGLQNLPGAEEG-DGFFYAKL 426


>gi|158338705|ref|YP_001519882.1| ribosomal RNA small subunit methyltransferase B [Acaryochloris
           marina MBIC11017]
 gi|158308946|gb|ABW30563.1| ribosomal RNA small subunit methyltransferase B [Acaryochloris
           marina MBIC11017]
          Length = 443

 Score =  156 bits (394), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 132/442 (29%), Positives = 208/442 (47%), Gaps = 54/442 (12%)

Query: 33  YGDSAF-----RLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLR 87
           Y D A      + ++  D+ L+  ++  ++R    +DA++D        ++   L+ LL 
Sbjct: 21  YADVALSRVMPKTIADADRRLLTELLYGSVRRQRTLDALIDQFAKKPAHQQPPDLRTLLH 80

Query: 88  VSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIEL-------- 138
           + + Q+ +LD + D A +   VE AK+++ +   +  VN +LR+ +R    L        
Sbjct: 81  LGLYQLRFLDHIPDAAAIFTTVELAKQNQLSG-LSGFVNGLLRQYARAAANLNDPLELPP 139

Query: 139 --LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL---TVKFDIETWAHKL 193
             +Q +  +   P+W  +   +  G E    + D C  P +IDL   ++K D E+   +L
Sbjct: 140 DPIQHLGILYSYPDWIVQVWHDQLGSEETEKLCDYCNQPPHIDLRINSLKTDRESVRSQL 199

Query: 194 NAVMLPTGGIRLKELPES---------IVSLPGFAEGVWWVQDASASIPVQLFGTLNNLS 244
            +  + T    L  LP++         I  LPGF EG+W VQ+ASA +   L        
Sbjct: 200 ASAGVTT--TPLPHLPQALRIEGKSGPIPQLPGFQEGLWTVQEASAQLVGHLLNPQPGAI 257

Query: 245 VLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA--- 298
            LD+CAAPGGKT   A+L+ +  +V A D +  RL KL  N  RL +    I   D+   
Sbjct: 258 ALDVCAAPGGKTTHIAELMENQGEVWACDRTPSRLRKLNQNTQRLGIDTVTIWTGDSRQL 317

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
            ++ P  L D VLVDAPCS  GT+ RH D  W +  D+I   +  Q  LLL     VKPG
Sbjct: 318 SNHIP--LADYVLVDAPCSGLGTLHRHADARWQQTPDNIQDLSTLQLDLLLNSARRVKPG 375

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           GI+++S C+L   ++E ++ + L   P      P+  A W          P+  ++I P 
Sbjct: 376 GILLYSTCTLHPLENENIIDQFLAQMPQWQTQQPI--AEWVPTS-----GPQSSVKILPH 428

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
                      MDGFF   LR+
Sbjct: 429 Q--------QNMDGFFMAILRQ 442


>gi|30064610|ref|NP_838781.1| 16S rRNA methyltransferase B [Shigella flexneri 2a str. 2457T]
 gi|56480310|ref|NP_709076.2| 16S rRNA methyltransferase B [Shigella flexneri 2a str. 301]
 gi|46396790|sp|Q7UBD3|RSMB_SHIFL RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|30042869|gb|AAP18592.1| hypothetical protein S3545 [Shigella flexneri 2a str. 2457T]
 gi|56383861|gb|AAN44783.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|313648789|gb|EFS13229.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           2a str. 2457T]
 gi|332749603|gb|EGJ80020.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-671]
 gi|332749746|gb|EGJ80161.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           4343-70]
 gi|332766528|gb|EGJ96735.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           2930-71]
 gi|332998314|gb|EGK17914.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-218]
 gi|333012367|gb|EGK31748.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-304]
          Length = 429

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +A ++    P+
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRIYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|296104996|ref|YP_003615142.1| 16S rRNA methyltransferase B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059455|gb|ADF64193.1| 16S rRNA methyltransferase B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 438

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 109/363 (30%), Positives = 188/363 (51%), Gaps = 22/363 (6%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           +S +D+ L++ +    LR L +++ +++ ++   +  K+ ++  L+ V   Q+L+  +  
Sbjct: 45  VSDKDKALLQELCFGVLRTLSQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLHTRIPP 104

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLE 157
           +A +   VE A   K  +    L+N +LR+  R++ ELL   A      + P+W   RL+
Sbjct: 105 HAALAETVEGAVAIKRPQ-LKGLINGVLRQFQRQQEELLAEFAKSETRFLHPDWLLNRLK 163

Query: 158 NFYGKERVLAISDACIS--PLYIDLTVKFDI-ETWAHKLNAVMLP-------TGGIRLKE 207
             Y  +R   I+DA     P+++ +       + W   L    +           +RL  
Sbjct: 164 KAY-PQRWQDIADANNQRPPMWLRVNRNHHTRDAWLALLEEAGMSGFAHDAYPDAVRLAS 222

Query: 208 LPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAK 265
            P  + +LPGF EG   VQDASA   +      N   +LDLCAAPGGKT  +  +   A 
Sbjct: 223 -PVPVHALPGFDEGWVTVQDASAQGCMTWLEPKNGEQILDLCAAPGGKTTHILEVAPQAS 281

Query: 266 VTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTI 322
           V A+D+  +RL ++  NL RL + A+ + + D     ++C +  FD +L+DAPCS+TG I
Sbjct: 282 VMAVDIDDQRLSRVYDNLKRLGMKAQ-VKQGDGRKPTEWCGETQFDRILLDAPCSATGVI 340

Query: 323 RRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           RRHPD+ W R   DI + A  Q ++L      +KPGG +V++ CS+  +++ + +   L+
Sbjct: 341 RRHPDIKWLRRDRDIKELAQLQSEILDAIWPHLKPGGTLVYATCSILPEENSQQISAFLK 400

Query: 383 SSP 385
            +P
Sbjct: 401 RTP 403


>gi|15833408|ref|NP_312181.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. Sakai]
 gi|13363627|dbj|BAB37577.1| RNA methyltransferase [Escherichia coli O157:H7 str. Sakai]
          Length = 429

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       +TW   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDTWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|332085437|gb|EGI90603.1| ribosomal RNA small subunit methyltransferase B [Shigella boydii
           5216-82]
          Length = 429

 Score =  155 bits (393), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 110/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTHIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +   +   ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTQHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYANLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG +RRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVVRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|333014516|gb|EGK33864.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-227]
          Length = 454

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/396 (28%), Positives = 206/396 (52%), Gaps = 25/396 (6%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R +++H +  V+ +  SL+ +L         + +S +D+ L++ +    LR L ++D 
Sbjct: 31  NLRSMAAHAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTLSQLDW 85

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +    L+N
Sbjct: 86  LINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-LKGLIN 144

Query: 126 SILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPLYIDLT 181
            +LR+  R + ELL          + P W  +RL+  Y ++ + +A ++    P+++ + 
Sbjct: 145 GVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPPMWLRIN 204

Query: 182 -VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
                 ++W   L+   +           +RL E P  + +LPGF +G   VQDASA   
Sbjct: 205 RTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDASAQGC 263

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAE 291
           +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL + A 
Sbjct: 264 MTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLGMKA- 322

Query: 292 DIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
            + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q ++L
Sbjct: 323 TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQSEIL 382

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
                 +K GG +V++ CS+  +++   ++  L+ +
Sbjct: 383 DAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRT 418


>gi|320666401|gb|EFX33384.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. LSU-61]
          Length = 429

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++ ++  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQVVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYGNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|262402050|ref|ZP_06078614.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. RC586]
 gi|262351696|gb|EEZ00828.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. RC586]
          Length = 426

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 120/398 (30%), Positives = 201/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGQSLSNALP-----TAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + QI ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQISFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   RE+  L        AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQREQERLDAQATSHDAGRYGHPSWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKFDI-ETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +  +    + +   L    + +      E       P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHSRDEYQALLEQAEIASEPHSQAEDALCLVNPCDVNQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL++++ NL RL L A
Sbjct: 235 ALTYLAPKAGELILDCCAAPGGKTAHILERTPDSQVVAIDCDETRLKRVQENLQRLKLNA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++
Sbjct: 295 Q-VICGDARYPQDWWQDEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDIPALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGTLVYATCSITPQENCLQVKAFLERTP 391


>gi|194435072|ref|ZP_03067310.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1012]
 gi|194416679|gb|EDX32810.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1012]
 gi|320182714|gb|EFW57600.1| Ribosomal RNA small subunit methyltransferase B [Shigella boydii
           ATCC 9905]
 gi|332086286|gb|EGI91442.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 155-74]
          Length = 429

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +   +   ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTQHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYANLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|262172810|ref|ZP_06040488.1| ribosomal RNA small subunit methyltransferase B [Vibrio mimicus
           MB-451]
 gi|261893886|gb|EEY39872.1| ribosomal RNA small subunit methyltransferase B [Vibrio mimicus
           MB-451]
          Length = 426

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 201/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGQSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQSLMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++  L        AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQERLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKF----DIETWAHKLNAVMLPTGGIR---LKELPESIVSLPGFAEGVWWVQDASASI 232
           +  +     + +T   + +    P            P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHNRDEYQTLLEQADLASEPHSQAEDALCLASPCDVNQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL++++ NL RL L A
Sbjct: 235 ALTYLAPKAGELILDCCAAPGGKTAHILERTPDSQVVAIDCDETRLKRVQENLQRLKLNA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++
Sbjct: 295 Q-VICGDARYPQDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDIPALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGTLVYATCSITPQENSLQVKAFLERTP 391


>gi|224493306|sp|Q0T014|RSMB_SHIF8 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +A ++    P+
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|167855267|ref|ZP_02478036.1| tryptophanyl-tRNA synthetase [Haemophilus parasuis 29755]
 gi|167853631|gb|EDS24876.1| tryptophanyl-tRNA synthetase [Haemophilus parasuis 29755]
          Length = 432

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 125/408 (30%), Positives = 206/408 (50%), Gaps = 29/408 (7%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           + R V++ ++  V+ +  SL+ L+       A   L  +D   V+       R LPR++A
Sbjct: 5   STRAVTAQIILQVLDQGKSLSTLIP-----EAQSQLDSKDLAWVQETTFGICRVLPRLEA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F  L N
Sbjct: 60  IIKLLVEKPLKNKTRLVHCLLLVGLYQLLYMRVPPHAAVDEVVNSTKVLKLDS-FRALTN 118

Query: 126 SILRRVSREKIELLQRI--AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
            +LRR  RE+  +L ++     ++ PEW   +L+  Y   R +  ++    P++I +  +
Sbjct: 119 GVLRRFLREQEAILAKVDKHWQTLHPEWLVNKLKQAYPNWREIVDANNQKPPMWIRVNAQ 178

Query: 184 -----------FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                       D+    HK     +P   + L +   S+  LP F +G   VQDA A  
Sbjct: 179 RTNRADYVALLGDLAK-NHKEATACVPDCAVLLDK-AVSVSQLPHFKQGWVAVQDAHAQW 236

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRLHLYA 290
             +L    N   +LD CAAPGGKT  ++     AKV ALD+ + RL +++ NL RL+  A
Sbjct: 237 SAELLDAQNGELILDACAAPGGKTTHILEKAPQAKVIALDIEEARLVRVKENLARLNQTA 296

Query: 291 EDIIEMDAFD----YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
             +I  DA          ++FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q K
Sbjct: 297 -TVICGDASQPEQWLTSGEMFDKILLDAPCSATGVIRRHPDIKWLRKEEDIAELAELQGK 355

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLN 394
           +L    + +KP G+++++ CS+  +++ + +Q  L  +P   +LV +N
Sbjct: 356 ILKALWARLKPNGVLLYATCSVLPEENSQQIQHFLAQTP-EAKLVEIN 402


>gi|281180323|dbj|BAI56653.1| putative rRNA methylase [Escherichia coli SE15]
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D  +   +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRNPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|171912374|ref|ZP_02927844.1| RsmB [Verrucomicrobium spinosum DSM 4136]
          Length = 414

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/379 (31%), Positives = 188/379 (49%), Gaps = 43/379 (11%)

Query: 30  DLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVS 89
           DL    +A   L  RD  L++ +V  TLR +  +D  L+ V  +     + S+  LLR+ 
Sbjct: 28  DLIEKAAATHRLDHRDTALLQTLVMGTLRNIDLLDIWLERVCDNQ--HLETSVHWLLRLG 85

Query: 90  VAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGISII- 148
           +AQ+L L++  +AVV+  V QA + +       LVN++LRRV RE+I LL R+  + I  
Sbjct: 86  IAQLLLLEMPAHAVVNETVNQAGKAR------GLVNAVLRRVDRERIPLLARMDRLPIAE 139

Query: 149 ----PEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIR 204
               P W  ER    +GK    A+ +    P    + V        ++L+   L    + 
Sbjct: 140 RTSHPSWLAERWTKQFGKSAAEALCEWDQQPASTYVRV--------NQLHPQPLTPEEV- 190

Query: 205 LKELPESIVSLPGF-----------AEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPG 253
              LP   +S PGF           A G  + QD S  I   L       ++LD CAAPG
Sbjct: 191 ---LPLEPISFPGFFRADTLPREWLASGRCYAQDPSTVIACDLLAPQPGETILDACAAPG 247

Query: 254 GKTA---QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKL---- 306
           GK+A   Q + +  ++   D   RRL++++ NL+RL++   +  ++D     P       
Sbjct: 248 GKSAYLAQKMQNQGRILTCDSVPRRLQRMQQNLERLNVTIAENRQVDWTKPLPPIWKGVQ 307

Query: 307 FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNC 366
            D +L+DAPCS+TG +RR  DV W  D +  V+ A  Q K+L      +K GG +V+S C
Sbjct: 308 VDRILLDAPCSNTGVMRRRVDVRWRLDPEVFVEMAQLQTKILSTLSPLLKSGGSLVYSTC 367

Query: 367 SLDKQDSEEVVQKVLRSSP 385
           SLD++++E+++   L + P
Sbjct: 368 SLDREENEDIIASFLVAHP 386


>gi|289664806|ref|ZP_06486387.1| hypothetical protein XcampvN_17488 [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 436

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 127/402 (31%), Positives = 197/402 (49%), Gaps = 30/402 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           + +G+ +RL ++ +L+ V  +  SL      E   +   +   RD+ LV AI    +R  
Sbjct: 6   VTAGVASRLAAARVLTAVFDQGRSLKT----ELAATLPGIGDPRDRALVEAICFAVIRRR 61

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P  D  L   L   LP +   L+ LL V  AQ+  L +  +A +   V+  +     R  
Sbjct: 62  PAYDVALRQWLERPLPPRDAELKALLMVGFAQLDVLQLPAHAALSATVDACRALGRPRQ- 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           A +VN+ILRR  RE    +   AG    P W +++L   +G +   +  + A ++P+++ 
Sbjct: 121 AGMVNAILRRAQREGFPAVSDDAGW---PSWLRKQLRADWGDRAEGIFTASAQMAPMWLR 177

Query: 180 LTVKFDIETWAHKLNAVMLPTGGIRLKE---LPESI--------VSLPGFAEGVWWVQDA 228
           +  +  I+  A+    V L   GIR      LP+++          LPGFAEG   VQD 
Sbjct: 178 VQ-RSRIDPAAYVARLVEL---GIRAHTDAVLPDAVRLHSAVPVSQLPGFAEGDVSVQDG 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA           +  VLD CAAPGGK A L+    G ++TALDV  RRLE+++  L R 
Sbjct: 234 SAQQVADALTLAPSARVLDACAAPGGKAAHLLERYPGLQLTALDVDARRLERVQQTLQRT 293

Query: 287 HLYAEDIIEMDAFDYCPK----KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
              A+  +              + FDAVL+DAPCS+TG +RR PDVL  R  DDI     
Sbjct: 294 VPNAQVALHAADAADTDAWWDGQPFDAVLLDAPCSATGVVRRQPDVLLHRRADDIDALCA 353

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
            Q +LL      ++PGG ++++ CSL  ++++  V+  L+ +
Sbjct: 354 LQARLLDATWRTLRPGGQLLYTTCSLLARENQTQVEAFLQRT 395


>gi|282895327|ref|ZP_06303529.1| Fmu, rRNA SAM-dependent methyltransferase [Raphidiopsis brookii D9]
 gi|281199633|gb|EFA74493.1| Fmu, rRNA SAM-dependent methyltransferase [Raphidiopsis brookii D9]
          Length = 465

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 131/467 (28%), Positives = 215/467 (46%), Gaps = 63/467 (13%)

Query: 14  LLSCVMRKRISLTCLLDLEYGDSA----------FRLLSQRDQILVRAIVNVTLRFLPRI 63
            +  +  ++I+ T L ++  G  A          F+L S  D+ L+  +V  ++R    +
Sbjct: 19  FMKTLSTRQIAFTALREVHRGAYADIAIDRTLQKFKL-SDHDRRLMTELVYGSVRRQRSL 77

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           DA++D +      ++   L+ +L + + Q+ Y   +   A V+  V+ AK +        
Sbjct: 78  DAIIDQIADKKSQQQPRDLRCILHLGLYQLRYQQKIPVSAAVNTTVQLAKENGFPG-LTG 136

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFY--------------GKERVLAI 168
            VN  LR    + I LL++ +   I+PE   ERL   Y              G+E    +
Sbjct: 137 FVNGFLR----QYIRLLEKTSDPLILPENLVERLGILYSFPNWVIEVWLSQLGQEETEKL 192

Query: 169 SDACISPLYIDLTVKFDIETWAHKLNAVMLPTG-----------GIRLKELPESIVSLPG 217
                    IDL V   +      + +V    G           G+RL      I +LPG
Sbjct: 193 CQWMNQTPTIDLRVNI-LRASLEMVESVFKKAGILVDRIPHLPQGLRLVNPAGPIQNLPG 251

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKR 274
           F EG W +QDA+A +   L        ++D+CAAPGGKT   A+L+    K+ A D +  
Sbjct: 252 FTEGWWCIQDAAAQLVGHLLDPKPGEVIIDVCAAPGGKTTHIAELMGDNGKIYACDRTPS 311

Query: 275 RLEKLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
           RL KL  N  RL L + +I   D+ ++     + D VL+DAPCS  GT+ RH D  W +D
Sbjct: 312 RLRKLSENAQRLRLQSIEIFPGDSRNFTQFHHVADRVLLDAPCSGLGTMHRHADARWRQD 371

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
              +   A  Q++L+     FVKPGG++V++ C+L  Q++E+++++ L  +P   E+   
Sbjct: 372 PSSVGDLAHIQKELISHTAKFVKPGGVLVYATCTLHPQENEDLIREFLHINP-QWEMEKP 430

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           N  +       + +S  GW+++ P            MDGFF V LR+
Sbjct: 431 NFDF-------LDVSSPGWLKLWPH--------QQLMDGFFLVRLRK 462


>gi|258622988|ref|ZP_05718003.1| sun protein [Vibrio mimicus VM573]
 gi|258584771|gb|EEW09505.1| sun protein [Vibrio mimicus VM573]
          Length = 438

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 201/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 13  MNVRAAAASALYQVVDLGQSLSNALP-----AAQQQIRPRDHALLQEICYGVLRQLPRLE 67

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 68  SISQSLMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 126

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++  L        AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 127 NAVLRNYQRDQERLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 186

Query: 180 LTVKF----DIETWAHKLNAVMLPTGGIR---LKELPESIVSLPGFAEGVWWVQDASASI 232
           +  +     + +T   + +    P            P  +  LPGFAEG   VQDA+A +
Sbjct: 187 VNHQHHNRDEYQTLLEQADLASEPHSQAEDALCLASPCDVNQLPGFAEGWVSVQDAAAQL 246

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL++++ NL RL L A
Sbjct: 247 ALTYLAPKAGELILDCCAAPGGKTAHILERTPDSQVVAIDCDETRLKRVQENLQRLKLNA 306

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++
Sbjct: 307 Q-VICGDARYPQDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDIPALAELQREI 365

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 366 LDAMWQQLKPGGTLVYATCSITPQENSLQVKAFLERTP 403


>gi|281602657|gb|ADA75641.1| Ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           2002017]
          Length = 436

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 207/401 (51%), Gaps = 25/401 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 8   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 62

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 63  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 121

Query: 121 AKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +A ++    P+
Sbjct: 122 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPPM 181

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 182 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 240

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 241 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRIYDNLKRL 300

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 301 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 359

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +
Sbjct: 360 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRT 400


>gi|606223|gb|AAA58086.1| we have one ORF, ECFMT has fmu and fmv [Escherichia coli str. K-12
           substr. MG1655]
          Length = 386

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKTGGTLVYATCSV 377


>gi|15803816|ref|NP_289850.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 EDL933]
 gi|168752263|ref|ZP_02777285.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4113]
 gi|168758516|ref|ZP_02783523.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4401]
 gi|168764971|ref|ZP_02789978.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769150|ref|ZP_02794157.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777854|ref|ZP_02802861.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783855|ref|ZP_02808862.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786178|ref|ZP_02811185.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC869]
 gi|168802718|ref|ZP_02827725.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC508]
 gi|195939836|ref|ZP_03085218.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. EC4024]
 gi|208808123|ref|ZP_03250460.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4206]
 gi|208812777|ref|ZP_03254106.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4045]
 gi|208820338|ref|ZP_03260658.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4042]
 gi|209396232|ref|YP_002272745.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4115]
 gi|217326360|ref|ZP_03442444.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. TW14588]
 gi|254795225|ref|YP_003080062.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224593|ref|ZP_05938874.1| 16S rRNA m5C967 methyltransferase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254513|ref|ZP_05947046.1| 16S rRNA m5C967 methyltransferase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|46396973|sp|Q8XEE5|RSMB_ECO57 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493246|sp|B5YT08|RSMB_ECO5E RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|12517918|gb|AAG58410.1|AE005556_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|187767005|gb|EDU30849.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4196]
 gi|188013841|gb|EDU51963.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4113]
 gi|188998877|gb|EDU67863.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4076]
 gi|189354681|gb|EDU73100.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361764|gb|EDU80183.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4486]
 gi|189365121|gb|EDU83537.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4501]
 gi|189373894|gb|EDU92310.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC869]
 gi|189375353|gb|EDU93769.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC508]
 gi|208727924|gb|EDZ77525.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4206]
 gi|208734054|gb|EDZ82741.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4045]
 gi|208740461|gb|EDZ88143.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4042]
 gi|209157632|gb|ACI35065.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4115]
 gi|209757340|gb|ACI76982.1| RNA methyltransferase [Escherichia coli]
 gi|209757342|gb|ACI76983.1| RNA methyltransferase [Escherichia coli]
 gi|209757346|gb|ACI76985.1| RNA methyltransferase [Escherichia coli]
 gi|217322581|gb|EEC31005.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. TW14588]
 gi|254594625|gb|ACT73986.1| 16S rRNA m5C967 methyltransferase [Escherichia coli O157:H7 str.
           TW14359]
 gi|320191677|gb|EFW66327.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC1212]
 gi|320639593|gb|EFX09187.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. G5101]
 gi|326342537|gb|EGD66311.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. 1044]
 gi|326344524|gb|EGD68273.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. 1125]
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 198/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       +TW   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDTWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|315297154|gb|EFU56434.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 16-3]
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|262166812|ref|ZP_06034549.1| ribosomal RNA small subunit methyltransferase B [Vibrio mimicus
           VM223]
 gi|262026528|gb|EEY45196.1| ribosomal RNA small subunit methyltransferase B [Vibrio mimicus
           VM223]
          Length = 426

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 118/398 (29%), Positives = 201/398 (50%), Gaps = 24/398 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++  L  V+    SL+  L      +A + +  RD  L++ I    LR LPR++
Sbjct: 1   MNVRAAAASALYQVVDLGQSLSNALP-----TAQQQIRPRDHALLQEICYGVLRQLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+ D +      L+
Sbjct: 56  SISQALMEKPLKGKQRVFHFLILVGLYQLSFMRIPAHAAVGETVEGAQ-DLKGPRLRGLI 114

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPLYID 179
           N++LR   R++  L        AG    P W  + L+  Y ++ + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRDQERLDAQATSHDAGRYGHPGWLLKLLKESYPEQWQQIVEANNSKAPMWLR 174

Query: 180 LTVKF----DIETWAHKLNAVMLPTGGIR---LKELPESIVSLPGFAEGVWWVQDASASI 232
           +  +     + +T   + +    P            P  +  LPGFAEG   VQDA+A +
Sbjct: 175 VNHQHHNRDEYQTLLEQADLASEPHSQAEDALCLASPCDVNQLPGFAEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +          +LD CAAPGGKTA ++     ++V A+D  + RL++++ NL RL L A
Sbjct: 235 ALTYLTPKAGELILDCCAAPGGKTAHILEHTPDSQVVAIDCDETRLKRVQENLQRLKLNA 294

Query: 291 EDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           + +I  DA    D+   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++
Sbjct: 295 Q-VICGDARYPQDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDIPALAELQREI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           L      +KPGG +V++ CS+  Q++   V+  L  +P
Sbjct: 354 LDAMWQQLKPGGTLVYATCSITPQENSLQVKAFLERTP 391


>gi|237728623|ref|ZP_04559104.1| 16S rRNA m5C967 methyltransferase [Citrobacter sp. 30_2]
 gi|226909245|gb|EEH95163.1| 16S rRNA m5C967 methyltransferase [Citrobacter sp. 30_2]
          Length = 439

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 116/403 (28%), Positives = 207/403 (51%), Gaps = 27/403 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L      +  + ++ +D+ L++ +    LR L
Sbjct: 11  MKKHLNLRSMTAQAVEQVVEKGQSLSNVLP-----AMQQKVADKDKALLQELCFGVLRTL 65

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V   Q+L+  +  +A +   VE A   K  +  
Sbjct: 66  SQLEWMIQQLMERPMTGKQRTVHYLIMVGFYQLLHTRIPAHAALAETVEGAVVIKRPQ-L 124

Query: 121 AKLVNSILRRVSREKIELLQRIAGISI---IPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL   A   +    P W  +R+++ Y ++   +  ++    P+
Sbjct: 125 KGLINGVLRQFQRRQDELLAEFAQSDLRFLHPSWLVKRIKSAYPQQWEAILEANNQRPPM 184

Query: 177 YIDLTVKFDI-ETWAHKLNAVMLPTG--------GIRLKELPESIVSLPGFAEGVWWVQD 227
           ++ +       + W   L    L TG         +RL E P  + +LPGF EG   VQD
Sbjct: 185 WLRVNRNHHTRDAWLDLLTEAGL-TGFPHPDYPDAVRL-ETPAPVHALPGFDEGWVTVQD 242

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDR 285
           ASA   V      +   +LDLC APGGKT  +  +   A V A+DV ++RL ++  NL R
Sbjct: 243 ASAQGCVNYLLPEDGEQILDLCCAPGGKTTHILEVAPLANVMAVDVDEKRLSRVYDNLKR 302

Query: 286 LHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A 
Sbjct: 303 LGMKA-TVKQGDGRYPQQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQ 361

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            Q ++L    S +K GG +V++ CS+  +++++ +   L  +P
Sbjct: 362 LQAEILNATWSHLKSGGTLVYATCSILPEENQQQIAAFLARTP 404


>gi|293412707|ref|ZP_06655375.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B354]
 gi|301018854|ref|ZP_07183093.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 69-1]
 gi|291468354|gb|EFF10847.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B354]
 gi|300399511|gb|EFJ83049.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 69-1]
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMSWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|74313807|ref|YP_312226.1| 16S rRNA methyltransferase B [Shigella sonnei Ss046]
 gi|123759539|sp|Q3YWX1|RSMB_SHISS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|73857284|gb|AAZ89991.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVHDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|16131168|ref|NP_417747.1| 16S rRNA m(5)C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89110722|ref|AP_004502.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. W3110]
 gi|157162762|ref|YP_001460080.1| 16S rRNA methyltransferase B [Escherichia coli HS]
 gi|170018476|ref|YP_001723430.1| 16S rRNA methyltransferase B [Escherichia coli ATCC 8739]
 gi|170082809|ref|YP_001732129.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188493203|ref|ZP_03000473.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           53638]
 gi|194439994|ref|ZP_03072052.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           101-1]
 gi|238902379|ref|YP_002928175.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           BW2952]
 gi|253771888|ref|YP_003034719.1| 16S rRNA methyltransferase B [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038449|ref|ZP_04872505.1| ribosomal RNA small subunit methyltransferase B [Escherichia sp.
           1_1_43]
 gi|254163216|ref|YP_003046324.1| 16S rRNA methyltransferase B [Escherichia coli B str. REL606]
 gi|256025984|ref|ZP_05439849.1| 16S rRNA methyltransferase B [Escherichia sp. 4_1_40B]
 gi|300932181|ref|ZP_07147461.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 187-1]
 gi|300946510|ref|ZP_07160776.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 116-1]
 gi|300955326|ref|ZP_07167708.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 175-1]
 gi|301021178|ref|ZP_07185214.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 196-1]
 gi|301643892|ref|ZP_07243922.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 146-1]
 gi|307139971|ref|ZP_07499327.1| 16S rRNA methyltransferase B [Escherichia coli H736]
 gi|312972450|ref|ZP_07786624.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1827-70]
 gi|331643984|ref|ZP_08345113.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H736]
 gi|1169715|sp|P36929|RSMB_ECOLI RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493247|sp|B1X6E1|RSMB_ECODH RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493248|sp|A8A593|RSMB_ECOHS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493250|sp|B1IQ11|RSMB_ECOLC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|259495485|sp|C4ZUE3|RSMB_ECOBW RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|49259108|pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With
           S- Adenosylmethionine At 2.1 A Resolution
 gi|49259109|pdb|1SQG|A Chain A, The Crystal Structure Of The E. Coli Fmu Apoenzyme At 1.65
           A Resolution
 gi|1772512|emb|CAA71359.1| sun [Escherichia coli str. K-12 substr. MG1655]
 gi|2367212|gb|AAC76314.1| 16S rRNA m(5)C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. MG1655]
 gi|85676753|dbj|BAE78003.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K12 substr. W3110]
 gi|157068442|gb|ABV07697.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           HS]
 gi|169753404|gb|ACA76103.1| sun protein [Escherichia coli ATCC 8739]
 gi|169890644|gb|ACB04351.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188488402|gb|EDU63505.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           53638]
 gi|194421046|gb|EDX37075.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           101-1]
 gi|226838955|gb|EEH70978.1| ribosomal RNA small subunit methyltransferase B [Escherichia sp.
           1_1_43]
 gi|238859734|gb|ACR61732.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           BW2952]
 gi|242378815|emb|CAQ33607.1| 16S rRNA m[5]C967 methyltransferase [Escherichia coli BL21(DE3)]
 gi|253322932|gb|ACT27534.1| sun protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975117|gb|ACT40788.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli B
           str. REL606]
 gi|253979273|gb|ACT44943.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           BL21(DE3)]
 gi|260447693|gb|ACX38115.1| sun protein [Escherichia coli DH1]
 gi|299881625|gb|EFI89836.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 196-1]
 gi|300317770|gb|EFJ67554.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 175-1]
 gi|300453816|gb|EFK17436.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 116-1]
 gi|300460065|gb|EFK23558.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 187-1]
 gi|301077735|gb|EFK92541.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 146-1]
 gi|309703700|emb|CBJ03041.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           ETEC H10407]
 gi|310334827|gb|EFQ01032.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1827-70]
 gi|315137864|dbj|BAJ45023.1| 16S rRNA methyltransferase B [Escherichia coli DH1]
 gi|323934513|gb|EGB30921.1| ribosomal RNA small methyltransferase B [Escherichia coli E1520]
 gi|323939290|gb|EGB35502.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E482]
 gi|323959561|gb|EGB55214.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H489]
 gi|323970092|gb|EGB65366.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA007]
 gi|331036278|gb|EGI08504.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H736]
 gi|332345236|gb|AEE58570.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           UMNK88]
          Length = 429

 Score =  155 bits (392), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKTGGTLVYATCSV 377


>gi|157157639|ref|YP_001464756.1| 16S rRNA methyltransferase B [Escherichia coli E24377A]
 gi|193066472|ref|ZP_03047516.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E22]
 gi|193071559|ref|ZP_03052468.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E110019]
 gi|194430276|ref|ZP_03062771.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B171]
 gi|209920754|ref|YP_002294838.1| 16S rRNA methyltransferase B [Escherichia coli SE11]
 gi|218555846|ref|YP_002388759.1| 16S rRNA methyltransferase B [Escherichia coli IAI1]
 gi|218696981|ref|YP_002404648.1| 16S rRNA methyltransferase B [Escherichia coli 55989]
 gi|256020647|ref|ZP_05434512.1| 16S rRNA methyltransferase B [Shigella sp. D9]
 gi|260846086|ref|YP_003223864.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O103:H2 str. 12009]
 gi|293453607|ref|ZP_06664026.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B088]
 gi|300815501|ref|ZP_07095726.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 107-1]
 gi|300822908|ref|ZP_07103044.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 119-7]
 gi|300918263|ref|ZP_07134867.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 115-1]
 gi|300921903|ref|ZP_07138058.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 182-1]
 gi|301325146|ref|ZP_07218678.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 78-1]
 gi|307315133|ref|ZP_07594716.1| sun protein [Escherichia coli W]
 gi|309794564|ref|ZP_07688986.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 145-7]
 gi|331670118|ref|ZP_08370957.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA271]
 gi|331679357|ref|ZP_08380027.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H591]
 gi|332281843|ref|ZP_08394256.1| 16S rRNA m5C967 methyltransferase S-adenosyl-L-methionine-dependent
           [Shigella sp. D9]
 gi|224493245|sp|A7ZSH7|RSMB_ECO24 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766855|sp|B7LHZ0|RSMB_ECO55 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766858|sp|B7M0Z4|RSMB_ECO8A RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766860|sp|B6I202|RSMB_ECOSE RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|157079669|gb|ABV19377.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E24377A]
 gi|192925853|gb|EDV80503.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E22]
 gi|192955147|gb|EDV85641.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E110019]
 gi|194411665|gb|EDX27992.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B171]
 gi|209914013|dbj|BAG79087.1| putative rRNA methylase [Escherichia coli SE11]
 gi|218353713|emb|CAU99984.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           55989]
 gi|218362614|emb|CAR00240.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           IAI1]
 gi|257761233|dbj|BAI32730.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O103:H2 str. 12009]
 gi|291321733|gb|EFE61164.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B088]
 gi|300414524|gb|EFJ97834.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 115-1]
 gi|300421704|gb|EFK05015.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 182-1]
 gi|300524674|gb|EFK45743.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 119-7]
 gi|300532393|gb|EFK53455.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 107-1]
 gi|300847978|gb|EFK75738.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 78-1]
 gi|306905482|gb|EFN36017.1| sun protein [Escherichia coli W]
 gi|308121614|gb|EFO58876.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 145-7]
 gi|315062580|gb|ADT76907.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli W]
 gi|323162967|gb|EFZ48802.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E128010]
 gi|323182767|gb|EFZ68168.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1357]
 gi|323376833|gb|ADX49101.1| sun protein [Escherichia coli KO11]
 gi|323944291|gb|EGB40367.1| ribosomal RNA small methyltransferase B [Escherichia coli H120]
 gi|324017855|gb|EGB87074.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 117-3]
 gi|324116322|gb|EGC10242.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E1167]
 gi|331062180|gb|EGI34100.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA271]
 gi|331072529|gb|EGI43854.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H591]
 gi|332104195|gb|EGJ07541.1| 16S rRNA m5C967 methyltransferase S-adenosyl-L-methionine-dependent
           [Shigella sp. D9]
          Length = 429

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|145629884|ref|ZP_01785676.1| potassium transporter peripheral membrane component [Haemophilus
           influenzae 22.1-21]
 gi|144977738|gb|EDJ87685.1| potassium transporter peripheral membrane component [Haemophilus
           influenzae 22.1-21]
          Length = 450

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 131/414 (31%), Positives = 214/414 (51%), Gaps = 36/414 (8%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + ++ R ++++L+  V+ +  SL+ L+ +++    A      +D  L++ I     R LP
Sbjct: 18  TALSTRAIAANLILQVLDEGKSLSALIPEVQLSVKA------QDLPLLQEICFGVCRVLP 71

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R++ ++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F 
Sbjct: 72  RLEQIIKRLVDKPLKGKTRIVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKSLKSDS-FR 130

Query: 122 KLVNSILRRVSREKIELLQRIAG--ISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
            LVN++LRR  RE+ E+L  I     ++ PEWF ++L+  Y   R +  ++    P+++ 
Sbjct: 131 GLVNAVLRRFLREQDEILAIIDKNWQTLHPEWFVKKLKKAYPNWREIIEANNQKPPMWLR 190

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLK----------ELPESIVSLPGFAEGVWWVQDA 228
           + + K  +ET+       +L   G+ LK          ++P ++  LP F EG   VQD 
Sbjct: 191 VNSQKNALETYR-----TLLEEQGVSLKTSHHPNALCLDIPIAVQKLPHFEEGAVTVQDL 245

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LD CAAPGGKT  ++     A V ALDV   RL+++  NL RL
Sbjct: 246 SAQWAAMLLEPKNEEWILDACAAPGGKTTHILELAPQANVIALDVESHRLKRVEENLARL 305

Query: 287 HLYA----EDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           +  A     D  + D +     K    FD +L+DAPCS+TG IRRHPD+ W R   DI +
Sbjct: 306 NQQAIVVCGDASKPDEWLAEIGKSAVKFDRILLDAPCSATGVIRRHPDIKWLRKETDIAQ 365

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
               QRK+L      +KP G+++++ CS+  +++ E +Q  L +     EL+PL
Sbjct: 366 LVELQRKILSALWEKLKPNGVLLYATCSVLPEENGEQIQAFLNAH-ADAELLPL 418


>gi|323496958|ref|ZP_08101986.1| 16S rRNA methyltransferase B [Vibrio sinaloensis DSM 21326]
 gi|323318032|gb|EGA71015.1| 16S rRNA methyltransferase B [Vibrio sinaloensis DSM 21326]
          Length = 426

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 119/392 (30%), Positives = 198/392 (50%), Gaps = 36/392 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGQSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ + L  KK     L+ V + Q+ ++ +  +A V   VE  K  +       L+
Sbjct: 56  SIANELMDNPLKGKKRVFHHLILVGIYQLSFMRIPAHAAVAETVEGTKTLR-GPSLRGLI 114

Query: 125 NSILRRVSREKIELLQRI----AGISIIPEWFKERL-ENFYGKERVLAISDACISPL--- 176
           N++LR   R++  L ++     AG    P W    L EN+  +   L  ++   +P+   
Sbjct: 115 NAVLRSYLRDQEALDEKAVSHNAGKYGHPNWLLNMLRENYPEQWEQLVDANNSKAPMWLR 174

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     Y++L    +IE   H        +  I+L   P  +  LPGF  G   VQ
Sbjct: 175 VNRQHHTRDEYLELLKDENIEFSVHPE-----ASDAIKLAS-PCDVTLLPGFDRGWVSVQ 228

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + V      +   +LD CAAPGGKTA ++      +V A+D   +RL+++  NL+
Sbjct: 229 DAAAQLSVNYLQPQDGELILDCCAAPGGKTAHILEHTEDTEVVAIDCDVKRLDRVYDNLE 288

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L A D+I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A
Sbjct: 289 RLQLRA-DVICGDARYPQEWWSGEKFDRILLDAPCSATGVIRRHPDIKWLRRANDIDALA 347

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
             Q +++      +K GG +V++ CS+  Q++
Sbjct: 348 ELQSEIMDAMWGQLKDGGTMVYATCSITPQEN 379


>gi|110643527|ref|YP_671257.1| 16S rRNA methyltransferase B [Escherichia coli 536]
 gi|123343554|sp|Q0TCH3|RSMB_ECOL5 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|110345119|gb|ABG71356.1| SUN protein [Escherichia coli 536]
          Length = 429

 Score =  155 bits (391), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCA PGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAGPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|110807136|ref|YP_690656.1| 16S rRNA methyltransferase B [Shigella flexneri 5 str. 8401]
 gi|110616684|gb|ABF05351.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 436

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/401 (28%), Positives = 207/401 (51%), Gaps = 25/401 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 8   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 62

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 63  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 121

Query: 121 AKLVNSILRRVSREKIELLQRIA---GISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R + ELL          + P W  +RL+  Y ++ + +A ++    P+
Sbjct: 122 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYPEQWQSIAEANNQRPPM 181

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 182 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 240

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 241 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 300

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 301 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 359

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +
Sbjct: 360 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRT 400


>gi|323173925|gb|EFZ59553.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           LT-68]
          Length = 429

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKTGGTLVYATCSV 377


>gi|331684931|ref|ZP_08385517.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H299]
 gi|331077302|gb|EGI48514.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H299]
          Length = 429

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 198/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDACYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  +  LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|300903537|ref|ZP_07121459.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 84-1]
 gi|301305498|ref|ZP_07211590.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 124-1]
 gi|300404410|gb|EFJ87948.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 84-1]
 gi|300839193|gb|EFK66953.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 124-1]
 gi|315255872|gb|EFU35840.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 85-1]
          Length = 429

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|26249873|ref|NP_755913.1| 16S rRNA methyltransferase B [Escherichia coli CFT073]
 gi|227883420|ref|ZP_04001225.1| 16S rRNA methyltransferase B [Escherichia coli 83972]
 gi|300979825|ref|ZP_07174727.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 45-1]
 gi|301046059|ref|ZP_07193238.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 185-1]
 gi|46396925|sp|Q8FD12|RSMB_ECOL6 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|26110301|gb|AAN82487.1|AE016767_247 SUN protein [Escherichia coli CFT073]
 gi|227839564|gb|EEJ50030.1| 16S rRNA methyltransferase B [Escherichia coli 83972]
 gi|300301944|gb|EFJ58329.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 185-1]
 gi|300409431|gb|EFJ92969.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 45-1]
 gi|307555376|gb|ADN48151.1| 16S rRNA m5C967 methyltransferase [Escherichia coli ABU 83972]
 gi|315292336|gb|EFU51688.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 153-1]
          Length = 429

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 112/385 (29%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            + D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQSDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|293416707|ref|ZP_06659344.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B185]
 gi|291431283|gb|EFF04268.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B185]
          Length = 429

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 198/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDNWLALLDEAGMKGFPHTDYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|260857409|ref|YP_003231300.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O26:H11 str. 11368]
 gi|260870031|ref|YP_003236433.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O111:H- str. 11128]
 gi|257756058|dbj|BAI27560.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O26:H11 str. 11368]
 gi|257766387|dbj|BAI37882.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O111:H- str. 11128]
 gi|323154126|gb|EFZ40329.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           EPECa14]
 gi|323179175|gb|EFZ64749.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1180]
          Length = 429

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 113/388 (29%), Positives = 201/388 (51%), Gaps = 31/388 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  ++ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQIVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V V Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGVYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS------IIPEWFKERLENFYGKE-RVLAISDACI 173
             L+N +LR+  R++ ELL   AG        + P W  +RL+  Y ++ + +  ++   
Sbjct: 115 KGLINGVLRQFQRQQEELL---AGFYASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQR 171

Query: 174 SPLYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWV 225
            P+++ +       ++W   L+   +           +RL E P  + +LPGF +G   V
Sbjct: 172 PPMWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTV 230

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNL 283
           QDASA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL
Sbjct: 231 QDASAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNL 290

Query: 284 DRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            RL + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + 
Sbjct: 291 KRLGMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPEL 349

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSL 368
           A  Q ++L      +K GG +V++ CS+
Sbjct: 350 AQLQSEILDAIWPHLKSGGTLVYATCSV 377


>gi|145631966|ref|ZP_01787719.1| methionyl-tRNA formyltransferase [Haemophilus influenzae R3021]
 gi|144982380|gb|EDJ89957.1| methionyl-tRNA formyltransferase [Haemophilus influenzae R3021]
          Length = 450

 Score =  155 bits (391), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 130/414 (31%), Positives = 214/414 (51%), Gaps = 36/414 (8%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + ++ R ++++L+  V+ +  SL+ L+ +++    A      +D  L++ I     R LP
Sbjct: 18  TALSTRAIAANLILQVLDEGKSLSALIPEVQLSVKA------QDLPLLQEICFGVCRVLP 71

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R++ ++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F 
Sbjct: 72  RLEQIIKRLVDKPLKGKTRIVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKSLKSDS-FR 130

Query: 122 KLVNSILRRVSREKIELLQRIAG--ISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
            LVN++LRR  RE+ E+L  I     ++ PEWF  +L+  Y   R +  ++    P+++ 
Sbjct: 131 GLVNAVLRRFLREQDEILAIIDKNWQTLHPEWFVNKLKKAYPNWREIIEANNQKPPMWLR 190

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLK----------ELPESIVSLPGFAEGVWWVQDA 228
           + + K  +ET+       +L   G+ LK          ++P ++  LP F EG   VQD 
Sbjct: 191 VNSQKNALETYR-----TLLEEQGVSLKTSHHPNALCLDIPIAVQKLPHFEEGAVTVQDL 245

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LD CAAPGGKT  ++     A V ALDV   RL+++  NL+RL
Sbjct: 246 SAQWAAMLLEPKNEEWILDACAAPGGKTTHILELAPQANVIALDVESHRLKRVEENLERL 305

Query: 287 HLYA----EDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           +  A     D  + D +     K    FD +L+DAPCS+TG IRRHPD+ W R   DI +
Sbjct: 306 NQQAIVVCGDASKPDEWLAEIGKSAVKFDRILLDAPCSATGVIRRHPDIKWLRKETDIAQ 365

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
               Q+K+L      +KP G+++++ CS+  +++ E +Q  L +     EL+PL
Sbjct: 366 LVELQKKILSALWEKLKPNGVLLYATCSVLPEENGEQIQAFLNAH-ADAELLPL 418


>gi|218691575|ref|YP_002399787.1| 16S rRNA methyltransferase B [Escherichia coli ED1a]
 gi|254766857|sp|B7N0S9|RSMB_ECO81 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218429139|emb|CAR09947.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           ED1a]
          Length = 429

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L    S +K GG +V++ CS+
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSV 377


>gi|78049480|ref|YP_365655.1| ribosomal RNA small subunit methyltransferase B [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|78037910|emb|CAJ25655.1| ribosomal RNA small subunit methyltransferase B [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
          Length = 436

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 203/412 (49%), Gaps = 29/412 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ +RL ++ +L+ V  +  SL      E   +   +   RD+ LV AI    +R  P 
Sbjct: 8   AGVASRLAAARVLTAVFDQGRSLKA----ELAATLPGIGDPRDRALVEAICFAVIRRRPA 63

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D  L   L  +LP +   L+ LL V  AQ+  L +  +A +   V+  +     R  A 
Sbjct: 64  YDVALRQWLERALPPRDAELKALLMVGFAQLDVLQLPAHAALSATVDACRALGRPRQ-AG 122

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAI--SDACISPLYIDL 180
           +VN+ILRR  RE    +   AG    P W +++L   +G +R  AI  + A ++P+++ +
Sbjct: 123 MVNAILRRAQREGFPAVADDAGW---PSWLRKQLRADWG-DRAEAIFTASAQMAPMWLRV 178

Query: 181 T-VKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
              + D   +  +L           +LP   +RL      +  LPGFAEG   VQD SA 
Sbjct: 179 QRSRTDPARYVARLAELDIVAHTDAVLPDA-VRLHNA-VPVSQLPGFAEGDVSVQDGSAQ 236

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL--- 286
                     +  VLD CAAPGGK A L+    G ++TALDV  RRLE+++  L R    
Sbjct: 237 QVADALTLAPSARVLDACAAPGGKAAHLLERHPGLQLTALDVDARRLERVQQTLQRTVPD 296

Query: 287 -HLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
             +  +     D   +   + FDAVL+DAPCS+TG +RR PDVL  R  DDI      Q 
Sbjct: 297 AQVALQAADAADPDAWWDGRPFDAVLLDAPCSATGVVRRQPDVLLHRRADDIDALCALQA 356

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
           +LL      ++PGG ++++ CSL  ++++  V+  L+ +P   +  PL + +
Sbjct: 357 RLLDATWRTLRPGGQLLYTTCSLLARENQAQVEAFLQRTP-DAQAQPLGAQF 407


>gi|218706896|ref|YP_002414415.1| 16S rRNA methyltransferase B [Escherichia coli UMN026]
 gi|293406886|ref|ZP_06650810.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1412]
 gi|298382627|ref|ZP_06992222.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1302]
 gi|300896636|ref|ZP_07115153.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 198-1]
 gi|331664901|ref|ZP_08365802.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA143]
 gi|254766859|sp|B7NDR0|RSMB_ECOLU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218433993|emb|CAR14910.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           UMN026]
 gi|284923295|emb|CBG36389.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           042]
 gi|291425697|gb|EFE98731.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1412]
 gi|298276463|gb|EFI17981.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1302]
 gi|300359513|gb|EFJ75383.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 198-1]
 gi|331057411|gb|EGI29397.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA143]
          Length = 429

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 198/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDACYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  +  LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG ++++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLIYATCSV 377


>gi|284928897|ref|YP_003421419.1| ribosomal RNA small subunit methyltransferase RsmB [cyanobacterium
           UCYN-A]
 gi|284809356|gb|ADB95061.1| ribosomal RNA small subunit methyltransferase RsmB [cyanobacterium
           UCYN-A]
          Length = 453

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 129/433 (29%), Positives = 216/433 (49%), Gaps = 41/433 (9%)

Query: 35  DSAFRL--LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQ 92
           DSAF+   LS++D+ L   +V   +R    +D+++D +      ++   L+++L + + Q
Sbjct: 29  DSAFKHNELSRQDRGLCTELVYGIIRCQRTLDSLIDQLGNKKSQKQSPVLRRILHIGLYQ 88

Query: 93  ILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILR---RVSRE---KIELLQRIAGI 145
           +LYLD V   A V+ +V+ AK +  N   +K+VN+ILR   RV ++   K+ L +     
Sbjct: 89  LLYLDHVPLSAAVNTSVDLAKNNNLNV-LSKVVNAILREYIRVKKKENCKLILSKDFVNT 147

Query: 146 SII----PEWFKERLENFYGKERVLAISDACISPLYIDL--------TVKFDIETWAHKL 193
           + I    P W  +     +G +  + +         ID+        T +   E     +
Sbjct: 148 TAIKYSFPNWIVKNWYQQWGGDTSVKLCYWFNQSPTIDIRVNVLGKTTQEIKNELIMANV 207

Query: 194 NAVMLPT--GGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAA 251
           N   LP     +RLK     I +LPGF +G W VQD SA +   L       +V+D CAA
Sbjct: 208 NVEYLPHLPCSLRLKGQTGDIKNLPGFIKGDWTVQDISAQLVSYLLDPKIGETVIDACAA 267

Query: 252 PGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA-FDYCPKKLF 307
           PGGKT   A+L+     + A D    RL K++ N++RL L +  +++ D+ +        
Sbjct: 268 PGGKTTHIAELMRDKGLILACDRISSRLTKIQQNIERLKLRSIKLVKGDSRYLQQFNNFA 327

Query: 308 DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCS 367
           D VLVDAPCS  GT+ R+PD+ W +  + I + +  Q+++L +   +VKP G++V+S C+
Sbjct: 328 DRVLVDAPCSGLGTLHRNPDIRWRQTPEKIKQLSIIQQEILDKASKWVKPNGVLVYSTCT 387

Query: 368 LDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVS 427
           L+  ++E +V   L+++P      PL S  +        ++  GW++  P          
Sbjct: 388 LNVSENETIVCNFLKNNPEWNIEKPLFSKLFSPF-----ITSSGWLQTLPH--------E 434

Query: 428 SGMDGFFAVALRR 440
             MDGFF V LR+
Sbjct: 435 HNMDGFFMVKLRK 447


>gi|82778586|ref|YP_404935.1| 16S rRNA methyltransferase B [Shigella dysenteriae Sd197]
 gi|309785611|ref|ZP_07680242.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1617]
 gi|123742076|sp|Q32B61|RSMB_SHIDS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|81242734|gb|ABB63444.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308926731|gb|EFP72207.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1617]
          Length = 429

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMSGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGKHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|319775433|ref|YP_004137921.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Haemophilus
           influenzae F3047]
 gi|317450024|emb|CBY86238.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Haemophilus
           influenzae F3047]
          Length = 451

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 128/407 (31%), Positives = 210/407 (51%), Gaps = 41/407 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + ++ R ++++L+  V+ +  SL+ L+ +++    A      +D  L++ I     R LP
Sbjct: 18  TALSTRAIAANLILQVLDEGKSLSALIPEVQLSVKA------QDLPLLQEICFGVCRVLP 71

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R++ ++  V+   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F 
Sbjct: 72  RLEQIIKRVVEKPLKGKTRIVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKSLKSDS-FR 130

Query: 122 KLVNSILRRVSREKIELLQRIAG--ISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
            LVN++LRR  RE+ E+L  I     ++ PEWF  +L+  Y   R +  ++    P++I 
Sbjct: 131 GLVNAVLRRFLREQDEILAIIDKNWQTLHPEWFVNKLKKAYPNWREIIEANNQKPPMWIR 190

Query: 180 L-TVKFDIETW-------------AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
           + + K  +ET+             +H  NA+ L        ++P ++  LP F EG   V
Sbjct: 191 VNSQKNALETYRSLLEEQGVSSKTSHHPNALCL--------DIPIAVQKLPHFEEGAVTV 242

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNL 283
           QD SA     L    N   +LD CAAPGGKT  ++     A V ALDV   RL+++  NL
Sbjct: 243 QDLSAQWAATLLEPKNEEWILDACAAPGGKTTHILELAPQANVIALDVESHRLKRVEENL 302

Query: 284 DRLHLYA----EDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +RL+  A     D  + D +     K    FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 303 ERLNQQAIVVCGDASKPDEWLAEIGKSAAKFDRILLDAPCSATGVIRRHPDIKWLRKETD 362

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS 383
           I +    Q+K+L      +KP G+++++ CS+  +++ E +Q+ L +
Sbjct: 363 IAQLVELQKKILSALWEKLKPNGVLLYATCSVLPEENYEQIQEFLNA 409


>gi|261342758|ref|ZP_05970616.1| ribosomal RNA small subunit methyltransferase B [Enterobacter
           cancerogenus ATCC 35316]
 gi|288314937|gb|EFC53875.1| ribosomal RNA small subunit methyltransferase B [Enterobacter
           cancerogenus ATCC 35316]
          Length = 428

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 108/362 (29%), Positives = 185/362 (51%), Gaps = 20/362 (5%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           +S +D+ L++ +    LR L +++ ++  ++   +  K+ S+  L+ V   Q+L+  +  
Sbjct: 35  VSDKDKALLQELCFGVLRTLSQLEWMISRLMARPMTGKQRSVHYLIMVGFYQLLHTRIPP 94

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLE 157
           +A +   VE A   K  +    L+N +LR+  R++ ELL   A      + P+W   RL+
Sbjct: 95  HAALAETVEGAIAIKRPQ-LKGLINGVLRQFQRQQEELLAEFAQTEKRFLHPDWLLNRLK 153

Query: 158 NFYGKE-RVLAISDACISPLYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKEL 208
             Y  + + +A ++    P+++ +       + W   L    +           +RL   
Sbjct: 154 KAYPTQWQAIAEANNQRPPMWLRVNRTHHKRDEWLALLEESGMSGFIHEAYPDAVRLAS- 212

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKV 266
           P  + +LPGF EG   VQDASA   +      N   +LDLCAAPGGKT  +  +   A V
Sbjct: 213 PAPVHALPGFEEGWVTVQDASAQGCMTWLEPKNGEKILDLCAAPGGKTTHILEVAPQADV 272

Query: 267 TALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIR 323
            A+DV ++RL ++  NL RL + A+ + + D     D+C    FD +L+DAPCS+TG IR
Sbjct: 273 LAVDVDEQRLSRVYDNLKRLGMKAQ-VKQGDGRTPADWCGNTQFDRILLDAPCSATGVIR 331

Query: 324 RHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS 383
           RHPD+ W R   DI + A  Q  +L      +K GG +V++ CS+  +++ + +   L+ 
Sbjct: 332 RHPDIKWLRRDRDIKELAQLQSDILDAIWPHLKAGGTLVYATCSVLPEENSQQIAAFLKR 391

Query: 384 SP 385
           +P
Sbjct: 392 TP 393


>gi|218702051|ref|YP_002409680.1| 16S rRNA methyltransferase B [Escherichia coli IAI39]
 gi|300935286|ref|ZP_07150297.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 21-1]
 gi|254766856|sp|B7NLK8|RSMB_ECO7I RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218372037|emb|CAR19897.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           IAI39]
 gi|300459489|gb|EFK22982.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 21-1]
          Length = 429

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           ++L E P  + +LPGF EG   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQL-ETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|325926148|ref|ZP_08187509.1| ribosomal RNA small subunit methyltransferase RsmB [Xanthomonas
           perforans 91-118]
 gi|325543493|gb|EGD14915.1| ribosomal RNA small subunit methyltransferase RsmB [Xanthomonas
           perforans 91-118]
          Length = 436

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 130/412 (31%), Positives = 203/412 (49%), Gaps = 29/412 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ +RL ++ +L+ V  +  SL      E   +   +   RD+ LV AI    +R  P 
Sbjct: 8   AGVASRLAAARVLTAVFDQGRSLKA----ELAATLPGIGDPRDRALVEAICFAVIRRRPA 63

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            D  L   L  +LP +   L+ LL V  AQ+  L +  +A +   V+  +     R  A 
Sbjct: 64  YDIALRQWLERALPPRDAELKALLMVGFAQLDVLQLPAHAALSATVDACRALGRPRQ-AG 122

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAI--SDACISPLYIDL 180
           +VN+ILRR  RE    +   AG    P W +++L   +G +R  AI  + A ++P+++ +
Sbjct: 123 MVNAILRRAQREGFPAVADDAGW---PSWLRKQLRADWG-DRAEAIFTASAQMAPMWLRV 178

Query: 181 T-VKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
              + D   +  +L           +LP   +RL      +  LPGFAEG   VQD SA 
Sbjct: 179 QRSRTDPARYVARLAELDIVAHTDAVLPDA-VRLHNA-VPVSQLPGFAEGDVSVQDGSAQ 236

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL--- 286
                     +  VLD CAAPGGK A L+    G ++TALDV  RRLE+++  L R    
Sbjct: 237 QVADALTLAPSARVLDACAAPGGKAAHLLERHPGLQLTALDVDARRLERVQQTLQRTVPD 296

Query: 287 -HLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
             +  +     D   +   + FDAVL+DAPCS+TG +RR PDVL  R  DDI      Q 
Sbjct: 297 AQVALQAADAADPDAWWDGRPFDAVLLDAPCSATGVVRRQPDVLLHRRADDIDALCALQA 356

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
           +LL      ++PGG ++++ CSL  ++++  V+  L+ +P   +  PL + +
Sbjct: 357 RLLDATWRTLRPGGQLLYTTCSLLARENQAQVEAFLQRTP-DAQAQPLGAQF 407


>gi|325983531|ref|YP_004295933.1| sun protein [Nitrosomonas sp. AL212]
 gi|325533050|gb|ADZ27771.1| sun protein [Nitrosomonas sp. AL212]
          Length = 425

 Score =  154 bits (389), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 117/372 (31%), Positives = 197/372 (52%), Gaps = 21/372 (5%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           LS++ +  V+ +    LRF  ++ AVLD +L    P +  SL  LL VS+ Q+ Y  V  
Sbjct: 35  LSKQQRGAVQDLSYGVLRFYGQLGAVLDILLKK--PLRDKSLCHLLLVSLYQLQYSRVLP 92

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIA----GISIIPEWFKERL 156
           + VVD AV  ++   +      +VN++LR   R++ +LL++ A    G    P+W+ ++L
Sbjct: 93  HTVVDQAVSASRCLVKGSGMQGVVNAVLRNFIRQQEKLLKQAAEKEIGRYSHPQWWVDKL 152

Query: 157 ENFYGKERVLAISDACISPLYIDLTV---KFDIETWA-----HKLNAVMLPTGGIRLKEL 208
              Y  E   AI  A      + L V   K  +E +      + + A +L  G +RL + 
Sbjct: 153 RRQY-PENFAAILSANNKRPPMTLRVNRRKISVEAYCDLLAENGMQAELLWPGALRLSQ- 210

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI-VSGAKVT 267
           P S+ SLPGFA G+  VQDA A +   L    + + VLD CAAPGGK+  L+ ++   ++
Sbjct: 211 PVSVESLPGFAMGLVTVQDAGAQLAAPLLDVHDGMRVLDACAAPGGKSTHLLELANISLS 270

Query: 268 ALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRR 324
            LD   +RL +++ N +RL + +E +I  DA +   +  K+ +D +L D PCS++G + R
Sbjct: 271 VLDNDPQRLIQVQQNFERLRMASERLICGDAANPDAWWDKQPYDRILADVPCSASGVVCR 330

Query: 325 HPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           HPD+ W R   D+ K A  Q+ +L      ++  G +++  CS+  +++   ++K L+  
Sbjct: 331 HPDIKWLRRESDLTKFAITQQAILDALWKILRKNGKLLYVTCSVFAEENTMQIEKFLKHH 390

Query: 385 PIPVELVPLNSA 396
               +L PL+ A
Sbjct: 391 SDACQL-PLSVA 401


>gi|331654881|ref|ZP_08355880.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M718]
 gi|331046896|gb|EGI18974.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M718]
          Length = 429

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|209693697|ref|YP_002261625.1| ribosomal RNA small subunit methyltransferase B [Aliivibrio
           salmonicida LFI1238]
 gi|208007648|emb|CAQ77758.1| ribosomal RNA small subunit methyltransferase B [Aliivibrio
           salmonicida LFI1238]
          Length = 444

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 119/403 (29%), Positives = 197/403 (48%), Gaps = 36/403 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L       A   +  RDQ L++ I    LRFLPR++
Sbjct: 19  MNVRAAAAKVIYQVVDQGHSLSSALP-----KAQSEIKPRDQALLQEICYGVLRFLPRLE 73

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +V   ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  +    L+
Sbjct: 74  SVAQSLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKNLKGPK-LRGLI 132

Query: 125 NSILRRVSREKIEL----LQRIAGISIIPEWFKERLENFYGKE-RVLAISDACISPL--- 176
           N +LR   R + EL    +   +G    P W  + L+  Y  +   +  ++   +P+   
Sbjct: 133 NGVLRSYQRSQEELDAKSISHDSGKYGHPGWLLKMLKEAYPTQWESIVEANNSKAPMWLR 192

Query: 177 ----------YIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
                     YI L  K +I    H      L      L +    + +LPGF +G   VQ
Sbjct: 193 VNSQHHTRDEYIALLEKEEIAVTPHSQATDAL------LLDKARDVFTLPGFEKGWVSVQ 246

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNLD 284
           DA+A + V+     +   +LD CAAPGGKTA ++       V A+D  + RL ++  NL+
Sbjct: 247 DAAAQLSVEYLQPQDGELILDCCAAPGGKTAHILERTKNTNVVAIDCDETRLTRVYENLE 306

Query: 285 RLHLYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL+L A+ +I  DA    ++   + FD +L+DAPCS+TG IRRHPD+ W R ++DI   A
Sbjct: 307 RLNLEAK-VICGDARHPEEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRSEDIKALA 365

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
             Q ++       +K GG +V++ CS+  Q++ + V+  L  +
Sbjct: 366 ELQSEIFDAMWLQLKSGGTMVYATCSITPQENGDQVKAFLERT 408


>gi|323974759|gb|EGB69872.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TW10509]
          Length = 456

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 112/401 (27%), Positives = 206/401 (51%), Gaps = 25/401 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 28  MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 82

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 83  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 141

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 142 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 201

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  +  LPGF EG   VQDA
Sbjct: 202 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHVLPGFEEGWVTVQDA 260

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 261 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 320

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 321 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 379

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSS 384
           Q ++L      +K GG ++++ CS+  +++   ++  L+ +
Sbjct: 380 QSEILDAIWPHLKSGGTLIYATCSVLPEENSLQIKAFLQRT 420


>gi|302877269|ref|YP_003845833.1| sun protein [Gallionella capsiferriformans ES-2]
 gi|302580058|gb|ADL54069.1| sun protein [Gallionella capsiferriformans ES-2]
          Length = 421

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 125/395 (31%), Positives = 206/395 (52%), Gaps = 23/395 (5%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N +L ++ ++  VM    +L  +LD      +    +QR    ++ +   TLRF  +++A
Sbjct: 3   NIQLAATQIVQQVMEDGRNLNQVLDESLRRKSVWTPAQR--AALQDLSYGTLRFYGQLNA 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +L+ +L   +   + S   LL V++ Q+ Y   A +AVVD AV  A  D  N     LVN
Sbjct: 61  ILELLLHKHMTDHRISY--LLLVALYQLQYSRAAQHAVVDHAVRSA--DILNPKIRGLVN 116

Query: 126 SILRRVSREKIELLQRIA----GISIIPEWFKERLENFYGKER-VLAISDACISPLYIDL 180
           +ILR   R + +LL + A    G    P+W+ + L   YG     + I+     P+ + +
Sbjct: 117 AILRNFLRNQADLLTQAALKDEGHYSHPQWWIDELRAQYGDAADAILIAGNGHPPMTLRV 176

Query: 181 TVK------FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
             +      +  +  A  + A ++    ++L E P S+  LPGF +G+  VQDA A    
Sbjct: 177 NAQRGSTPDYLAQLAAQDIPARLIGAEALQL-EKPVSVDKLPGFFDGLVSVQDAGAQYAA 235

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIV-SGAKVTALDVSKRRLEKLRCNLDRLHLYAEDI 293
           +L      + VLD CAAPGGKTA ++  +  ++ ALD    RL +++ NL RL L A  +
Sbjct: 236 RLLDAKAGMRVLDACAAPGGKTAHILERADVELLALDKDAARLSRVKENLQRLTLNAA-L 294

Query: 294 IEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
           +  DA    D+   +LF+ +L D PCS+TG +RRHPD+ W R   D+   A  Q ++L  
Sbjct: 295 LTGDAASPSDWWDGRLFERILADVPCSATGVVRRHPDIKWLRRKKDLASFAEQQFEILNA 354

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
               + PGG+++++ CS+ KQ++++VV K L  +P
Sbjct: 355 LWPLLAPGGLLLYATCSVFKQENQQVVDKFLAQTP 389


>gi|320187010|gb|EFW61722.1| Ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           CDC 796-83]
          Length = 429

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 110/385 (28%), Positives = 199/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL +        + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IR HPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRHHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|21244523|ref|NP_644105.1| Sun protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|46396950|sp|Q8PG22|RSMB_XANAC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|21110194|gb|AAM38641.1| Sun protein [Xanthomonas axonopodis pv. citri str. 306]
          Length = 436

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 128/401 (31%), Positives = 200/401 (49%), Gaps = 30/401 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G+ +RL ++ +L+ V  +  SL      E   +   +   RD+ LV AI    +R  P 
Sbjct: 8   AGVASRLAAARVLTAVFDQGRSLKA----ELAATLPGIGDPRDRALVEAICFAVIRRRPA 63

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
            +  L   L  +LP +   L+ LL V  AQ+  L +  +A +   V+  +     R  A 
Sbjct: 64  YEVALRQWLERALPPRDAELKALLMVGFAQLEVLQLPAHAALSATVDACRALGRPRQ-AG 122

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAI--SDACISPLYIDL 180
           +VN+ILRR  RE    +   AG    P W +++L   +G +R  AI  + A ++P+++ +
Sbjct: 123 MVNAILRRAQREGFPAVADDAGW---PSWLRKQLRADWG-DRAEAIFTASAQMAPMWLRV 178

Query: 181 T-VKFDIETWAHKL--------NAVMLPTGGIRLKE-LPESIVSLPGFAEGVWWVQDASA 230
              + D  T+  +L           +LP   +RL   +P  +  LPGFAEG   VQD SA
Sbjct: 179 QRSRTDPATYVARLAELDIVAHTDAVLPDA-VRLHNAVP--VSQLPGFAEGDVSVQDGSA 235

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL-- 286
                      +  VLD CAAPGGK A L+    G ++ ALDV  RRLE+++  L R   
Sbjct: 236 QQVADALTLAPSARVLDACAAPGGKAAHLLERHPGLQLVALDVDARRLERVQQTLQRTVP 295

Query: 287 --HLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
              +  +     D   +   + FDAVL+DAPCS+TG +RR PDVL  R  DDI      Q
Sbjct: 296 NALVALQAADAADTDAWWDGRPFDAVLLDAPCSATGVVRRQPDVLLHRRADDIEALCALQ 355

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
            +LL      ++PGG ++++ CSL  ++++  V+  L+ +P
Sbjct: 356 ARLLDATWRTLRPGGQLLYTTCSLLARENQAQVEAFLQRTP 396


>gi|319785852|ref|YP_004145327.1| sun protein [Pseudoxanthomonas suwonensis 11-1]
 gi|317464364|gb|ADV26096.1| sun protein [Pseudoxanthomonas suwonensis 11-1]
          Length = 451

 Score =  154 bits (389), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 140/457 (30%), Positives = 210/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           +  G+  R+ ++ +L  V+ +  SL      E      RL   RD+ L+ A+V   LR  
Sbjct: 20  LAPGVEVRVHAARVLDAVVNRGRSLKS----ELAPVLPRLADPRDRALLEAVVFAALRGR 75

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            R +A L   +         SL  LL    AQ+  L +  +A +D  VE A R     H 
Sbjct: 76  HRYEAALRGWMAKPPGAGDGSLVALLLAGCAQLDALQLPAHAALDATVE-AARALGRPHQ 134

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS-PLYID 179
           A LVN++LRR  RE        A       W + +LE  + +      + +  + PL++ 
Sbjct: 135 AGLVNALLRRAQREGFPAADPAAAWP---RWLRMKLEAAWPEHAAAVFAASAHAAPLWLR 191

Query: 180 LTVK------FDIETWAHKLNAVMLP--TGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
           +  +      +        ++A + P    G+RL E P  + +LPGF +G+  VQD SA 
Sbjct: 192 VNRRLVGRDEYRARLEEAGISASLDPRLPDGLRLDE-PVPVAALPGFDQGLVAVQDGSAQ 250

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA--KVTALDVSKRRLEKLRCNLDRLHLY 289
                        VLD CAAPGGK A LI      ++ ALDV  RRL ++   L R  L 
Sbjct: 251 QAADALAPEPGARVLDACAAPGGKAAHLIERDPTLELLALDVDPRRLARVEDTLRRGGLL 310

Query: 290 AEDIIEMDAFDYCPKKL------FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            E + ++   D     L      FDA+L+DAPCS+TG +RR PD+L  R  +DI      
Sbjct: 311 GERV-QLRPVDATAPALWWDGFTFDAILLDAPCSATGVVRRQPDILLHRRPEDIGSLVAA 369

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q +LL      ++PGGI++++ CS+  +++   V+  L  +P  V +VPL  A+      
Sbjct: 370 QARLLDAVWPMLRPGGILLYATCSILPEENAGQVEAFLARTPDAV-VVPLPEAF------ 422

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             A  P G  R+T +          GMDGFF   LR+
Sbjct: 423 GHAAGP-GRQRLTGE---------DGMDGFFYARLRK 449


>gi|56964082|ref|YP_175813.1| RNA-binding protein Sun [Bacillus clausii KSM-K16]
 gi|56910325|dbj|BAD64852.1| RNA-binding protein Sun [Bacillus clausii KSM-K16]
          Length = 447

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 132/454 (29%), Positives = 217/454 (47%), Gaps = 49/454 (10%)

Query: 21  KRISLTCLLDLEYGDSAFRLL----------SQRDQILVRAIVNVTLRFLPRIDAVLDFV 70
           + ++L  LL +E   +   LL           +RD  L+  +V  T+     +D  L   
Sbjct: 7   REVALDALLKVEKNQAYSHLLLHSTLTNAGLDKRDSGLLTELVYGTIARKRTLDYYLAPF 66

Query: 71  LISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILR 129
           L S   R  + +  LLR+SV Q+++LD + D AVV  AV  A + + ++  + LVN +LR
Sbjct: 67  LKSGKKRALW-VDVLLRLSVYQMVFLDRIPDRAVVHEAVTIANK-RGHKGISGLVNGVLR 124

Query: 130 RVSREKI-------ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
            + R+ +       + ++R A  +  P+W   R  N YG++  +A+++A   P  + L V
Sbjct: 125 SIQRQGLPNVDAIADPIERAAVQTSHPQWLMARWMNQYGEDDAIAMANANNIPPEVCLRV 184

Query: 183 KFDIETWAHKLNAVMLPTG--GIRLKELPESIVSL--------PGFAEGVWWVQDASASI 232
              ++T A +L A +   G    R K LP+  V +          + +G++  QD ++ +
Sbjct: 185 N-RMKTTAAELVAHLGNEGVEAERSKLLPDLAVIIKKGNPFGGEAYKKGLFTAQDEASML 243

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
             +L G    + VLD CAAPGGKT   A+ +     + ALD+   +++ +     RL L 
Sbjct: 244 VAKLLGPEEGMDVLDACAAPGGKTTHIAEQMNGTGHILALDLHPHKVKLIAEQAARLGLE 303

Query: 290 AEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLL 349
             +    DA     KK ++ VLVDAPC+  G IRR PD+ W++   D+   A  Q  +L 
Sbjct: 304 NIETRAEDARTLQTKKHYNRVLVDAPCTGFGVIRRKPDIRWSKTEKDVKHIANVQAAILA 363

Query: 350 QGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA--- 406
               FVK GG +V+S C+++K+++E  +++ L + P   +       Y +  D   A   
Sbjct: 364 HASQFVKQGGTLVYSTCTIEKEENEHAIERFLDTHP---QFETNERFYGRLPDHIQANGR 420

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            SP G   +  D          G DGFF V L R
Sbjct: 421 FSPLGLTILPHDF---------GTDGFFMVPLTR 445


>gi|170684100|ref|YP_001745551.1| 16S rRNA methyltransferase B [Escherichia coli SMS-3-5]
 gi|224493251|sp|B1LGP5|RSMB_ECOSM RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|170521818|gb|ACB19996.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           SMS-3-5]
          Length = 429

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 198/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       + W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDRWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|187732355|ref|YP_001881972.1| 16S rRNA methyltransferase B [Shigella boydii CDC 3083-94]
 gi|224493269|sp|B2U2Q6|RSMB_SHIB3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|187429347|gb|ACD08621.1| ribosomal RNA small subunit methyltransferase B [Shigella boydii
           CDC 3083-94]
          Length = 429

 Score =  154 bits (388), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 110/385 (28%), Positives = 200/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL +        + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N+  +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNSEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IR HPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRHHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|291284647|ref|YP_003501465.1| Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Escherichia coli
           O55:H7 str. CB9615]
 gi|209757338|gb|ACI76981.1| RNA methyltransferase [Escherichia coli]
 gi|209757344|gb|ACI76984.1| RNA methyltransferase [Escherichia coli]
 gi|290764520|gb|ADD58481.1| Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Escherichia coli
           O55:H7 str. CB9615]
 gi|320645091|gb|EFX14107.1| 16S rRNA methyltransferase B [Escherichia coli O157:H- str. 493-89]
 gi|320650402|gb|EFX18868.1| 16S rRNA methyltransferase B [Escherichia coli O157:H- str. H 2687]
 gi|320661379|gb|EFX28794.1| 16S rRNA methyltransferase B [Escherichia coli O55:H7 str. USDA
           5905]
          Length = 429

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 111/385 (28%), Positives = 198/385 (51%), Gaps = 25/385 (6%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ ELL          + P W  +RL+  Y ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +       ++W   L+   +           +RL E P  + +LPGF +G   VQDA
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT  +  +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSL 368
           Q ++L      +K GG +V++ CS+
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSV 377


>gi|145637960|ref|ZP_01793600.1| potassium transporter peripheral membrane component [Haemophilus
           influenzae PittHH]
 gi|145268851|gb|EDK08814.1| potassium transporter peripheral membrane component [Haemophilus
           influenzae PittHH]
          Length = 450

 Score =  154 bits (388), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 130/417 (31%), Positives = 215/417 (51%), Gaps = 42/417 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLL-DLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + ++ R ++++L+  V+ +  SL+ L+ +++    A      +D  L++ I     R LP
Sbjct: 18  TALSTRAIAANLILQVLDEGKSLSALIPEVQLSVKA------QDLPLLQEICFGVCRVLP 71

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           R++ ++  ++   L  K   +  LL V + Q+LY+ V  +A VD  V   K  K +  F 
Sbjct: 72  RLEQIIKRLVDKPLKGKTRIVHCLLLVGLYQLLYMRVPAHAAVDEVVNATKSLKSDS-FR 130

Query: 122 KLVNSILRRVSREKIELLQRIAG--ISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
            LVN++LRR  RE+ E+L  I     ++ PEWF ++L+  Y   R +  ++    P+++ 
Sbjct: 131 GLVNAVLRRFLREQDEILAIIDKNWQTLHPEWFVKKLKKAYPNWREIIEANNQKPPMWLR 190

Query: 180 L-TVKFDIETW-------------AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
           + + K  +ET+             +H  NA+ L        ++P ++  LP F EG   V
Sbjct: 191 VNSQKNALETYRALLEEQGISAKTSHHPNALCL--------DIPIAVQKLPHFEEGAVTV 242

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLI--VSGAKVTALDVSKRRLEKLRCNL 283
           QD SA     L    N   +LD CAAPGGKT  ++     A V ALDV   RL+++  NL
Sbjct: 243 QDLSAQWAATLLEPKNEEWILDACAAPGGKTTHILELAPQANVIALDVESHRLKRVEENL 302

Query: 284 DRLHLYA----EDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +RL+  A     D  + D +     K    FD +L+DAPCS+TG IRRHPD+ W R   D
Sbjct: 303 ERLNQQAIVVCGDASKPDEWLAEIGKSAVKFDRILLDAPCSATGVIRRHPDIKWLRKETD 362

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
           I +    Q+K+L      +KP G+++++ CS+  +++ E +Q  L +     EL+PL
Sbjct: 363 IAQLVELQKKILSALWEKLKPNGVLLYATCSVLPEENGEQIQAFLNAH-ADAELLPL 418


>gi|312173998|emb|CBX82251.1| Ribosomal RNA small subunit methyltransferase B [Erwinia amylovora
           ATCC BAA-2158]
          Length = 429

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 114/398 (28%), Positives = 211/398 (53%), Gaps = 23/398 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  LV+ +    LR L
Sbjct: 1   MKKMTNLRCIAARTIEQVVEQGQSLSNVLP-----AAQKCVDDKDAALVQELCYGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ V+  ++   +  K+ ++  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWVISKLMSCPMTGKQRAIHFLIMVGLYQLMFTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ +L+Q++       + P+W  ERL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDQLMQQMNDGDQQYLHPKWLLERLKRAWPEQWQQIVAANNQRPPM 174

Query: 177 YIDLTVKFD--------IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  ++         +E    +  +  L    +RL E P ++  LPGF +G   VQDA
Sbjct: 175 WLRVNRQYHSRDAWLALLEESGKQAFSHPLHCDALRL-ESPCTVHQLPGFDQGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    N   +LDLCAAPGGKT  ++ +   A V A+DV  +RL ++  NL RL
Sbjct: 234 SAQGCVALLAPQNGEQILDLCAAPGGKTTHILEAAPQANVLAVDVDAQRLTRITENLQRL 293

Query: 287 HLYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++ AE  +        +C   LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 NMQAEVKLGDGRTPAAWCGDTLFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           +++L      +K GG ++++ CS+  +++   + + L+
Sbjct: 354 QQILDAVWPHLKSGGTMLYATCSVLPEENHLQISQFLQ 391


>gi|292489815|ref|YP_003532705.1| ribosomal RNA small subunit methyltransferase B [Erwinia amylovora
           CFBP1430]
 gi|291555252|emb|CBA23523.1| Ribosomal RNA small subunit methyltransferase B [Erwinia amylovora
           CFBP1430]
          Length = 456

 Score =  153 bits (387), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 114/398 (28%), Positives = 211/398 (53%), Gaps = 23/398 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  LV+ +    LR L
Sbjct: 28  MKKMTNLRCIAARTIEQVVEQGQSLSNVLP-----AAQKCVDDKDAALVQELCYGVLRTL 82

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ V+  ++   +  K+ ++  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 83  PQLEWVISKLMSRPMTGKQRAIHFLIMVGLYQLMFTRIPPHAALAETVEGAVALKRPQ-L 141

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ +L+Q++       + P+W  ERL+  + ++ + +  ++    P+
Sbjct: 142 KGLINGVLRQFQRQQDQLMQQMNDGDQQYLHPKWLLERLKRAWPEQWQQIVAANNQRPPM 201

Query: 177 YIDLTVKFD--------IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  ++         +E    +  +  L    +RL E P ++  LPGF +G   VQDA
Sbjct: 202 WLRVNRQYHSRDAWLALLEESGKQAFSHPLHCDALRL-ESPCTVHQLPGFDQGWVTVQDA 260

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    N   +LDLCAAPGGKT  ++ +   A V A+DV  +RL ++  NL RL
Sbjct: 261 SAQGCVALLAPQNGEQILDLCAAPGGKTTHILEAAPQANVLAVDVDAQRLTRITENLQRL 320

Query: 287 HLYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++ AE  +        +C   LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 321 NMQAEVKLGDGRTPAAWCGDTLFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQ 380

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           +++L      +K GG ++++ CS+  +++   + + L+
Sbjct: 381 QQILDAVWPHLKSGGTMLYATCSVLPEENHLQISQFLQ 418


>gi|332090533|gb|EGI95631.1| ribosomal RNA small subunit methyltransferase B [Shigella boydii
           3594-74]
          Length = 454

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 104/361 (28%), Positives = 191/361 (52%), Gaps = 20/361 (5%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           +S +D+ L++ +    LR L ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  
Sbjct: 61  VSDKDKALLQELCFGVLRTLSQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPP 120

Query: 101 YAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLE 157
           +A +   VE A   K  +    L+N +LR+  R++ ELL +        + P W  +RL+
Sbjct: 121 HAALAETVEGAIAIKRPQ-LKGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQ 179

Query: 158 NFYGKE-RVLAISDACISPLYIDLT-VKFDIETWAHKLNAVMLP-------TGGIRLKEL 208
             Y ++ + +  ++    P+++ +       ++W   L+   +           +RL E 
Sbjct: 180 KAYPEQWQSIVEANNQRPPMWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRL-ET 238

Query: 209 PESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL--IVSGAKV 266
           P  + +LPGF +G   VQDASA   +      N   +LDLCAAPGGKT  +  +   A+V
Sbjct: 239 PAPVHALPGFEDGWVTVQDASAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQV 298

Query: 267 TALDVSKRRLEKLRCNLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIR 323
            A+D+ ++RL ++  NL RL + A  + + D      +C ++ FD +L+DAPCS+TG IR
Sbjct: 299 VAVDIDEQRLSRVYDNLKRLGMKA-TVKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIR 357

Query: 324 RHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS 383
           RHPD+ W R   DI + A  Q ++L      +K GG +V++ CS+  +++   ++  L+ 
Sbjct: 358 RHPDIKWLRRDRDIPELAQLQSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQR 417

Query: 384 S 384
           +
Sbjct: 418 T 418


>gi|292900857|ref|YP_003540226.1| ribosomal RNA small subunit methyltransferase B [Erwinia amylovora
           ATCC 49946]
 gi|291200705|emb|CBJ47838.1| ribosomal RNA small subunit methyltransferase B [Erwinia amylovora
           ATCC 49946]
          Length = 429

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 114/398 (28%), Positives = 211/398 (53%), Gaps = 23/398 (5%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + +  +D  LV+ +    LR L
Sbjct: 1   MKKMTNLRCIAARTIEQVVEQGQSLSNVLP-----AAQKCVDDKDAALVQELCYGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ V+  ++   +  K+ ++  L+ V + Q+++  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWVISKLMSRPMTGKQRAIHFLIMVGLYQLMFTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAGIS---IIPEWFKERLENFYGKE-RVLAISDACISPL 176
             L+N +LR+  R++ +L+Q++       + P+W  ERL+  + ++ + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDQLMQQMNDGDQQYLHPKWLLERLKRAWPEQWQQIVAANNQRPPM 174

Query: 177 YIDLTVKFD--------IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           ++ +  ++         +E    +  +  L    +RL E P ++  LPGF +G   VQDA
Sbjct: 175 WLRVNRQYHSRDAWLALLEESGKQAFSHPLHCDALRL-ESPCTVHQLPGFDQGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSG--AKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    N   +LDLCAAPGGKT  ++ +   A V A+DV  +RL ++  NL RL
Sbjct: 234 SAQGCVALLAPQNGEQILDLCAAPGGKTTHILEAAPQANVLAVDVDAQRLTRITENLQRL 293

Query: 287 HLYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++ AE  +        +C   LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 NMQAEVKLGDGRTPAAWCGDTLFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           +++L      +K GG ++++ CS+  +++   + + L+
Sbjct: 354 QQILDAVWPHLKSGGTMLYATCSVLPEENHLQISQFLQ 391


>gi|26986811|ref|NP_742236.1| sun protein [Pseudomonas putida KT2440]
 gi|46396870|sp|Q88RR3|RSMB_PSEPK RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|24981407|gb|AAN65700.1|AE016196_11 sun protein [Pseudomonas putida KT2440]
          Length = 436

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 130/423 (30%), Positives = 200/423 (47%), Gaps = 51/423 (12%)

Query: 41  LSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVAD 100
           + +RD+ L + +   T R+ PR+D +   +L          +Q LL V + Q+ Y  +  
Sbjct: 32  VDERDRGLTQDLAFGTARWQPRLDLLAAQLLQKPFKAADADVQALLLVGLYQLFYTRIPA 91

Query: 101 YAVVDLAVEQAKRDKENRHFAK-LVNSILRRVSREKIELLQRIAGISII----PEWFKER 155
           +A +   V  A  DK  + +AK L+N++LRR  RE  ELL  +    ++    P W ++ 
Sbjct: 92  HAAIGETVGCA--DKLKKPWAKGLLNAVLRRAQREGEELLAGMERDPVVRTAHPRWLQKA 149

Query: 156 LENFYGKE-RVLAISDACISPL-------------YIDLTVKFDIETWAHKLNAVMLPTG 201
           L+ F+ ++   +  ++    P+             Y+ L  +  I       +A      
Sbjct: 150 LKAFWPEQWEAICAANNAHPPMILRVNRRHHSRDAYLALLAEAGIGA-----SACQYSRD 204

Query: 202 GIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV 261
           GI L E  + +  LPGFAEG   VQD +A +   L        VLD C APGGKT  L+ 
Sbjct: 205 GIVLAEACD-VRGLPGFAEGWVSVQDEAAQLSADLLELAPGQRVLDACCAPGGKTCHLLE 263

Query: 262 SGA--