PSIBLAST alignment of GI: 254780666 and protein with PDB id: 2yxl

gi|186972907|pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450
 Score =  184 bits (467), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 95/413 (23%), Positives = 169/413 (40%), Gaps = 38/413 (9%)

Query: 49  VRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAV 108
           +  I    ++    ID V+  ++  +       L+  LRV+V   L+ D      +    
Sbjct: 53  LTMIFYDIMKKQGLIDKVIKEIVGVTPLILDPWLRAALRVAVDIALFHD-PSSQTIKNLR 111

Query: 109 EQAKRDKENRHFAKLVNSI------LRRVSREKIELLQRIAGISIIPEWFKERLENFYGK 162
            +A     +R    +          +          L+ +    + P W  ER++   G 
Sbjct: 112 WKASDFISSRTHPYVGMYFWDLLDKIFEYKPNPKNELEELEWKYLAPSWLIERVKGILGD 171

Query: 163 ERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPG----- 217
           E             +I + V          +  +      +   E   +I+ + G     
Sbjct: 172 ETEDFFRSVNKRHEWISIRVNTLKANVEEVIGELEEDGVEVVRSERVPTILKIKGPYNFD 231

Query: 218 ----FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALD 270
               F EG   VQ+ ++++   +       +V+DL AAPGGKT  L   + +  K+ A D
Sbjct: 232 TSSAFNEGKIIVQEEASAVASIVLDPKPGETVVDLAAAPGGKTTHLAELMKNKGKIYAFD 291

Query: 271 VSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP---KKLFDAVLVDAPCSSTGTIRRHPD 327
           V K R+++L+  + R+ +     +  DA        +++ D VL+DAPC+S+GTI ++P+
Sbjct: 292 VDKMRMKRLKDFVKRMGIKIVKPLVKDARKAPEIIGEEVADKVLLDAPCTSSGTIGKNPE 351

Query: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIP 387
           + W    D I + +  QR+LL      VKPGG ++++ CS+ K+++E+ ++  L   P  
Sbjct: 352 LRWRLREDKINEMSQLQRELLESAARLVKPGGRLLYTTCSIFKEENEKNIRWFLNVHP-E 410

Query: 388 VELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +LVPL S Y            EG +R  P              GFF   L +
Sbjct: 411 FKLVPLKSPYDPGF-------LEGTMRAWPH--------RHSTIGFFYALLEK 448