BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein
[Candidatus Liberibacter asiaticus str. psy62]
         (445 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040343|gb|ACT57139.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 445

 Score =  332 bits (850), Expect = 9e-89,   Method: Composition-based stats.
 Identities = 445/445 (100%), Positives = 445/445 (100%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL
Sbjct: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF
Sbjct: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL
Sbjct: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL
Sbjct: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD
Sbjct: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI
Sbjct: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML
Sbjct: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420

Query: 421 EKIDGVSSGMDGFFAVALRRLIQPK 445
           EKIDGVSSGMDGFFAVALRRLIQPK
Sbjct: 421 EKIDGVSSGMDGFFAVALRRLIQPK 445


>gi|209551488|ref|YP_002283405.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209537244|gb|ACI57179.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 462

 Score =  314 bits (805), Expect = 1e-83,   Method: Composition-based stats.
 Identities = 227/441 (51%), Positives = 302/441 (68%), Gaps = 4/441 (0%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR  ++ +L  V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR LP
Sbjct: 26  KPGLQARAAAAKILGAVVERKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHLP 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RIDA +  +L S LP    +LQ +L + VAQILYLDV D++ VDLAVEQA +D  NR FA
Sbjct: 86  RIDAAISSLLESPLPEGARALQHVLAIGVAQILYLDVPDHSAVDLAVEQANQDPRNRRFA 145

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK E+L  I  ++ +P WF  RLE  YG++  LAIS++ + P  IDLT
Sbjct: 146 KLVNAVLRRLGREKDEVLGEIDKVAPMPAWFIARLEKAYGRDAALAISESQLQPAAIDLT 205

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +LN V+LPTGG+RL      I SL GF +G WWVQDA+ASIP +LFG L+
Sbjct: 206 VKSDAEGWAKRLNGVVLPTGGVRLAAFDGGIPSLEGFDDGAWWVQDAAASIPAKLFGDLS 265

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
                DLCAAPGGKTAQLI++G  VTALD S+ RL +LR NLDRL L AE I   D   +
Sbjct: 266 GKRAADLCAAPGGKTAQLILAGGAVTALDQSESRLRRLRSNLDRLSLKAETI-AADLTTF 324

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P + FDA+L+DAPCSSTGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP G +
Sbjct: 325 EPAERFDAILLDAPCSSTGTTRRHPDVLWTKGPEDIGRLAALQERLLRHALTLLKPDGTL 384

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EEVV +VL  +   +E V +++  W  ++ A  ++P G  R  P ML+
Sbjct: 385 VFSNCSLDPTEGEEVVARVLADT-DGIERVRIDAGDWPGLEAA--ITPLGEFRTLPTMLK 441

Query: 422 KIDGVSSGMDGFFAVALRRLI 442
             DG++SG+DGF+A  LRR+ 
Sbjct: 442 MPDGIASGLDGFYAAMLRRVA 462


>gi|254502120|ref|ZP_05114271.1| ribosomal RNA small subunit methyltransferase B [Labrenzia
           alexandrii DFL-11]
 gi|222438191|gb|EEE44870.1| ribosomal RNA small subunit methyltransferase B [Labrenzia
           alexandrii DFL-11]
          Length = 468

 Score =  311 bits (797), Expect = 1e-82,   Method: Composition-based stats.
 Identities = 179/439 (40%), Positives = 261/439 (59%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR V++ +L  V+ K+  L   LD+  G S FR L+  D+ LVRAI    LR   
Sbjct: 32  KPGFAARKVAADILGNVVHKKRPLDGELDMASGHSGFRALAANDRALVRAIAGAALRHRG 91

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I  +L  +L   +P K   +  +L V++AQ+ +LD+ D A V LAV+ A  D+  R + 
Sbjct: 92  EITEILGRLLDRDIPEKTGRVLDILHVAIAQMQFLDIPDRAAVSLAVDHASMDRRARPYK 151

Query: 122 KLVNSILRRVSREKIELLQR-IAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+ RE+ E+     A     P+W  E  +  YG+E   AI+ A      +DL
Sbjct: 152 GLVNGVLRRLGRERDEITSDLDAPRLNTPDWLWESWQAAYGEEGARAIAKAHEREAALDL 211

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA KL+ V++  G +RL     ++ +L GF +G WWVQDA+AS+P +L G +
Sbjct: 212 TVKADAAAWAEKLDGVVVGAGSVRL-TKKGAVDALEGFEDGAWWVQDAAASLPAKLLGDV 270

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +   V DLCAAPGGKTAQL   GA++TA+D+SK RL++L  N+ RL L     +  D  +
Sbjct: 271 SGKQVADLCAAPGGKTAQLAAVGAEITAIDISKARLKRLAENMTRLGLS-VTTVAADLRE 329

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P+ LFDA+L+DAPCS+TGTIRRHPDV W +   DI K +  Q  LL + +S++KPGG+
Sbjct: 330 FEPEVLFDAILLDAPCSATGTIRRHPDVPWIKKPYDIEKLSEIQTALLDRVMSWLKPGGV 389

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL++ + E   +  L  +   V LVP++++      +A +++PEG++R  PD  
Sbjct: 390 LVYCTCSLERAEGEGQAEAFLERNKDRVSLVPVDASEIGG--LAESVTPEGYLRCRPDQS 447

Query: 421 EKIDGVSSGMDGFFAVALR 439
              +    GMDGFFA   R
Sbjct: 448 AGPETGLFGMDGFFAARFR 466


>gi|118591346|ref|ZP_01548744.1| SUN protein [Stappia aggregata IAM 12614]
 gi|118436018|gb|EAV42661.1| SUN protein [Stappia aggregata IAM 12614]
          Length = 458

 Score =  311 bits (796), Expect = 2e-82,   Method: Composition-based stats.
 Identities = 180/440 (40%), Positives = 260/440 (59%), Gaps = 5/440 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR V++ +L  V+ K+  L   LD   G S FR L+  D+ LVRAI+   LR   
Sbjct: 22  KPGFAARKVAADILGNVVHKKRPLDGELDTASGHSGFRALAANDRSLVRAIIGAALRHRG 81

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I  +LD +L   +P K   +  +L V++AQ+L+LD+ D A V LAV+ A  D+  R + 
Sbjct: 82  EIAEILDRLLDRPIPEKTGRVLDILHVAIAQMLFLDIPDRAAVSLAVDHAGLDRRARPYK 141

Query: 122 KLVNSILRRVSREKIELLQR-IAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+ RE+ E+     A +   P+W  E  +  YG E    I+ A  +   +DL
Sbjct: 142 GLVNGVLRRLGRERDEVTADLDAAVLNTPDWLMESWQVAYGPETAREIARAHETEAALDL 201

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           +VK D E WA KL+  ++  G +RL     ++ +L G+ +G WWVQDA+A++P +L G +
Sbjct: 202 SVKADPEGWAQKLDGQIVGAGSVRLVR-KGAVDALEGYGDGQWWVQDAAAALPARLLGDV 260

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
             L V DLCAAPGGKTAQL  +GA VTA+D+SK RL++L  N+ RL L   + +  D   
Sbjct: 261 KGLRVADLCAAPGGKTAQLAAAGASVTAVDISKARLKRLEENMTRLGLS-VETVAADLRA 319

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P++ FDA+L+DAPCS+TGTIRRHPDV W +   DI K    Q +LL + + +VKPGG+
Sbjct: 320 FEPEEPFDAILLDAPCSATGTIRRHPDVPWIKKPYDIEKLTEIQSELLDRVVGWVKPGGL 379

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+  + E  V   L      +EL+ + +       +A  ++ EG++R  P   
Sbjct: 380 IVYCTCSLEAAEGEAQVSAFLERQGGKMELIAVEAGEVGG--LAECVTKEGYLRCLPCHS 437

Query: 421 EKIDGVSSGMDGFFAVALRR 440
             +D VS GMDGFFA  LRR
Sbjct: 438 AAVDPVSKGMDGFFAARLRR 457


>gi|134299563|ref|YP_001113059.1| sun protein [Desulfotomaculum reducens MI-1]
 gi|134052263|gb|ABO50234.1| sun protein [Desulfotomaculum reducens MI-1]
          Length = 453

 Score =  306 bits (782), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 120/465 (25%), Positives = 203/465 (43%), Gaps = 39/465 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ ++AR ++  +   V  +       L+          L   D+     IV   LR L
Sbjct: 1   MKN-VSARELALLVSKAVEDEGAYANLALNKLLEQYQPGKL---DRAFATEIVYGVLRNL 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRH 119
             ID VL   L   L  +   ++ +LR+   QI+++  V D A  + +V  AK+   ++ 
Sbjct: 57  NTIDWVLAHFLKQPLASQTVWIRNILRMGTYQIMFMPRVPDSAACNESVNLAKKY-GHQG 115

Query: 120 FAKLVNSILRRVSREKIE---------LLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
             K VN +LR V+R++            +  IA     P W  ER    YG E+ +A+  
Sbjct: 116 APKFVNGVLRNVARQQHSLEFPDSKEAPVDHIALKYSHPTWLVERWLMQYGFEQTIALCQ 175

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKELPESIVS------LPGFAEG 221
           A   P    +         E    +L A  +     +      ++        L  F  G
Sbjct: 176 ANNRPAPNTVRTNTLKISREDLMARLKAEGVEARETKFVPEGLNLSGFLSYRTLKSFQGG 235

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
            + VQD S+ +   +    +   VLD+ +APGGKT  L   +    ++ A D+   +L+ 
Sbjct: 236 FFQVQDESSMLVAHVLNPSSGAKVLDVASAPGGKTTHLAQLMGDSGQIIAFDIYSHKLDL 295

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +  N  RL + +      DA D   K     D VLVDAPCS  G +RR PD  W +D   
Sbjct: 296 IMDNCRRLGIQSIQAEVADARDLHKKYQGWADYVLVDAPCSGLGVLRRRPDSRWRKDPSQ 355

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +      Q+++L      ++PGG++V+S C++ K+++  VV++ L++ P  + +  L   
Sbjct: 356 LPGIVRLQKEILQSAAQCLRPGGVLVYSTCTITKEENIGVVEEFLKNHPEFI-MGDLRQL 414

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +D   + + +G+I++ P +         GMDGFF   LR+ 
Sbjct: 415 LPPGLDEEKS-AEKGYIQLLPHV--------HGMDGFFIARLRKK 450


>gi|195970119|ref|NP_387430.2| putative sun protein [Sinorhizobium meliloti 1021]
 gi|307302539|ref|ZP_07582296.1| Fmu (Sun) domain protein [Sinorhizobium meliloti BL225C]
 gi|187904238|emb|CAC47903.2| Hypothetical Sun protein [Sinorhizobium meliloti 1021]
 gi|306903209|gb|EFN33799.1| Fmu (Sun) domain protein [Sinorhizobium meliloti BL225C]
          Length = 470

 Score =  305 bits (781), Expect = 7e-81,   Method: Composition-based stats.
 Identities = 217/439 (49%), Positives = 299/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ ++  L  +LD E G+ A+R LS+ D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVVDRKTPLDGMLDPERGNPAYRELSEADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+  QILYLDV D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAATQILYLDVPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK E+L+++  +  +P WF +RL   YG ++   IS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKEEILEKLRQVPAMPGWFFDRLVACYGPDQAERISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D  +WA +L   +LPTG +RL+E   SI SL GF+EG WWVQDA+ASIP +LFG ++
Sbjct: 214 VKSDAASWAERLAGTVLPTGSVRLQEFSGSIPSLSGFSEGAWWVQDAAASIPARLFGDIS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQL+++GA+VTALD S  RL +L+ NL+RL   A    E D  ++
Sbjct: 274 GKKVVDLCAAPGGKTAQLVLAGAEVTALDQSSSRLRRLKANLERLGFEA-RTKESDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ VKPGG++
Sbjct: 333 RPEELFDAALLDAPCSSTGTTRRHPDVLWTKGPQDVEKLARLQERLLRHALTLVKPGGLI 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EEVV +V+       E VP+++A W  ++ A  ++  G  R TP ML 
Sbjct: 393 VFSNCSLDPLEGEEVVARVVA--DSGCERVPIDAADWPGLEKA--ITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                + G+DGF+A  LRR
Sbjct: 449 LEPPFAGGLDGFYAAVLRR 467


>gi|150398383|ref|YP_001328850.1| Fmu (Sun) domain-containing protein [Sinorhizobium medicae WSM419]
 gi|150029898|gb|ABR62015.1| Fmu (Sun) domain protein [Sinorhizobium medicae WSM419]
          Length = 470

 Score =  305 bits (781), Expect = 9e-81,   Method: Composition-based stats.
 Identities = 220/439 (50%), Positives = 303/439 (69%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ ++  L  +LD E G+  +R L+  D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVVDRKTPLDGMLDPERGNPVYRELNDADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+ AQILYLDV D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAAAQILYLDVPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK  +L+R+  +  +P WF +RL   YG+++   ISDA + P  ID+T
Sbjct: 154 SLVNAVLRRLSREKEAILERLQQVPAMPGWFFDRLVTCYGRDQAERISDAQLVPAAIDVT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D  +WA +LN  +LPTG +RL++   SI SLPGF+EG WWVQDA+ASIP +LFG ++
Sbjct: 214 VKSDAASWADRLNGTVLPTGSVRLQDFDGSIPSLPGFSEGGWWVQDAAASIPARLFGDIS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQL+++GAKV ALD S  RL +L+ NL+RL L +    E D  D+
Sbjct: 274 GRKVVDLCAAPGGKTAQLVLAGAKVIALDQSSSRLRRLKANLERLGLESA-TKEADMADF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDA L+DAPCSSTGT RRHPDVLWT+  DD+ K A  Q +LL   ++ VKPGG++
Sbjct: 333 RPEELFDAALLDAPCSSTGTTRRHPDVLWTKGPDDVEKLAGLQERLLRHALTLVKPGGLL 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD ++ EEVV +V+       E VP+++A W  ++ A  ++  G  R TP ML 
Sbjct: 393 VFSNCSLDPREGEEVVARVVA--DGGCERVPIDAAAWPGLEQA--ITALGEFRTTPAMLS 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                +SG+DGF+A  LRR
Sbjct: 449 LGPPFASGLDGFYAAVLRR 467


>gi|323701798|ref|ZP_08113469.1| sun protein [Desulfotomaculum nigrificans DSM 574]
 gi|323533334|gb|EGB23202.1| sun protein [Desulfotomaculum nigrificans DSM 574]
          Length = 453

 Score =  304 bits (778), Expect = 2e-80,   Method: Composition-based stats.
 Identities = 114/465 (24%), Positives = 197/465 (42%), Gaps = 39/465 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  + AR ++  +L  V  +       L+          L   D+     I    LR L
Sbjct: 1   MKK-VTARDLALQVLKVVEEEGAYANLALNRYLELYQPGKL---DRAFATEITYGVLRNL 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRH 119
             ID VL   L   L  +   ++ +LR+   QI+++  V D A  + +VE AK+   +  
Sbjct: 57  NTIDWVLAHFLKQPLAAQTVWVRNILRMGTYQIMFMPRVPDSAACNESVELAKKY-GHTG 115

Query: 120 FAKLVNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
            AK VN +LR              +   +  I+     P W  ER    +G ++ +A+  
Sbjct: 116 AAKFVNGVLRNVARQQGELDFPDPQESPIDYISLKYSHPTWLVERWLKEFGFDQTVALCK 175

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKELPESI------VSLPGFAEG 221
           A   P    +       +      +L    + T   +       +       SLP F EG
Sbjct: 176 ANNHPAPNTIRTNTLKINRTDLKARLEFEGVETRVTKYAPEGLHLNGFLSYQSLPSFQEG 235

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
           ++ VQD S+ +        +   ++D+ +APGGKT  L   +    ++ A+D+   +LE 
Sbjct: 236 LFQVQDESSMLVAHALNPASGARIIDVASAPGGKTTHLAQLMKDRGEIVAVDIHPHKLEL 295

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ N  RL + +   +  DA     +     D VLVDAPCS  G +RR PD  W +D   
Sbjct: 296 IKENCQRLGINSIRTLLADARCLPAEYTNWADYVLVDAPCSGLGVLRRRPDARWRKDPSQ 355

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +      QR++L    ++++PGG++++S C++ ++++  V++  L   P    L  L   
Sbjct: 356 LPGIVRLQREILESASTYLRPGGVLIYSTCTITREENIGVLEAFLADHP-EFSLGDLRQF 414

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +      +  G+I++ P +         GMDGFF   LR+ 
Sbjct: 415 LPPGL-AEEETAENGFIQLLPHI--------HGMDGFFIARLRKK 450


>gi|227823840|ref|YP_002827813.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234]
 gi|227342842|gb|ACP27060.1| Fmu (Sun) domain protein [Sinorhizobium fredii NGR234]
          Length = 473

 Score =  303 bits (776), Expect = 3e-80,   Method: Composition-based stats.
 Identities = 221/439 (50%), Positives = 299/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ +  SL  +LD E+G+ A+R L+  D+ LVRAI+N  LR LP
Sbjct: 34  KPGLKSRQAAAKILAAVIDRNTSLDGMLDQEHGNPAYRELNDADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+ AQILYLD+ D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAAAQILYLDIPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK  +L+ +  +  IP WF ERL   YG+    AIS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKQAILEALQTVPAIPAWFYERLVAHYGRAEAEAISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK +   WA +L   +LPTG +RL +   +I SLPGF+EG WWVQDA+ASIP +LFG L+
Sbjct: 214 VKSEPALWAERLGGTVLPTGSVRLGDFTGTIPSLPGFSEGAWWVQDAAASIPARLFGDLS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             +V+DLCAAPGGKTAQLI++GAKVTALD S  RL +L+ NL+RL L A    E D  ++
Sbjct: 274 GKTVVDLCAAPGGKTAQLILAGAKVTALDQSSSRLRRLKANLERLGLEA-RTKETDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P +LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ V+PGGIV
Sbjct: 333 RPDELFDAALLDAPCSSTGTTRRHPDVLWTKGPGDVEKLARLQERLLRHALTVVRPGGIV 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD ++ EEVV +V+       E +P+ ++ W  ++ A  ++  G  R TP ML 
Sbjct: 393 VFSNCSLDPREGEEVVARVVA--DGDCERLPIAASDWPGLEAA--ITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                S+G+DGF+A  LRR
Sbjct: 449 LDQPFSAGLDGFYAAVLRR 467


>gi|147678123|ref|YP_001212338.1| tRNA and rRNA cytosine-C5-methylases [Pelotomaculum
           thermopropionicum SI]
 gi|146274220|dbj|BAF59969.1| tRNA and rRNA cytosine-C5-methylases [Pelotomaculum
           thermopropionicum SI]
          Length = 456

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 110/463 (23%), Positives = 198/463 (42%), Gaps = 38/463 (8%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +G++AR ++  +++ V  +       L+          L   D+     +   TLR L  
Sbjct: 5   TGLSARELALKVVNAVEEEGAYANLALNQVLEKHRPGKL---DRAFATELAYGTLRSLNT 61

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +D VL+  +   L  +  ++  +LR+ V Q++++D V   AV +   E A++   +    
Sbjct: 62  LDWVLEQFIKQPLSSQSRTVLNILRLGVYQLMFMDRVPPSAVCNEGAELARKY-GHAGTV 120

Query: 122 KLVNSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDAC 172
           K VN +LR +SR   E+            I+     P W  +R    +G +  +A+  A 
Sbjct: 121 KFVNGVLRNISRRLNEISFPALEDDPVKHISLRYSHPVWMVKRWLKEFGLDHTVALCRAN 180

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRL------KELPESIVSLPGFAEGVW 223
             P    +         +  A +L    L              +   SI SL  F EG++
Sbjct: 181 NGPAPNTVRTNTLKITRDGLAERLRNEGLTVSETEFAPEGLKIDGFFSIGSLQSFKEGLF 240

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            +QD S+ +  +         V+D C+APGGKT  L   + +  ++ A+D+   +L  ++
Sbjct: 241 QIQDESSMLAGRALMPAPGAFVIDACSAPGGKTTHLAQLMENRGRILAVDIHPHKLVLIK 300

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
            N  RL +   + +  DA +         D +LVDAPCS  G +RR PD  W ++   + 
Sbjct: 301 ENCSRLGINIVEGLAGDARELPENLYNKADFILVDAPCSGLGVLRRRPDARWRKEPGQLP 360

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
                QR++L      +K  G++V+S C++ ++++   V+  L   P    L  L+    
Sbjct: 361 AIIQLQREILEGVARCLKKNGVIVYSTCTITREENLRQVEWFLDKHP-QFVLEDLSPFLP 419

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +D    L   G++++ P           GMDGFF   +R+ 
Sbjct: 420 AGLDFEGTL-KGGFLQVLP--------YRHGMDGFFIARMRKK 453


>gi|307316130|ref|ZP_07595574.1| Fmu (Sun) domain protein [Sinorhizobium meliloti AK83]
 gi|306897970|gb|EFN28712.1| Fmu (Sun) domain protein [Sinorhizobium meliloti AK83]
          Length = 470

 Score =  303 bits (775), Expect = 4e-80,   Method: Composition-based stats.
 Identities = 217/439 (49%), Positives = 299/439 (68%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ +R  ++ +L+ V+ ++  L  +LD E G+ A+R LS+ D+ LVRAI+N  LR LP
Sbjct: 34  KLGLKSRQAAAKILAAVVDRKTPLDGMLDPERGNPAYRELSEADRALVRAILNSALRHLP 93

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A +D +L + LP    +L+ +L V+  QILYLDV D++ VDLAVEQA+ D  NR FA
Sbjct: 94  RIRAAIDSLLQTPLPEGARALEHVLTVAATQILYLDVPDHSAVDLAVEQAQSDPRNRRFA 153

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LRR+SREK E+L+++  +  +P WF +RL   YG ++   IS+A + P  IDLT
Sbjct: 154 SLVNAVLRRLSREKEEILEKLRQVPAMPGWFFDRLVACYGPDQAERISEAQLVPAAIDLT 213

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D  +WA +L   +LPTG +RL+E   SI SL GF+EG WWVQDA+ASIP +LFG ++
Sbjct: 214 VKSDAASWAERLAGTVLPTGSVRLQEFSGSIPSLSGFSEGAWWVQDAAASIPARLFGDIS 273

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V+DLCAAPGGKTAQL+++GA+VTALD S  RL +L+ NL+RL   A    E D  ++
Sbjct: 274 GKKVVDLCAAPGGKTAQLVLAGAEVTALDQSSSRLRRLKANLERLGFEA-RTKESDMAEF 332

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDA L+DAPCSSTGT RRHPDVLWT+   D+ K A  Q +LL   ++ VKPGG++
Sbjct: 333 RPEELFDAALLDAPCSSTGTTRRHPDVLWTKGPQDVEKLARLQERLLRHALTLVKPGGLI 392

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EEVV +V+       E VP+++A W  ++ A  ++  G  R TP ML 
Sbjct: 393 VFSNCSLDPLEGEEVVARVVA--DSGCERVPIDAADWPGLEKA--ITALGEFRTTPAMLP 448

Query: 422 KIDGVSSGMDGFFAVALRR 440
                + G+DGF+A  LRR
Sbjct: 449 LEPPFAGGLDGFYAAVLRR 467


>gi|315122151|ref|YP_004062640.1| Fmu (Sun) domain protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495553|gb|ADR52152.1| Fmu (Sun) domain protein [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 443

 Score =  302 bits (774), Expect = 5e-80,   Method: Composition-based stats.
 Identities = 345/442 (78%), Positives = 393/442 (88%), Gaps = 2/442 (0%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKSGMNARLV++HLLSCV RKRISLTCLLD E GD AFR LS +DQ LVRAI++ TLRFL
Sbjct: 1   MKSGMNARLVAAHLLSCVTRKRISLTCLLDPERGDIAFRKLSHKDQALVRAILSTTLRFL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDAVLD +L+SSL +KK SL+QL R+S+AQILYLDVADYAVVDLAVEQAKRD+ENRHF
Sbjct: 61  PRIDAVLDLLLVSSLSKKKQSLRQLFRISIAQILYLDVADYAVVDLAVEQAKRDQENRHF 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           + LVNSILRRVSREK ELLQR + IS+IP+WFK+RLE+FYGKE    IS AC++P Y+DL
Sbjct: 121 SNLVNSILRRVSREKTELLQRFSSISVIPQWFKKRLEDFYGKESTYCISQACLTPSYVDL 180

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK DIE WA+KLNAV+LPTGGIRL+E   S+ SLPGFAEGVWWVQDASASIPVQLFG L
Sbjct: 181 TVKSDIEIWANKLNAVVLPTGGIRLREFRGSVSSLPGFAEGVWWVQDASASIPVQLFGPL 240

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           N LSVLDLCAAPGGKTAQLI+SGAKVTALD+S  RLEKL+ NL+RL L A++IIE DAFD
Sbjct: 241 NGLSVLDLCAAPGGKTAQLILSGAKVTALDISNNRLEKLQHNLNRLRLCADNIIEGDAFD 300

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           Y PKKLFDAVLVDAPCSSTGT+RRHPDVLWTRD +DIV+SACFQ +LLL G++ VKPGGI
Sbjct: 301 YRPKKLFDAVLVDAPCSSTGTMRRHPDVLWTRDAEDIVRSACFQERLLLHGLALVKPGGI 360

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VVFSNCSLDKQDSE+VV+KVLRSS IPVE++ LN+A W   +MAMA++PEGW+RITPDML
Sbjct: 361 VVFSNCSLDKQDSEDVVRKVLRSSLIPVEIMSLNNASW--NNMAMAITPEGWLRITPDML 418

Query: 421 EKIDGVSSGMDGFFAVALRRLI 442
            +I+GV SGMDGFFAVALRRLI
Sbjct: 419 GEIEGVPSGMDGFFAVALRRLI 440


>gi|332976420|gb|EGK13268.1| RNA methyltransferase Sun [Desmospora sp. 8437]
          Length = 453

 Score =  302 bits (773), Expect = 6e-80,   Method: Composition-based stats.
 Identities = 127/464 (27%), Positives = 200/464 (43%), Gaps = 37/464 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    +AR V+  +L  V  +      LL+     S    LS RD+ L   +V  TL+  
Sbjct: 1   MTRPDSARNVALDVLIAVEERGAYSNLLLNDRLQRS---SLSPRDRGLATELVYGTLQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L+ ++   +      ++ LLR+ + Q+ YLD V   A V   VE AK  + +R 
Sbjct: 58  NTLDWILNKLVRKGIDTLDPWVRHLLRLGIYQLRYLDRVPSRAAVHETVEIAKA-RGHRG 116

Query: 120 FAKLVNSILRRVSREKIELLQRIAGISI--------IPEWFKERLENFYGKERVLAISDA 171
              LVN +LR   R   E     +  S+         PEW   RL   YG E   ++  A
Sbjct: 117 IPGLVNGVLRSYLRRGREWTLPDSPKSVTDLALVTSHPEWLVRRLVEVYGPETAHSVLKA 176

Query: 172 CISPLYIDLTVKF---DIETWAHKLNAV-------MLPTGGIRLKELPESIVSLPGFAEG 221
              P  + + V     + E  A  L          + P  G  L     +  S   F EG
Sbjct: 177 NNRPPGLSVRVNPLRGNRERVARLLQEEDPRLRIRLSPLSGQGLILTGGNPASGRLFREG 236

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEK 278
            + VQD S+ +  +L        VLD CAAPGGKT      + +   + A D+   +++ 
Sbjct: 237 WFTVQDESSMLVAELLAPRPGERVLDGCAAPGGKTGHLAERMENRGTLLACDIHPHKVKL 296

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +   + RL L   ++ + D  +     +  FD VL+DAPCS  G IRR PD+ W+++  +
Sbjct: 297 IENQVRRLGLSMVEVRQADLRELPGTGEARFDRVLLDAPCSGWGVIRRKPDIKWSKNLQE 356

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +      Q +LL      V PGG +V+S C+L+ Q++ E +   L+  P   +       
Sbjct: 357 VDSLRQLQAELLEAAARLVTPGGTLVYSTCTLEPQENREQITAFLKKHPT-FQADSTLFD 415

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              +     AL+ +GW++I P   E         DGFF   + +
Sbjct: 416 TLPAPVREKALTGDGWVQILPHHFES--------DGFFIARMIK 451


>gi|116254448|ref|YP_770286.1| ribosomal RNA small subunit methyltransferase B [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115259096|emb|CAK10207.1| putative ribosomal RNA small subunit methyltransferase B [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 460

 Score =  302 bits (773), Expect = 8e-80,   Method: Composition-based stats.
 Identities = 226/424 (53%), Positives = 290/424 (68%), Gaps = 4/424 (0%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+ +++ L   LD E+G+ A+R L + D+ LVRAI+N TLR LPRIDA +  +L S LP 
Sbjct: 40  VVDRKLPLDGALDHEHGNPAYRALGESDRALVRAILNTTLRHLPRIDAAIAGLLDSPLPE 99

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR FAKLVN+ILRR+ REK +
Sbjct: 100 GARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRFAKLVNAILRRLGREKEQ 159

Query: 138 LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +L  I  ++ +P WF  RLE  YG++  LAIS++ + P  IDLTVK D E WA +LN V+
Sbjct: 160 VLADIGKVAPMPAWFIARLEKAYGRDAALAISESQLEPAAIDLTVKSDPEGWAKRLNGVV 219

Query: 198 LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTA 257
           LPTGGIRL      I SL GF EG WWVQDA+ASIP +LFG L      DLCAAPGGKTA
Sbjct: 220 LPTGGIRLAAFDGGIPSLEGFDEGAWWVQDAAASIPAKLFGDLAGKRTADLCAAPGGKTA 279

Query: 258 QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCS 317
           QLI++G  VTALD S+ RL +LR NLDRL L AE I   D   + P + FDA+L+DAPCS
Sbjct: 280 QLILAGGAVTALDQSENRLRRLRSNLDRLGLKAETI-AADLTTFGPTERFDAILLDAPCS 338

Query: 318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           STGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KPGG +VFSNCSLD  + E+VV
Sbjct: 339 STGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPGGTLVFSNCSLDPVEGEDVV 398

Query: 378 QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVA 437
            +VL  +   VE VP+ +  W  ++ A  ++P G  R  P ML+  DG+ SG+DGF+A  
Sbjct: 399 ARVLSDT-DAVERVPIGAGDWPGLEAA--ITPLGEFRTLPTMLKMPDGIGSGLDGFYAAV 455

Query: 438 LRRL 441
           LRRL
Sbjct: 456 LRRL 459


>gi|254700459|ref|ZP_05162287.1| Sun [Brucella suis bv. 5 str. 513]
 gi|261750960|ref|ZP_05994669.1| fmu domain-containing protein [Brucella suis bv. 5 str. 513]
 gi|261740713|gb|EEY28639.1| fmu domain-containing protein [Brucella suis bv. 5 str. 513]
          Length = 465

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 263/445 (59%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++VVDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSVVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|241206925|ref|YP_002978021.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
 gi|240860815|gb|ACS58482.1| Fmu (Sun) domain protein [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 460

 Score =  301 bits (771), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 222/425 (52%), Positives = 292/425 (68%), Gaps = 4/425 (0%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+ +++ L   LD E+G+ A+R L + D+ LVRAI+N TLR LPRIDA +  +L S LP 
Sbjct: 40  VVDRKLPLDGALDHEHGNPAYRALGESDRALVRAILNTTLRHLPRIDAAIAGLLDSPLPE 99

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L +  AQILYLDV D++ VDLAVEQA  D  NR FAKLVN+ILRR+ REK +
Sbjct: 100 GARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANLDPRNRRFAKLVNAILRRLGREKEQ 159

Query: 138 LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +L +I  ++ +P WF  RLE  YG++  LAIS++ + P  IDLTVK D E WA +LN V+
Sbjct: 160 VLDQIGKVAPMPAWFIARLEKAYGRDAALAISESQLEPAAIDLTVKSDPEDWAKRLNGVV 219

Query: 198 LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTA 257
           LPTG +RL     SI S+ GF EG WWVQDA+ASIP +LFG L      DLCAAPGGKTA
Sbjct: 220 LPTGSVRLAAFDGSIPSVEGFDEGAWWVQDAAASIPAKLFGDLLGKRTADLCAAPGGKTA 279

Query: 258 QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCS 317
           QLI++G  VTALD S+ RL +LR NLDRL L AE I   D   + P + FDA+L+DAPCS
Sbjct: 280 QLILAGGAVTALDQSESRLRRLRSNLDRLGLKAETI-AADLTTFEPAERFDAILLDAPCS 338

Query: 318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           STGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KPGG +VFSNCSLD  + E+VV
Sbjct: 339 STGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPGGTLVFSNCSLDPVEGEDVV 398

Query: 378 QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVA 437
            +VL  +   VE VP+ ++ W  ++ A  ++P G  R  P ML+  +G++SG+DGF+A  
Sbjct: 399 ARVLSDT-DAVERVPIGASDWPGLEAA--ITPLGEFRTLPTMLKMPEGIASGLDGFYAAV 455

Query: 438 LRRLI 442
           LRR+ 
Sbjct: 456 LRRVA 460


>gi|62290679|ref|YP_222472.1| Sun, sun protein [Brucella abortus bv. 1 str. 9-941]
 gi|82700594|ref|YP_415168.1| hypothetical protein BAB1_1822 [Brucella melitensis biovar Abortus
           2308]
 gi|148559652|ref|YP_001259653.1| sun protein [Brucella ovis ATCC 25840]
 gi|189024891|ref|YP_001935659.1| Sun [Brucella abortus S19]
 gi|237816180|ref|ZP_04595175.1| Sun, sun protein [Brucella abortus str. 2308 A]
 gi|254689968|ref|ZP_05153222.1| Sun [Brucella abortus bv. 6 str. 870]
 gi|254698119|ref|ZP_05159947.1| Sun [Brucella abortus bv. 2 str. 86/8/59]
 gi|254708333|ref|ZP_05170161.1| Sun [Brucella pinnipedialis M163/99/10]
 gi|254708815|ref|ZP_05170626.1| Sun [Brucella pinnipedialis B2/94]
 gi|254731003|ref|ZP_05189581.1| Sun [Brucella abortus bv. 4 str. 292]
 gi|256030341|ref|ZP_05443955.1| Sun [Brucella pinnipedialis M292/94/1]
 gi|256061838|ref|ZP_05451973.1| Sun [Brucella neotomae 5K33]
 gi|256258223|ref|ZP_05463759.1| Sun [Brucella abortus bv. 9 str. C68]
 gi|256370218|ref|YP_003107729.1| sun protein [Brucella microti CCM 4915]
 gi|260547084|ref|ZP_05822822.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260755503|ref|ZP_05867851.1| fmu domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260758726|ref|ZP_05871074.1| fmu domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260762560|ref|ZP_05874897.1| fmu domain-containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884524|ref|ZP_05896138.1| fmu domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261315833|ref|ZP_05955030.1| fmu domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|261316307|ref|ZP_05955504.1| fmu domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261325843|ref|ZP_05965040.1| fmu domain-containing protein [Brucella neotomae 5K33]
 gi|265987375|ref|ZP_06099932.1| fmu domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294851054|ref|ZP_06791730.1| ribosomal RNA small subunit methyltransferase B [Brucella sp. NVSL
           07-0026]
 gi|297249071|ref|ZP_06932779.1| ribosomal RNA small subunit methyltransferase B [Brucella abortus
           bv. 5 str. B3196]
 gi|62196811|gb|AAX75111.1| Sun, sun protein [Brucella abortus bv. 1 str. 9-941]
 gi|82616695|emb|CAJ11778.1| SAM (and some other nucleotide) binding motif:Bacterial
           Sun/eukaryotic nucleolar Nop1/Nop2:Antitermination
           protein NusB:NusB [Brucella melitensis biovar Abortus
           2308]
 gi|148370909|gb|ABQ60888.1| sun protein [Brucella ovis ATCC 25840]
 gi|189020463|gb|ACD73185.1| Sun [Brucella abortus S19]
 gi|237788642|gb|EEP62855.1| Sun, sun protein [Brucella abortus str. 2308 A]
 gi|256000381|gb|ACU48780.1| sun protein [Brucella microti CCM 4915]
 gi|260095449|gb|EEW79327.1| conserved hypothetical protein [Brucella abortus NCTC 8038]
 gi|260669044|gb|EEX55984.1| fmu domain-containing protein [Brucella abortus bv. 4 str. 292]
 gi|260672986|gb|EEX59807.1| fmu domain-containing protein [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675611|gb|EEX62432.1| fmu domain-containing protein [Brucella abortus bv. 6 str. 870]
 gi|260874052|gb|EEX81121.1| fmu domain-containing protein [Brucella abortus bv. 9 str. C68]
 gi|261295530|gb|EEX99026.1| fmu domain-containing protein [Brucella pinnipedialis B2/94]
 gi|261301823|gb|EEY05320.1| fmu domain-containing protein [Brucella neotomae 5K33]
 gi|261304859|gb|EEY08356.1| fmu domain-containing protein [Brucella pinnipedialis M163/99/10]
 gi|264659572|gb|EEZ29833.1| fmu domain-containing protein [Brucella pinnipedialis M292/94/1]
 gi|294821697|gb|EFG38693.1| ribosomal RNA small subunit methyltransferase B [Brucella sp. NVSL
           07-0026]
 gi|297174204|gb|EFH33561.1| ribosomal RNA small subunit methyltransferase B [Brucella abortus
           bv. 5 str. B3196]
          Length = 465

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 262/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|256160512|ref|ZP_05458201.1| Sun [Brucella ceti M490/95/1]
 gi|256255718|ref|ZP_05461254.1| Sun [Brucella ceti B1/94]
 gi|261222929|ref|ZP_05937210.1| fmu domain-containing protein [Brucella ceti B1/94]
 gi|265998888|ref|ZP_06111445.1| fmu domain-containing protein [Brucella ceti M490/95/1]
 gi|260921513|gb|EEX88166.1| fmu domain-containing protein [Brucella ceti B1/94]
 gi|262553577|gb|EEZ09346.1| fmu domain-containing protein [Brucella ceti M490/95/1]
          Length = 465

 Score =  301 bits (770), Expect = 1e-79,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 262/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDITKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|307943521|ref|ZP_07658865.1| ribosomal RNA small subunit methyltransferase B [Roseibium sp.
           TrichSKD4]
 gi|307773151|gb|EFO32368.1| ribosomal RNA small subunit methyltransferase B [Roseibium sp.
           TrichSKD4]
          Length = 462

 Score =  301 bits (770), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 174/440 (39%), Positives = 256/440 (58%), Gaps = 6/440 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR V++ +L  V+ K   L   L+L+ G S FR L  +D+ LVRAI+   LR   
Sbjct: 27  KPGFAARKVAADILGNVVHKHRPLDGELELKSGHSGFRALEPKDRALVRAILGAALRHRG 86

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I  +L  +L   +P K   +  +L V++AQ+LYLD+ D A V LAV+ A  D  +R + 
Sbjct: 87  EISEILTRLLDRDIPEKTGRVLDILHVAIAQMLYLDIPDRAAVSLAVDHASADSRSRVYK 146

Query: 122 KLVNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+ RE+  + + +   +   PEW   R    YG+E    I+ A      +D+
Sbjct: 147 GLVNGVLRRLGRERDMMTEDLDGEVLNTPEWLFTRWVETYGEETARKIAAAHQHEAALDI 206

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           +VK + + WA +L  V+L    IRL     ++  L GF EG WWVQD +AS+P +L G +
Sbjct: 207 SVKSNPKVWAERLEGVLLAGKTIRLSR-KGAVDGLVGFEEGAWWVQDLAASLPARLLGDV 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           +  +V DLCAAPGGKTAQL  S  KVTA+D+SK RL++L  N+DRL L   + +  D   
Sbjct: 266 SGQTVADLCAAPGGKTAQLAASSGKVTAVDISKGRLKRLSQNMDRLGLP-VETVVADLRK 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           Y P +LFDA+L+D PCS+TGTIRRHPDV W +   DI   A  Q++LL +   ++KPGG 
Sbjct: 325 YDPPELFDAILLDVPCSATGTIRRHPDVPWLKGERDIETLAEIQKELLERVAGWLKPGGQ 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CS+++ + E  ++  L++  +   LVP+         +   +SPEG++R  P   
Sbjct: 385 MVYCTCSMERDEGEAQIEAFLKAH-LDFRLVPVAGDEIGG--LNACISPEGYVRTLPFHS 441

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              +   +G+DGFFA  L+R
Sbjct: 442 VDPNSELTGLDGFFAARLQR 461


>gi|23502667|ref|NP_698794.1| sun protein [Brucella suis 1330]
 gi|161619734|ref|YP_001593621.1| Fmu (Sun) domain-containing protein [Brucella canis ATCC 23365]
 gi|163845392|ref|YP_001623047.1| hypothetical protein BSUIS_B1292 [Brucella suis ATCC 23445]
 gi|254703581|ref|ZP_05165409.1| hypothetical protein Bsuib36_06589 [Brucella suis bv. 3 str. 686]
 gi|260568886|ref|ZP_05839354.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261754214|ref|ZP_05997923.1| fmu domain-containing protein [Brucella suis bv. 3 str. 686]
 gi|23348676|gb|AAN30709.1| sun protein [Brucella suis 1330]
 gi|161336545|gb|ABX62850.1| Fmu (Sun) domain protein [Brucella canis ATCC 23365]
 gi|163676115|gb|ABY40225.1| Hypothetical protein, conserved [Brucella suis ATCC 23445]
 gi|260154270|gb|EEW89352.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gi|261743967|gb|EEY31893.1| fmu domain-containing protein [Brucella suis bv. 3 str. 686]
          Length = 465

 Score =  300 bits (768), Expect = 2e-79,   Method: Composition-based stats.
 Identities = 192/445 (43%), Positives = 261/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LR     ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRHLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|254719803|ref|ZP_05181614.1| Sun [Brucella sp. 83/13]
 gi|265984821|ref|ZP_06097556.1| fmu domain-containing protein [Brucella sp. 83/13]
 gi|306839499|ref|ZP_07472307.1| Sun [Brucella sp. NF 2653]
 gi|264663413|gb|EEZ33674.1| fmu domain-containing protein [Brucella sp. 83/13]
 gi|306405444|gb|EFM61715.1| Sun [Brucella sp. NF 2653]
          Length = 464

 Score =  300 bits (768), Expect = 3e-79,   Method: Composition-based stats.
 Identities = 192/445 (43%), Positives = 263/445 (59%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 25  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 84

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 85  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 144

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 145 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGVEKAATILAIHAYEPPIDF 204

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 205 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 264

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 265 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 323

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 324 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 383

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K   +    + L P          +   ++ EG++R TP  L
Sbjct: 384 IVFSNCSLHPLEGEEMARKAAEN----LLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 439

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 440 PPDRFDGNPHMAGMDGFFAARFKRV 464


>gi|325294195|ref|YP_004280059.1| SUN protein [Agrobacterium sp. H13-3]
 gi|325062048|gb|ADY65739.1| SUN protein [Agrobacterium sp. H13-3]
          Length = 461

 Score =  300 bits (767), Expect = 4e-79,   Method: Composition-based stats.
 Identities = 223/440 (50%), Positives = 294/440 (66%), Gaps = 11/440 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR+ ++ +L+ V+ K+ SL  +LD E G+  +R LS  D+ LVRAIVN  LR LP
Sbjct: 33  KPGLAARVAATRILAAVLEKKTSLDGMLDSENGNPVYRALSLADRALVRAIVNSALRHLP 92

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+A L  +L   LP+   SL  +L V  AQ+L+LDV D++ VDLAVEQA RD  NR FA
Sbjct: 93  RIEAALSMLLDGPLPQGARSLHHVLVVGAAQVLHLDVPDHSAVDLAVEQAHRDPRNRRFA 152

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK E+ + IA + ++P+WF  RL + YG E    IS+A ++P  IDLT
Sbjct: 153 KLVNAVLRRLGREKAEIEKAIADVPVLPDWFYARLVSAYGDEVAKRISEAQLTPSSIDLT 212

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KL   +LP G +RL E    I SL GFAEG WWVQD +AS+PV+L G ++
Sbjct: 213 VKKDQAVWAEKLGGTVLPNGSVRLGEFEGQIPSLEGFAEGAWWVQDLAASMPVKLMGDIS 272

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQL ++GAKVTALD S  RL +LR NLDRL L+AE + E +   Y
Sbjct: 273 GKRVADLCAAPGGKTAQLALAGAKVTALDQSGNRLRRLRENLDRLGLHAETV-EANMLKY 331

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDAVL+DAPCSSTGT+R+HPDV WT+D +DI K A  Q ++L   ++ V  GGIV
Sbjct: 332 QPEQLFDAVLLDAPCSSTGTLRKHPDVCWTKDENDIAKLAALQGQMLRHALTLVGAGGIV 391

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + E ++ +VL  +P   E V +    W  ++ A  ++ EG +R TPDM  
Sbjct: 392 VFSNCSLDPSEGEAMIAQVLAENP-DFERVAVRKDDWPGMEAA--VTAEGDLRTTPDMF- 447

Query: 422 KIDGVSSGMDGFFAVALRRL 441
                  G+DGFF+  LR+ 
Sbjct: 448 ------GGIDGFFSSVLRKK 461


>gi|260168015|ref|ZP_05754826.1| sun protein [Brucella sp. F5/99]
 gi|261757460|ref|ZP_06001169.1| RNA methyltransferase- sun protein [Brucella sp. F5/99]
 gi|261737444|gb|EEY25440.1| RNA methyltransferase- sun protein [Brucella sp. F5/99]
          Length = 465

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 193/445 (43%), Positives = 262/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGFALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|254714655|ref|ZP_05176466.1| Sun [Brucella ceti M644/93/1]
 gi|254717553|ref|ZP_05179364.1| Sun [Brucella ceti M13/05/1]
 gi|261219386|ref|ZP_05933667.1| fmu domain-containing protein [Brucella ceti M13/05/1]
 gi|261322448|ref|ZP_05961645.1| fmu domain-containing protein [Brucella ceti M644/93/1]
 gi|260924475|gb|EEX91043.1| fmu domain-containing protein [Brucella ceti M13/05/1]
 gi|261295138|gb|EEX98634.1| fmu domain-containing protein [Brucella ceti M644/93/1]
          Length = 465

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 191/445 (42%), Positives = 260/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAE  WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAESEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ R ++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRRKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|258515525|ref|YP_003191747.1| sun protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257779230|gb|ACV63124.1| sun protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 452

 Score =  299 bits (765), Expect = 6e-79,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 200/461 (43%), Gaps = 38/461 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           +NAR ++  +L  V ++       L+       F  L   D+     +V  TLR L  +D
Sbjct: 4   VNAREMALIVLKAVDQEGAYANIALNQVLEQRDFNKL---DRAFTTELVYGTLRALNTVD 60

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            VL   L   L  +   ++ +LR+   Q+L++  V   A  + A + + +   ++   K 
Sbjct: 61  WVLAQFLKHPLSSQTAWIRNILRLGTYQLLFMHRVPASAACNEAAKLSHKY-GHKGQVKF 119

Query: 124 VNSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN +LR ++R+   +            I+     P W  ER  N +GKE+ + I  +  +
Sbjct: 120 VNGVLRNIARQHENIEYPDCEKDPVSHISLRYSHPIWMVERWLNQFGKEKTIRICQSNNT 179

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWV 225
           P    +       + +  A  L    +                  S+ + P F  G++ V
Sbjct: 180 PARFSIRTNTLQINRDNLAELLKQQGMIVDKTGFAPEGLNVEGFTSLRNFPAFRNGLFQV 239

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCN 282
           QD S+ +         N  V+D CAAPGGKT     L+ +  ++ A D+   +L+ +  N
Sbjct: 240 QDESSILAGHAVKPAVNCRVIDACAAPGGKTTHLAQLMENKGEIIAADIYPHKLDLIEDN 299

Query: 283 LDRLHLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
             RL +    II +D+           D VLVDAPCS  G +RR PD  W ++ + I   
Sbjct: 300 CQRLGIKCVKIINLDSRTLHNSYTGWADYVLVDAPCSGLGVLRRRPDARWRKEAEQIPAL 359

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              QR++L      V+PGG++V+S C++ ++++ E V+  L +  +   L  ++      
Sbjct: 360 VKIQREILESAALCVRPGGVLVYSTCTITEEENIEQVKYFLLTH-LDFVLEDMSRLLPSE 418

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ID    L   G+I+I P         +  +DGFF   +R+ 
Sbjct: 419 IDWQNTLGK-GYIQILP--------YTHNIDGFFIARMRKK 450


>gi|172035456|ref|YP_001801957.1| Fmu, rRNA SAM-dependent methyltransferase [Cyanothece sp. ATCC
           51142]
 gi|171696910|gb|ACB49891.1| Fmu, rRNA SAM-dependent methyltransferase [Cyanothece sp. ATCC
           51142]
          Length = 452

 Score =  299 bits (764), Expect = 7e-79,   Method: Composition-based stats.
 Identities = 121/464 (26%), Positives = 210/464 (45%), Gaps = 42/464 (9%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
               NAR ++  +L  + RK       LD  +  +    L+  D+ L   +V   +R   
Sbjct: 5   TKKTNARQLTLDILRQIDRKNSYTDIALDRAFNQTH---LNPSDRSLCTELVYGIIRHQR 61

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHF 120
            +D ++D +      ++   L+++L + + Q+ YLD +   A V+ +V  AK  K NR  
Sbjct: 62  TLDTLIDQLGKKKAKQQPPDLRRILHIGLYQLRYLDNIPPSAAVNTSVNLAKEYKLNR-L 120

Query: 121 AKLVNSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
           + +VN ILR+  R               +++IA     P+W  E     +G+     +  
Sbjct: 121 SGVVNGILRQYLRSSETDGDPLILPPNPIEKIAIQYSFPDWMIETWVQQWGEATTEQLCH 180

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAE 220
                  ID+ +      +ET   +L    +           +RL+    SI +LPGF +
Sbjct: 181 WFNQTPTIDIRINPLKTTLETLQTQLTEAGINATPFPPLPCTLRLQGKIGSIQTLPGFHQ 240

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLE 277
           G W +QD+SA +   L       +++D CAAPGGKT  +   +     + A D +  RL+
Sbjct: 241 GHWTIQDSSAQLVSYLLDPQPGETIIDACAAPGGKTTHMAELMGDQGTIIACDRTPSRLK 300

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           K++ N  RL L +   I  D+          D VLVD PCS  GT+ RHPD+ W +  + 
Sbjct: 301 KVQQNAQRLQLNSIQTILGDSRHLPQLINTADRVLVDVPCSGLGTLHRHPDIRWRQTPEK 360

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           I + +  Q+++L Q   +VKP G +V++ C+L+  +++++++  L   P    L P +  
Sbjct: 361 IQELSRLQQEILTQAAQWVKPQGTLVYATCTLNPTENQQIIESFLTHHPQW-NLKPPSVH 419

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +      +  ++   WI+I P             DGFF V L++
Sbjct: 420 WL----FSPFMTSSKWIQILPH--------EHHTDGFFMVKLKK 451


>gi|328541770|ref|YP_004301879.1| ribosomal RNA small subunit methyltransferase B [polymorphum gilvum
           SL003B-26A1]
 gi|326411522|gb|ADZ68585.1| Ribosomal RNA small subunit methyltransferase B [Polymorphum gilvum
           SL003B-26A1]
          Length = 439

 Score =  299 bits (764), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 178/441 (40%), Positives = 254/441 (57%), Gaps = 6/441 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
             G   R  ++ +L  V+  R  L   LD   G S FR L  +D+ LVRAI+   LR   
Sbjct: 4   TPGFAVRKAAADILGAVVHARRPLDGELDPVSGHSGFRALDSKDRALVRAILGACLRRRG 63

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI A++D +L   +P K   +  +L V+ AQ+L+LDV D A V +AV+ A  D+  R + 
Sbjct: 64  RIAAIVDALLDRPIPEKTGRVLDILHVAAAQVLFLDVPDRAAVSVAVDLAAADRRARPYK 123

Query: 122 KLVNSILRRVSREKIELLQRIAGISII-PEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN +LRR+SREK  LL   + +    P+W  +R    +G+   +AI+ A  +   +DL
Sbjct: 124 GLVNGVLRRLSREKDALLADFSDVRGTPPDWLFDRWTAAWGEATAVAIAHALANEPELDL 183

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA +L   ++ TG +RL     ++ +  G+ EG WWVQDA+A++P +L G L
Sbjct: 184 TVKSDPELWAQRLGGRVVATGSVRLSR-KGAVETFEGYGEGAWWVQDAAAALPARLLGPL 242

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL  +G +VTA+D+S +RL+++  NL RL   A DI+  D  D
Sbjct: 243 AGKRVADLCAAPGGKTAQLAAAGGRVTAVDISGKRLKRVAENLARLGFEA-DIVAADLKD 301

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P + FDA+L+DAPCS+TGTIRRHPDV WT+ + DI   A  Q  LL +   ++ PGG 
Sbjct: 302 WQPAERFDAILLDAPCSATGTIRRHPDVAWTKRSQDIATLAGVQALLLRRAAGWLVPGGT 361

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E  +   L   P    LVP+         +A  ++ EG +R  P  L
Sbjct: 362 LVYCTCSLELEEGEAQIAAFLAEVPG-FALVPVAPGEIGG--LAECVTDEGCLRTLPCHL 418

Query: 421 EKIDGVSSGMDGFFAVALRRL 441
              +    G+DGFFA  L RL
Sbjct: 419 GGAEAADGGLDGFFAARLTRL 439


>gi|306841594|ref|ZP_07474291.1| Sun [Brucella sp. BO2]
 gi|306288340|gb|EFM59703.1| Sun [Brucella sp. BO2]
          Length = 464

 Score =  298 bits (763), Expect = 9e-79,   Method: Composition-based stats.
 Identities = 192/445 (43%), Positives = 264/445 (59%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 25  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 84

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 85  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 144

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 145 GLVNALLRRLARNKERALAHTFEPEANVPEWFSKSITDAYGAEKAATILAMHAYEPPIDF 204

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 205 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 264

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 265 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 323

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q +LL    + VKPGG+
Sbjct: 324 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLADLQGRLLAHAATLVKPGGV 383

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K    +P+   L P          +   ++ EG++R TP  L
Sbjct: 384 IVFSNCSLHPLEGEEMARKA-AENPL---LEPFPITEQDCPGLEGLVTAEGFLRSTPADL 439

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 440 PPDRFDGNPHMAGMDGFFAARFKRV 464


>gi|27375690|ref|NP_767219.1| SUN protein [Bradyrhizobium japonicum USDA 110]
 gi|27348828|dbj|BAC45844.1| SUN protein [Bradyrhizobium japonicum USDA 110]
          Length = 448

 Score =  298 bits (763), Expect = 1e-78,   Method: Composition-based stats.
 Identities = 174/439 (39%), Positives = 256/439 (58%), Gaps = 5/439 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ ++  V+ K  +L   LD        + L+ RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADIVDGVLHKHRTLDDQLDGSGAHPGLKTLADRDRALMRRLVATVLRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  VL  +L   +P +    Q  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LGHVLSRLLDKGIPSEAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAARYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE   L++ +A  S  +P W   R    YG+     ++ A      +DLT
Sbjct: 133 LVNAVLRRCAREGQALVEEVATQSLDLPPWLLARWRAHYGEATARDMALALGHEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +L+   LPTG +R   L  S+  LPGFAEG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDAEQWASRLHGETLPTGTVR-MLLHGSVTMLPGFAEGQWWVQDAAAALPARLFGDIK 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             S+ DLCAAPGGKTAQL  +GA VTA+D S  R+ +LR NL RL L AE ++   A   
Sbjct: 252 GKSIADLCAAPGGKTAQLAHAGAHVTAIDRSPARVARLRENLARLSLQAETVVADAAEWA 311

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P + FD +L+DAPC+STGTIRRHPDV W R   DI      Q++LL + +S +KPGG +
Sbjct: 312 GPAEGFDGILIDAPCTSTGTIRRHPDVAWLRQESDIAALTALQQRLLRKSVSLLKPGGTL 371

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E+ +  +L + P  +  VP+ ++  +   ++  ++ EG +R  P  L 
Sbjct: 372 VYCTCSLEPEEGEQAIATLLAAEP-ALRRVPIEAS--EVSGLSEIITAEGDLRTLPSHLP 428

Query: 422 KIDGVSSGMDGFFAVALRR 440
             D    G+DGFFA  L +
Sbjct: 429 NADPKLGGLDGFFAARLVK 447


>gi|253575778|ref|ZP_04853113.1| ribosomal RNA small subunit methyltransferase B [Paenibacillus sp.
           oral taxon 786 str. D14]
 gi|251844821|gb|EES72834.1| ribosomal RNA small subunit methyltransferase B [Paenibacillus sp.
           oral taxon 786 str. D14]
          Length = 506

 Score =  296 bits (758), Expect = 4e-78,   Method: Composition-based stats.
 Identities = 125/459 (27%), Positives = 200/459 (43%), Gaps = 36/459 (7%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR V+  +L+ V ++      LL+     S    L+  D  L   +V  T++ L  ID  
Sbjct: 55  ARSVALQVLTAVEQEGAYSNLLLNGALQKS---GLTGPDAGLATELVYGTIQRLNTIDYF 111

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L+  +   L +    ++ LLR+S  Q+ YLD +  +A V+ AV  AKR K ++  + +VN
Sbjct: 112 LEQFVTKGLAKLAPWVRNLLRLSFYQLQYLDRIPPHAAVNEAVNLAKR-KGHQGISGMVN 170

Query: 126 SILRRVSREKI--------ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +LR V R K         + +QRIA     PEW        YG+    AI  A   P  
Sbjct: 171 GVLRNVLRRKEELRLPEGLDPVQRIALEHSHPEWMVALWIQQYGESAAEAICRANNEPPS 230

Query: 178 IDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V     +    L          +    +    +     ++     + EG+  VQD 
Sbjct: 231 VSVRVNRTKASRDEVLRLMEEQGLRASASPISPDGIVVHSGGNMALTSWYREGLISVQDE 290

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +       ++VLD CAAPGGKT  +   +    +V A D+   + + +  +  R
Sbjct: 291 SSMLVAEALDPQPGMNVLDCCAAPGGKTCHIAEIMEGRGRVLANDIHPHKAKLIEDHAKR 350

Query: 286 LHLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L   D +  DA     +     FD +L+D PCS  G IRR PD+ W +  +D+ + A 
Sbjct: 351 LGLDNVDTLSGDALQLAERLKAASFDRILLDVPCSGLGVIRRKPDLKWAKKPEDVTEIAG 410

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            QR LL      +KPGG++V+S C+++ +++ E+V   L   P         S   +   
Sbjct: 411 VQRTLLDSVSGLLKPGGLLVYSTCTIEPRENAEMVASFLSRHPEFELADEPISWKERGAL 470

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            A A   E  ++I P             DGF+   LRR 
Sbjct: 471 AAAAGRVEAGLQILPQDA--------HSDGFYIARLRRK 501


>gi|225853258|ref|YP_002733491.1| Fmu domain-containing protein, Sun [Brucella melitensis ATCC 23457]
 gi|256114379|ref|ZP_05455112.1| Fmu domain protein, Sun [Brucella melitensis bv. 3 str. Ether]
 gi|256263253|ref|ZP_05465785.1| NOL1/NOP2/sun family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|265995679|ref|ZP_06108236.1| fmu domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|225641623|gb|ACO01537.1| Fmu domain protein, Sun [Brucella melitensis ATCC 23457]
 gi|262766963|gb|EEZ12581.1| fmu domain-containing protein [Brucella melitensis bv. 3 str.
           Ether]
 gi|263093217|gb|EEZ17314.1| NOL1/NOP2/sun family protein [Brucella melitensis bv. 2 str. 63/9]
 gi|326409818|gb|ADZ66883.1| Fmu domain-containing protein, Sun [Brucella melitensis M28]
 gi|326539536|gb|ADZ87751.1| Fmu domain protein, Sun [Brucella melitensis M5-90]
          Length = 465

 Score =  296 bits (757), Expect = 5e-78,   Method: Composition-based stats.
 Identities = 191/445 (42%), Positives = 260/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   L    
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALHNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L   +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMDDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|159185402|ref|NP_355752.2| Sun protein [Agrobacterium tumefaciens str. C58]
 gi|159140651|gb|AAK88537.2| Sun protein [Agrobacterium tumefaciens str. C58]
          Length = 461

 Score =  296 bits (756), Expect = 6e-78,   Method: Composition-based stats.
 Identities = 220/440 (50%), Positives = 294/440 (66%), Gaps = 11/440 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR+ ++ +L+ V+ K+ S+  +LD E G+  +R LS  D+ LVRA+VN  LR LP
Sbjct: 33  KPGLAARIAATRILAAVLEKKTSMDGMLDSENGNPVYRALSLADRALVRAVVNSALRHLP 92

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+  L  +L   LP+   SL  +L V  AQ+LYLDV D++ VDLAVEQA RD  NR F 
Sbjct: 93  RIETALSMLLDGPLPQGARSLHHVLVVGAAQMLYLDVPDHSAVDLAVEQAHRDPRNRRFV 152

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK E+ + IA + ++PEWF  RL + YG E    IS A ++P  IDLT
Sbjct: 153 KLVNAVLRRLGREKAEIEKAIADVPVLPEWFYARLVSAYGDEVAQRISQAQLTPSCIDLT 212

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L   ++P G +RL E    I SL GFAEG WWVQD +AS+PV+L G ++
Sbjct: 213 VKADPALWAERLGGTLMPNGSVRLGEFEGQIPSLDGFAEGAWWVQDLAASMPVRLLGDIS 272

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQL ++GA+VTALD S  RL +LR NLDRL L+AE + E +   Y
Sbjct: 273 GKRVADLCAAPGGKTAQLALAGARVTALDQSGNRLRRLRENLDRLGLHAETV-EANMLKY 331

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++LFDAVL+DAPCSSTGT+R+HPDV WT+D +DI K A  Q ++L   ++ V PGG+V
Sbjct: 332 QPEQLFDAVLLDAPCSSTGTLRKHPDVCWTKDENDIAKLAALQGQMLRHALTLVGPGGLV 391

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EE++ +VL  +P  VE V ++   W  ++ A  +S  G +R TPDM  
Sbjct: 392 VFSNCSLDPSEGEEMIAEVLAENP-DVERVAVHREDWPGMEAA--ISAAGDLRTTPDMF- 447

Query: 422 KIDGVSSGMDGFFAVALRRL 441
                  G+DGFF+  LR+ 
Sbjct: 448 ------GGVDGFFSSVLRKK 461


>gi|154243996|ref|YP_001414954.1| sun protein [Xanthobacter autotrophicus Py2]
 gi|154158081|gb|ABS65297.1| sun protein [Xanthobacter autotrophicus Py2]
          Length = 471

 Score =  296 bits (756), Expect = 7e-78,   Method: Composition-based stats.
 Identities = 165/442 (37%), Positives = 252/442 (57%), Gaps = 13/442 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
             G+ AR+++   L  V+R   +L   LD +        L  RD+ L   I+  +LR + 
Sbjct: 42  TPGLAARILAVDGLEQVLRHGAALEDALDADVA------LDPRDRALAYRILATSLRRIG 95

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            + A++  ++   LP+    L+ +L     QIL++DV ++A V L V+ A+ D+    FA
Sbjct: 96  TLRALIAKLMERGLPKSAPRLESVLLAGATQILFMDVPNHAAVGLCVDVARADRNTAGFA 155

Query: 122 KLVNSILRRVSREKIELLQRIAG-ISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR++RE   L+  I+   +  PEW  +R    YG E   AI+        +D+
Sbjct: 156 GLVNAVLRRLTREADALMVGISPDFADTPEWMGQRWIKAYGLETTRAIAAMHKVEPPLDI 215

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L+  +LPTG +R+ +    + +LPGFAEG WWVQDA+A++P +L G +
Sbjct: 216 TVKADPALWAERLSGEVLPTGSVRILQA-GPVRALPGFAEGDWWVQDAAAALPARLLGDV 274

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
             L V DLCAAPGGKTAQL  +GA VTA+D S  RL +L+ NL+RL L A+ +       
Sbjct: 275 KGLKVADLCAAPGGKTAQLAAAGAIVTAVDRSSSRLTRLKENLERLKLSAQVV--AGDAA 332

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDAVL+DAPCS+TGT+RRHPD+   +   D+V  A  Q +L+      +KPGG 
Sbjct: 333 DFSGGPFDAVLLDAPCSATGTLRRHPDIAVNKRPGDLVTLAGLQARLIAHAADLLKPGGT 392

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+S CSL+ ++ E+ V+++L +    +   P+     + ID    ++P+G +R  P   
Sbjct: 393 LVYSTCSLEPEEGEQQVERLLAARSDIIR-APIVPGEVEGIDP--FITPQGDVRTLPSHW 449

Query: 421 EKIDGVSSGMDGFFAVALRRLI 442
            + +   SG+DGFFA  L+R  
Sbjct: 450 MRGEAERSGLDGFFAARLKRRA 471


>gi|256045414|ref|ZP_05448306.1| Fmu domain protein, Sun [Brucella melitensis bv. 1 str. Rev.1]
 gi|260565697|ref|ZP_05836180.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|265991841|ref|ZP_06104398.1| fmu domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|260151070|gb|EEW86165.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M]
 gi|263002797|gb|EEZ15200.1| fmu domain-containing protein [Brucella melitensis bv. 1 str.
           Rev.1]
          Length = 465

 Score =  295 bits (754), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 191/445 (42%), Positives = 260/445 (58%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   L    
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALHNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L   +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVESNLTDLPGFAEGEWWVQDVAASLPARLMDDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K     P    L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRLDGNPHMAGMDGFFAARFKRV 465


>gi|306844795|ref|ZP_07477380.1| Sun [Brucella sp. BO1]
 gi|306274967|gb|EFM56737.1| Sun [Brucella sp. BO1]
          Length = 465

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 190/445 (42%), Positives = 263/445 (59%), Gaps = 10/445 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 26  RPGLAARLCAARLLGAVIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALRNRG 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 86  SIERAINKRLDRPLPENAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 145

Query: 122 KLVNSILRR-VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR    ++  L       + +PEWF + + + YG E+   I         ID 
Sbjct: 146 GLVNALLRRLARNKERALAHTFEPEANVPEWFAKSITDAYGAEKAATILAMHAYEPPIDF 205

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 206 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGEWWVQDVAASLPARLMGDI 265

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D
Sbjct: 266 KGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMD 324

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   D+ K A  Q +LL    + VKPG +
Sbjct: 325 FKPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDVAKLAELQGRLLAHAATLVKPGSV 384

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K    +P+   L P          +   ++ EG++R TP  L
Sbjct: 385 IVFSNCSLHPLEGEEMARKA-AENPL---LEPFPITEQDCPGLEGLVTVEGFLRSTPADL 440

Query: 421 E----KIDGVSSGMDGFFAVALRRL 441
                  +   +GMDGFFA   +R+
Sbjct: 441 PPDRFDGNPHMAGMDGFFAARFKRV 465


>gi|299133157|ref|ZP_07026352.1| Fmu (Sun) domain protein [Afipia sp. 1NLS2]
 gi|298593294|gb|EFI53494.1| Fmu (Sun) domain protein [Afipia sp. 1NLS2]
          Length = 446

 Score =  294 bits (753), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 168/439 (38%), Positives = 254/439 (57%), Gaps = 7/439 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ ++  V+ KR +L   L+        + LS RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADIIDGVLHKRRTLDDQLEGPAAHPVLKTLSDRDRALMRRLVATVLRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LGHLLSRLLDRGIPSDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAG 132

Query: 123 LVNSILRRVSREK-IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE    + +   G+  +P W   R    YG++   A++ A      +DLT
Sbjct: 133 LVNAVLRRCAREGLPLVEEVKDGMIDLPPWLVARWIKAYGEDNARAMARAIGHEPPLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E+WA +L+  MLPTG +R  +L   I  LPGF+EG WWVQDA+A+IP +LFG + 
Sbjct: 193 VKTDSESWATRLHGEMLPTGTVR-TQLHGPITMLPGFSEGAWWVQDAAAAIPARLFGDIT 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             SV DLCAAPGGKTAQL  +GA VTA+D S  RL +L+ N  RL L A  +        
Sbjct: 252 GKSVADLCAAPGGKTAQLAQAGAHVTAVDRSAGRLARLKDNFARLSLEASCV--ATDATE 309

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
                FDA+L+DAPC +TGTIRRHPDV W ++  D+      Q++LL + ++ +KPGG++
Sbjct: 310 WDGGPFDAILLDAPCMATGTIRRHPDVAWLKNEADMGALNALQKRLLQKSVTLLKPGGML 369

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E+ +  +L S P  V+ +P+     +   ++  ++ +G +R  P  L 
Sbjct: 370 VYCTCSLEPEEGEQAIASLLASEP-QVKRMPVTP--GELAGLSELITADGDVRTLPCHLP 426

Query: 422 KIDGVSSGMDGFFAVALRR 440
             D   SG+DGF+A  L +
Sbjct: 427 HADPKLSGLDGFYAARLVK 445


>gi|148251938|ref|YP_001236523.1| putative ribosomal RNA small subunit methyltransferase B
           [Bradyrhizobium sp. BTAi1]
 gi|146404111|gb|ABQ32617.1| putative Ribosomal RNA small subunit methyltransferase B
           [Bradyrhizobium sp. BTAi1]
          Length = 450

 Score =  294 bits (753), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 171/440 (38%), Positives = 244/440 (55%), Gaps = 6/440 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ ++  V+ K  +L   LD        + L+ RD+ L+R +V  TLR L  
Sbjct: 13  PGLAARRIAADVVDGVLHKHRTLDDQLDGTGAHPGLKQLADRDRALMRRLVATTLRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  VL  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LGHVLSRLLDRGVPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE   LL  + G    I  W   R    YG+     I+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGAGLLDDVQGQPLDIAPWLLTRWIAHYGEATAKNIAAALGQEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L+  +LPT  +R   L  S+  LPGFAEG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDAAQWAARLHGEVLPTETVR-TLLHGSVTVLPGFAEGQWWVQDAAAALPARLFGDVA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFD 300
             ++ DLCAAPGGKTAQL   GA VTA+D S  R+ +L+ N+ RL L A   + +   + 
Sbjct: 252 GKTMADLCAAPGGKTAQLAHGGAHVTAVDRSPARMARLKDNMTRLQLTAETAVADAAEWQ 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FD +LVDAPC+STGTIRRHPDV W R   DI   +  QR+LL +  S +KPGG+
Sbjct: 312 PAATGGFDGILVDAPCTSTGTIRRHPDVGWLRSEADIAALSSVQRRLLTRAASLLKPGGM 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+VV+  L       EL  +     +   +A  ++  G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQVVESALA---DTTELRRVPITPSEVAGLAELITEAGDLRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D    G+DGF+A  L R
Sbjct: 429 PHQDPRLGGLDGFYAARLER 448


>gi|146337494|ref|YP_001202542.1| putative ribosomal RNA small subunit methyltransferase B
           [Bradyrhizobium sp. ORS278]
 gi|146190300|emb|CAL74296.1| putative Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) (16S rRNA m5C967
           methyltransferase)(rsmB) [Bradyrhizobium sp. ORS278]
          Length = 450

 Score =  294 bits (752), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 174/440 (39%), Positives = 251/440 (57%), Gaps = 6/440 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ ++  V+ K  +L   LD        + L+ RD+ L+R +V  TLR L  
Sbjct: 13  PGLAARRIAADVIDGVLHKHRTLDDQLDGPGAHPGLKQLADRDRALMRRLVATTLRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  VL  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LGNVLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE   LL    G    I  W  +R  + YG+     I+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGAALLDDAKGQPLDIAPWLLKRWTDHYGEATARDIAAALGQEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L+  +LPTG +R   L  S+  LPGFAEG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDPAQWASRLHGEVLPTGTVR-TLLHGSVTVLPGFAEGQWWVQDAAAALPARLFGDVA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE-MDAFD 300
             S+ DLCAAPGGKTAQL   GA+VTA+D S  R+ +L+ N+ RL L AE ++     + 
Sbjct: 252 GKSMADLCAAPGGKTAQLAHGGARVTAVDRSPARMSRLKDNMTRLQLPAETVVTDAAEWQ 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FD +L+DAPC+STGTIRRHPDV W R+  DI   +  Q +LL +    +KPGG 
Sbjct: 312 PADAGGFDGILLDAPCTSTGTIRRHPDVGWLRNEADIAALSGTQVRLLTRAAGLLKPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+VV  VL +    +  VP++ A  +   +A  ++P G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQVVDHVLAA-GTELRRVPIDPA--EVAGLAELVTPMGDLRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D    G+DGF+A  L R
Sbjct: 429 PHADPRLGGLDGFYAARLER 448


>gi|190893964|ref|YP_001980506.1| RNA methyltransferase - sun protein [Rhizobium etli CIAT 652]
 gi|190699243|gb|ACE93328.1| probable RNA methyltransferase - sun protein [Rhizobium etli CIAT
           652]
          Length = 464

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 217/423 (51%), Positives = 286/423 (67%), Gaps = 4/423 (0%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR LPRIDA +  +L S LP 
Sbjct: 44  VVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHLPRIDAAIASLLESPLPE 103

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR FAKLVN++LRR+ REK  
Sbjct: 104 GARALHHVLSIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRFAKLVNAVLRRLGREKDP 163

Query: 138 LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +L  I  ++ +P WF  RLE  YG++  LAIS + + P  IDLTVK D E WA +LN V 
Sbjct: 164 VLAEIDKVAPMPSWFLARLEKAYGRDAALAISQSQLEPAAIDLTVKSDAEGWAKRLNGVA 223

Query: 198 LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTA 257
           LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG L+     DLCAAPGGKTA
Sbjct: 224 LPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDLSGKRAADLCAAPGGKTA 283

Query: 258 QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCS 317
           QLI++G  VTALD S+ RL +LR NLDRL L AE +   D   + P + FDA+L+DAPCS
Sbjct: 284 QLILAGGTVTALDQSESRLRRLRSNLDRLGLKAETV-AADLTTFKPAEGFDAILLDAPCS 342

Query: 318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           STGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP G +VFSNCSLD  + EEVV
Sbjct: 343 STGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPLGTLVFSNCSLDPAEGEEVV 402

Query: 378 QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVA 437
            +VL  +   +E V +++  W  ++ A  ++  G  R  P ML+  +G++SG+DGF+A  
Sbjct: 403 ARVLSDT-DAIERVAISAGDWPGLEAA--ITSLGEFRTLPTMLKMPEGIASGLDGFYAAV 459

Query: 438 LRR 440
           LRR
Sbjct: 460 LRR 462


>gi|90421553|ref|YP_529923.1| Fmu (Sun) [Rhodopseudomonas palustris BisB18]
 gi|90103567|gb|ABD85604.1| Fmu (Sun) [Rhodopseudomonas palustris BisB18]
          Length = 450

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 174/440 (39%), Positives = 253/440 (57%), Gaps = 6/440 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V+ K  +L   L+        + LS RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLHKHRTLDDQLEGAAAHPGLKTLSDRDRALMRRLVATILRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  VL  +L   LP      Q  L +  AQIL+++V D+A VDL+V   + D+    +A 
Sbjct: 73  LGHVLSRMLDRGLPTDAPRAQSALLIGAAQILWMEVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE   L+  + G S  +P W   R    YG +   AI+ A      +DL+
Sbjct: 133 LVNAVLRRCAREGQPLIDEVQGQSLDVPPWLLARWSAHYGADTARAIARAIGEEPSLDLS 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +L+  +LPTG +R   L  S+  LPGF +G WWVQDA+A++P +LFG L 
Sbjct: 193 VKSDAEAWASRLHGEVLPTGTVR-TLLQGSVKMLPGFDDGQWWVQDAAAALPARLFGDLT 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFD 300
             SV DLCAAPGGKTAQL  +GA VTA+D S+ R+ +LR NL RL L A   + +   + 
Sbjct: 252 GKSVADLCAAPGGKTAQLCNAGAWVTAIDRSQSRVARLRENLGRLGLPAETAVADAAEWP 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDAVL+DAPCSSTGTIRRHPDV W +   DI   A  Q++LL + +S +KPGG 
Sbjct: 312 GNGGDGFDAVLLDAPCSSTGTIRRHPDVAWLKQEADIGALAAQQQRLLHKAVSLLKPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E  +  +L  +   +   P++S+  +   +   ++P+G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEVAIAALLAGNSG-MRRAPVDSS--EVAGLGDLITPDGALRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D    G+DGF+A  L +
Sbjct: 429 PHPDPRLGGLDGFYAARLVK 448


>gi|239832893|ref|ZP_04681222.1| Sun, sun protein [Ochrobactrum intermedium LMG 3301]
 gi|239825160|gb|EEQ96728.1| Sun, sun protein [Ochrobactrum intermedium LMG 3301]
          Length = 465

 Score =  294 bits (751), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 196/446 (43%), Positives = 265/446 (59%), Gaps = 10/446 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 25  RPGLAARLCAARLLGAVIEKNTSLDGLTDNTHGHPQYLALEPRDRALVRAILGSALRNRG 84

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V++AQI YLD+ D++ VDLAVE A  D  NR +A
Sbjct: 85  SIERAINKRLDRPLPENAVALKHLLHVAIAQIFYLDLPDHSAVDLAVEAANSDPRNRKYA 144

Query: 122 KLVNSILRRVSREKIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR+SR K       +   + +PEWF + +   YG E+  AI         ID 
Sbjct: 145 GLVNALLRRLSRNKERALAHTLEPETNVPEWFAKSITEAYGAEKAAAILAMHAYEPPIDF 204

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D E WA KL  V LP G +RL+ +  ++  L GFAEG WWVQD +AS+P +L G +
Sbjct: 205 TVKGDAEAWAEKLGGVALPNGSVRLQTVEGNLTDLLGFAEGDWWVQDVAASLPARLMGDI 264

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++LR NL+RL   A+ +   +  D
Sbjct: 265 RGKRVADLCAAPGGKTAQLVLQGADVTALDLSENRLKRLRGNLERLGFEAKTV-ATNLMD 323

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 324 FQPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 383

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSL   + EE+ +K    +P+   L P          +   ++ EG++R TP  L
Sbjct: 384 IVFSNCSLHPLEGEEMARKA-AENPL---LEPFPITEQDCSGLEGLVTVEGFLRSTPADL 439

Query: 421 E----KIDGVSSGMDGFFAVALRRLI 442
                  +   +GMDGFFA   +R  
Sbjct: 440 PPKRFDGNPQMAGMDGFFAARFKRRA 465


>gi|158426322|ref|YP_001527614.1| rRNA SAM-dependent methyltransferase [Azorhizobium caulinodans ORS
           571]
 gi|158333211|dbj|BAF90696.1| rRNA SAM-dependent methyltransferase [Azorhizobium caulinodans ORS
           571]
          Length = 456

 Score =  293 bits (750), Expect = 3e-77,   Method: Composition-based stats.
 Identities = 176/440 (40%), Positives = 257/440 (58%), Gaps = 13/440 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
            +G+ ARL+++  L  ++R   SL      +        L  RD+ L   IV   LR L 
Sbjct: 28  SAGLPARLLAADALDRILRGNASLEDAFIHD------AGLEPRDRALAFRIVATALRRLG 81

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            + AVL  ++    P+    ++ +L V  AQIL++DV D+A V L+V+ A+ D     FA
Sbjct: 82  TLRAVLTALMERGAPKSAPKVETVLLVGAAQILFMDVPDHAAVGLSVDIARGDNSTAGFA 141

Query: 122 KLVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            L+N++LRR++RE+ E L   A +    PEW ++R    YG ER  AI+D       +D+
Sbjct: 142 GLINAVLRRLAREREERLAAFATLGLDTPEWLRQRWTKAYGPERAKAITDILSHEPALDI 201

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA KL   +LPTG +R+ +   ++ +LPG+ +G WWVQDA+A++P +L G +
Sbjct: 202 TVKSDAAGWAEKLGGEVLPTGTVRVLQA-GAVRALPGYEDGEWWVQDAAAALPARLLGDV 260

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
              SV DLCAAPGGKTAQL  +GAKVTA+D S  RL +L  NL RL L A D+ E DA  
Sbjct: 261 AGKSVADLCAAPGGKTAQLAAAGAKVTAVDRSGPRLARLSENLARLKLTA-DVREADAAS 319

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDA+L+DAPC++TGT+RRHPD+ W +   D+   A  Q  L+   +  +K GG+
Sbjct: 320 LKAG-PFDAILLDAPCTATGTLRRHPDIAWAKRPSDVATLAAVQAGLIDHALDLLKSGGL 378

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V++ CSL+ ++ E  V +VL +    VE VPL     +   +A  ++PEG +R  P  L
Sbjct: 379 LVYATCSLEPEEGEAQVARVLAAR-NDVERVPLKPEEMEG--LAPYITPEGDLRTLPCDL 435

Query: 421 EKIDGVSSGMDGFFAVALRR 440
            + +   SG+DGFFA  LR+
Sbjct: 436 VRGEPERSGLDGFFAARLRK 455


>gi|148262276|ref|YP_001228982.1| sun protein [Geobacter uraniireducens Rf4]
 gi|146395776|gb|ABQ24409.1| sun protein [Geobacter uraniireducens Rf4]
          Length = 448

 Score =  292 bits (748), Expect = 5e-77,   Method: Composition-based stats.
 Identities = 111/466 (23%), Positives = 187/466 (40%), Gaps = 43/466 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +  N R  +  +L  + ++R     L+D E        L   D+ L+  +V   LR  
Sbjct: 1   MST-TNPRSAAFEILLRIDKERSYADILIDRELSSG---FLQGPDRGLLTELVYGVLRRQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +++        R + S+  LLR+ + QI YLD V   A V+  V+ AK       
Sbjct: 57  GTLDYIINRFSKQKSERLERSVLVLLRIGLYQIFYLDRVPVSAAVNETVKLAK--VLAPR 114

Query: 120 FAKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISD 170
            +  VN++LR   RE+ ++             +     P W         G     +++ 
Sbjct: 115 ASGFVNAVLRSADRERDDIAYPDKEKDPVGYLSTFYSHPSWLVAGWIGQLGFAEAESLAK 174

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRL------KELPESIVSLPGFAEG 221
           A   P  + +         E    +L +  +     R            S+  L  F +G
Sbjct: 175 AMAEPPPLTIRTNTLKTSREELMERLASEGVQCEATRFSPLGVRIITAGSVARLQSFRDG 234

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
           ++ VQD S+ + V          VLD CAAPGGK   +   + +  ++ A DV  R+L  
Sbjct: 235 LFTVQDESSQLAVMFLSPEPGEKVLDACAAPGGKATHMAQLMGNSGEIIACDVIGRKLRL 294

Query: 279 LRCNLDRLHLYAEDI---IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           +  N  RL +              +      F  +L+DAPCS  G IRR+P+  W +   
Sbjct: 295 IGENAARLGISCIKTVPLNTARPLNSIKDARFQRILLDAPCSGLGVIRRNPEGKWWKTAA 354

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D+ +    Q+ +L     ++K GGI++++ CS  ++++E V+   L      V    L  
Sbjct: 355 DVAELVRGQKTILENLAGYLKRGGILLYATCSTTREENEAVIDDFLSRHSDFV----LED 410

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                      ++P+G  R  P           GMDGFFA  L+++
Sbjct: 411 LRVLFPAYGELITPQGCFRGWPH--------RQGMDGFFAARLKKI 448


>gi|222087916|ref|YP_002546454.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein
           [Agrobacterium radiobacter K84]
 gi|221725364|gb|ACM28520.1| tRNA and rRNA cytosine-C5-methylase (RNA methyltransferase) protein
           [Agrobacterium radiobacter K84]
          Length = 469

 Score =  292 bits (748), Expect = 6e-77,   Method: Composition-based stats.
 Identities = 225/428 (52%), Positives = 290/428 (67%), Gaps = 4/428 (0%)

Query: 13  HLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLI 72
            +LS V+ ++  L  +LD E G+ A++ L   D+ LVRAI+N  LR LPRI+A +  +L 
Sbjct: 44  KILSAVIDRKTPLDGMLDAEGGNPAYKALGDSDRALVRAILNSALRHLPRIEAAIASLLD 103

Query: 73  SSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVS 132
           S LP    +L  +L V  AQ+LYLDV D++ VD+AVEQA +D  NR FAKLVN+ILRR+ 
Sbjct: 104 SPLPEGARALHHVLVVGAAQMLYLDVPDHSAVDIAVEQANQDPRNRRFAKLVNAILRRIG 163

Query: 133 REKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHK 192
           REK ++L + A +  +P+WF  RLE  YG++  L ISD  + P  ID+TVK D E WA +
Sbjct: 164 REKQDILSQGADVPAMPKWFLTRLEAAYGRQAALKISDTQLEPAAIDVTVKSDAEGWAKR 223

Query: 193 LNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAP 252
           LN V+LPTGG+RL     SI SL GFA+G WWVQDA+ASIP +LFG+L    V+DLCAAP
Sbjct: 224 LNGVVLPTGGVRLAAFEGSIPSLDGFADGEWWVQDAAASIPAKLFGSLAGQRVVDLCAAP 283

Query: 253 GGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLV 312
           GGKTAQLI++G KVTALD S  RL++L  NL RL L AE +   D   + P  LFDA L+
Sbjct: 284 GGKTAQLILAGGKVTALDQSANRLKRLSGNLARLGLEAETV-VADMAKFQPDDLFDAALL 342

Query: 313 DAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQD 372
           DAPCSSTGT RRHPDVLWT+  +DI K    Q +LL   ++ VKPGG+VVFSNCSLD ++
Sbjct: 343 DAPCSSTGTTRRHPDVLWTKGPEDIAKLTALQERLLRHALTLVKPGGLVVFSNCSLDPEE 402

Query: 373 SEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDG 432
            E++V +VL  +    E V +    W  ++ A  +SP G  R TPDML    G +SG+DG
Sbjct: 403 GEDLVARVLSET-DMAERVAIKPEDWPGLEAA--ISPLGAFRTTPDMLPLSGGFASGLDG 459

Query: 433 FFAVALRR 440
           FFAV LRR
Sbjct: 460 FFAVVLRR 467


>gi|218439986|ref|YP_002378315.1| sun protein [Cyanothece sp. PCC 7424]
 gi|218172714|gb|ACK71447.1| sun protein [Cyanothece sp. PCC 7424]
          Length = 452

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 123/460 (26%), Positives = 207/460 (45%), Gaps = 42/460 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++  +L  + +K       LD     +    L   D+ LV  +V   +R    +D 
Sbjct: 7   NPRQLALIILRDIYQKEAYTDLALDQGIKRADLGNL---DRGLVTELVYGIVRRQRTLDE 63

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++  +      ++   L+ +L + + Q+ YLD +   A V+ +VE AK++K  +  + +V
Sbjct: 64  IISQLGTKKANQQPPDLRLILHIGLYQLRYLDQIPPSAAVNTSVELAKKNKLGK-LSGVV 122

Query: 125 NSILRRVSR----------EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           N ILR+  R             + +  +  +   P W  +   + +G+E+   + +    
Sbjct: 123 NGILRQYDRIKEQGKDPLKFPSDPVNHLGVLHSFPNWIIQLWLDEFGQEQTEQLCEWFNQ 182

Query: 175 PLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           P  ID+ V     T             K+  +      +RL     SI  LPGF EG W 
Sbjct: 183 PAMIDIRVNLLKTTVEKVASIFSDVGVKVKPIPHLPQSLRLIGGTRSIQQLPGFEEGWWT 242

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           VQD+SA +   L     +  ++D CAAPGGKT  +   +     + A D    RL K++ 
Sbjct: 243 VQDSSAQLVTHLLDPQPDEIIIDACAAPGGKTTHIAQLMGDRGTIWACDRVPSRLRKVQQ 302

Query: 282 NLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
           N +RL L +  I E D+      ++  D VL+DAPCS  GT+ + PD+ W +  + I + 
Sbjct: 303 NAERLQLNSIRICEGDSRHLTQFRETADRVLLDAPCSGLGTLHKRPDIRWRQTPEKIAEL 362

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
           +  Q +LL +  ++VKP GI+V++ C+L+  ++E V+   L   P      P +      
Sbjct: 363 SQLQTELLEETATWVKPKGILVYATCTLNPLENERVIAAFLDRHPSWHIQTPSSDNTV-- 420

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              A   +P GWI++ P            MDGFF V L +
Sbjct: 421 ---AAFATPSGWIKVLPH--------QHQMDGFFMVKLVK 449


>gi|209883490|ref|YP_002287347.1| SUN protein [Oligotropha carboxidovorans OM5]
 gi|209871686|gb|ACI91482.1| SUN protein [Oligotropha carboxidovorans OM5]
          Length = 446

 Score =  292 bits (747), Expect = 7e-77,   Method: Composition-based stats.
 Identities = 167/439 (38%), Positives = 252/439 (57%), Gaps = 7/439 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ ++  V+ KR +L   L+      A + LS RD+ L+R +V   LR    
Sbjct: 13  PGLAARRIAADIIDGVLHKRRTLDDQLEGAAQHPALKSLSDRDRALMRRLVATVLRRRGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LAYLLSRLLDRGVPSDAPRAQSALMIGAAQILWMDVPDHAAVDLSVRLVQADRRAAKYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE I L+         +P W   R    YG++   A++ A      +DLT
Sbjct: 133 LVNAVLRRCAREGIPLIDESTDEMIDLPPWLATRWIKAYGEDTARAMARAIGHEPPLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D E WA +L+   LPTG +R   L  S+  LPGF+EG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDSENWATRLHGETLPTGTVR-TLLHGSVTMLPGFSEGAWWVQDAAAALPARLFGDIA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQL  +GAKVTA+D S  RL +L+ N  RL L A  +        
Sbjct: 252 GKPVADLCAAPGGKTAQLAQAGAKVTAVDRSAGRLARLKENFARLGLEATYV--AADATE 309

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
                FDA+L+DAPC +TGTIRRHPDV W ++  D+   +  Q +LL + ++ +KPGG +
Sbjct: 310 WEAGPFDAILLDAPCMATGTIRRHPDVAWLKNEADLDALSALQARLLRKSVTLLKPGGTL 369

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E+ +  +L + P  ++  P+ ++  +   ++  +SP G +R  P  L+
Sbjct: 370 VYCTCSLEPEEGEQAIAALLEAEP-QMKRRPVEAS--ELAGLSELISPMGDVRTLPCHLQ 426

Query: 422 KIDGVSSGMDGFFAVALRR 440
             D   SG+DGF+A  L +
Sbjct: 427 HDDPKLSGLDGFYAARLVK 445


>gi|251797738|ref|YP_003012469.1| sun protein [Paenibacillus sp. JDR-2]
 gi|247545364|gb|ACT02383.1| sun protein [Paenibacillus sp. JDR-2]
          Length = 491

 Score =  292 bits (747), Expect = 8e-77,   Method: Composition-based stats.
 Identities = 124/462 (26%), Positives = 196/462 (42%), Gaps = 40/462 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
            R ++   L  V          L+    +     L + D  LV  +V  T++    +D  
Sbjct: 40  PRELALDTLVKVAETGAYSNLQLNRVLQE---AQLQRADAALVTELVYGTIQRQLTLDHW 96

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L       L + +  + QLLR+S  Q+LYLD +  +A V+ AV  AKR + ++  + +VN
Sbjct: 97  LGKFAAKGLRKLEPWVHQLLRMSAYQLLYLDRIPAHAAVNEAVTIAKR-RGHQGISGMVN 155

Query: 126 SILRRVSREK----------IELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
            ILR + R +             + +I+     PEW  ER    YG E   AI  +   P
Sbjct: 156 GILRSIDRNRAELTVDAIADKNPVVQISVRYSYPEWLVERWVKAYGAETAEAICASGNEP 215

Query: 176 LYIDLTVKFDIETWAHKLNAVMLPTGGI---------RLKELPESIVSLPGFAEGVWWVQ 226
            +  + V     +    L+ +    G            +     ++    GF +G+W +Q
Sbjct: 216 PHASVRVNPLRSSRNEVLSLLTEQGGDAEASRLAPAGIVVRRGGNLADTEGFRDGLWTMQ 275

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ +  ++      + VLD CAAPGGKT  +   +    KV A D+   + + +    
Sbjct: 276 DESSMLVAEVVAPKAGMQVLDCCAAPGGKTTHMAELMSGKGKVYANDLHPHKRQLIVDQA 335

Query: 284 DRLHLYAEDIIEMDAFDYCPKKLF---DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            RL L   + I  DA     +      DAVL+DAPCS  G IRR P++ WT+   D+ + 
Sbjct: 336 VRLGLQNIEAITEDAGKLGERFAPASIDAVLLDAPCSGFGVIRRKPEIKWTKTAGDVAEI 395

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
           A  QR+LL      VKPGG +V+S C+++  ++EE V   L+  P               
Sbjct: 396 AAIQRRLLGAVAGLVKPGGTLVYSTCTIESTENEEQVAVFLKEHPEFQLDAEWPEEALAP 455

Query: 401 IDMAMALSP--EGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +     +    +G  ++ P           G DGFF   LRR
Sbjct: 456 LREKGIIDSSFDGQAQLLPHHY--------GSDGFFIARLRR 489


>gi|153008423|ref|YP_001369638.1| Fmu (Sun) domain-containing protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151560311|gb|ABS13809.1| Fmu (Sun) domain protein [Ochrobactrum anthropi ATCC 49188]
          Length = 453

 Score =  292 bits (746), Expect = 9e-77,   Method: Composition-based stats.
 Identities = 196/448 (43%), Positives = 273/448 (60%), Gaps = 10/448 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARL ++ LL  V+ K  SL  L D  +G   +  L  RD+ LVRAI+   LR   
Sbjct: 9   RPGLAARLCAARLLGAVIEKNTSLDGLTDNTHGHPQYLALEPRDRALVRAILGSALRNRG 68

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  ++  L   LP    +L+ LL V++AQI YL++ D++ VDLAVE A  D  NR +A
Sbjct: 69  SIERAINKRLDRPLPENAVALKHLLHVAIAQIFYLNLPDHSAVDLAVEAANADPRNRKYA 128

Query: 122 KLVNSILRRVSREKIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR+SR K       +   + +PEWF + + + YG E+  AI         ID 
Sbjct: 129 GLVNALLRRLSRNKERALAHTLEPETNVPEWFAKSITDAYGAEKAAAILAMHAYEPPIDF 188

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA KL  V LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L G +
Sbjct: 189 TVKGDAKAWAEKLGGVALPNGSVRLQTVEGNLTDLPGFAEGDWWVQDVAASLPARLMGDI 248

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V DLCAAPGGKTAQL++ GA VTALD+S+ RL++LR NL+RL   A+ +   +  D
Sbjct: 249 KGKRVADLCAAPGGKTAQLVLQGANVTALDLSENRLKRLRGNLERLGFEAKTV-ATNLMD 307

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           + P +LFDAVL+DAPCSSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG+
Sbjct: 308 FQPDELFDAVLLDAPCSSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGV 367

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID--MAMALSPEGWIRITPD 418
           +VFSNCSL   + EE+ +K    +P+ +E  P+      S++  +   ++ EG++R TP 
Sbjct: 368 IVFSNCSLHPLEGEEMARKA-AENPL-LEPFPITEQDCPSLNGLLDGLVTAEGFLRSTPA 425

Query: 419 MLE----KIDGVSSGMDGFFAVALRRLI 442
            L     + +   +GMDGFFA   +R  
Sbjct: 426 DLPPDRFEGNPHMAGMDGFFAARFKRRA 453


>gi|296133297|ref|YP_003640544.1| sun protein [Thermincola sp. JR]
 gi|296031875|gb|ADG82643.1| sun protein [Thermincola potens JR]
          Length = 451

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 103/465 (22%), Positives = 196/465 (42%), Gaps = 41/465 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M+S   AR ++  ++  V R+       L+            ++D+  +  +V  TL+ L
Sbjct: 1   MRS---ARKLALEVIYQVDREGAYSNIALNKVLEKYQP---EKKDRAFITELVYGTLKRL 54

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +    +   L      ++ ++R+ + QI ++D V + A  + +V  A++   ++ 
Sbjct: 55  NTLDWIAGRFVSRPLDSLTPWIRNIIRMGIYQIFFMDKVPNSAACNESVNLARKF-GHQG 113

Query: 120 FAKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISD 170
             K VN +LR V R K  +             +     P W        +G E    +  
Sbjct: 114 TVKFVNGVLRNVVRHKDRVKWPDKDAEPVEYLSIHYSHPTWMVSLWIEEFGFEETEKLCR 173

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEG 221
           A        +         +     L    +                 +SI SL   A+G
Sbjct: 174 ANNETPPNSIRTNTLKISRDELIGVLAGEGVECRKGEFAPETINISGFKSIASLKSHAQG 233

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
           ++ VQD S+++   +        V+D C+APGGKT  L   + +  ++ A D+ + ++  
Sbjct: 234 LYLVQDESSTMVGHIVAPKPGSKVIDACSAPGGKTTHLAQLMNNQGRILAGDIHQHKMGL 293

Query: 279 LRCNLDRLHLYAEDIIEMDAF--DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ N  RL +   +   +DA       K+  D VLVDAPCS  G +RR P++ W +  + 
Sbjct: 294 IKENCSRLGVNIIEPALVDARELHKEYKEWADFVLVDAPCSGLGVLRRRPELRWRKTVNR 353

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
             +    Q  +L      VK GG++V+S C+++++++ ++V+  L ++P    L  L   
Sbjct: 354 FDELTALQLAILRSAAQCVKAGGVLVYSTCTVNRRENLDLVRSFLENAP-EFRLDSLLPL 412

Query: 397 YWKSIDMAMALS-PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +  + D     +  EG+I+  P +         G DGFFA  + +
Sbjct: 413 FPDTCDRTKFPTAAEGYIQFLPHV--------HGTDGFFAARMVK 449


>gi|303239358|ref|ZP_07325886.1| sun protein [Acetivibrio cellulolyticus CD2]
 gi|302593144|gb|EFL62864.1| sun protein [Acetivibrio cellulolyticus CD2]
          Length = 450

 Score =  292 bits (746), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 102/464 (21%), Positives = 203/464 (43%), Gaps = 40/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +  R  +  +L  + +        L+    D A   L   D+  +  +V  TL++ 
Sbjct: 1   MKLDLP-RETALKILYDINKSGAYSNIALNKYLEDKALSGL---DKAFITELVYGTLKWR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRH 119
             ID ++D      + +    +  +LR+ V QI+Y+  + + A  + +V  AKR   +  
Sbjct: 57  LSIDYIIDQFSSVKINKLSPWILNILRLGVYQIVYMSKIPESAACNESVNLAKRY-GHSA 115

Query: 120 FAKLVNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
            ++ VN++LR                +L+  ++     P+W  ++  + +G+     +  
Sbjct: 116 SSRYVNAMLRNVARSKNKIVYPDRNKDLISYLSIKYSHPDWMVKKWLDRFGESFTEELLK 175

Query: 171 ACISPLYIDLTVK---FDIETWAHKLNAVML------PTGGIRLKELPESIVSLPGFAEG 221
           +      + + V       E   + L                     P S+  +  F +G
Sbjct: 176 SNNETAPLTVRVNSLKTTREELENTLKKEGFETESAKYIENALTINNPSSLTKMEAFVKG 235

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
            + VQD S+ +  ++F       ++D+C+APGGKT  +   + +  ++ A D+ + ++  
Sbjct: 236 FFQVQDESSMMVGRIFDPKPGEFIVDVCSAPGGKTTHIAELMGNRGQIIARDIHEHKIRL 295

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +     RL +        DA +         D VLVDAPC+  G IRR PD+ W R+++D
Sbjct: 296 INEASSRLGIDIIKAEIFDASEQDASLTDKADRVLVDAPCTGLGIIRRKPDIKWARNSND 355

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           + +    Q K+L     +VKPGG++V+S C+++ Q++EE+V+K L+ +     +  ++  
Sbjct: 356 LNEIVKLQEKILNASSKYVKPGGVLVYSTCTIEPQENEEMVKKFLKDNK-EYTMEDISKQ 414

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
               +      + +G+I++             G+DGFF   +R+
Sbjct: 415 LPDGLV--KDTTKDGYIQLY--------TNRDGIDGFFISKMRK 448


>gi|163757448|ref|ZP_02164537.1| putative ribosomal RNA small subunit methyltransferase B [Hoeflea
           phototrophica DFL-43]
 gi|162284950|gb|EDQ35232.1| putative ribosomal RNA small subunit methyltransferase B [Hoeflea
           phototrophica DFL-43]
          Length = 446

 Score =  291 bits (745), Expect = 1e-76,   Method: Composition-based stats.
 Identities = 200/438 (45%), Positives = 265/438 (60%), Gaps = 6/438 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR  ++ LL+ V   R SL  LLD   G+ AF  L  +D++LVRAI+   LR L 
Sbjct: 11  KPGLAARQAATRLLAAVTESRASLDGLLDPAGGNPAFTGLGPQDRLLVRAILLSALRHLR 70

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            IDA +D ++ S LP    +L+QLLRV  AQIL+LDV D A VDLAV QA  D  NR FA
Sbjct: 71  VIDAYIDELVTSPLPEGAKALRQLLRVGAAQILFLDVPDRAAVDLAVSQANGDPRNRRFA 130

Query: 122 KLVNSILRRVSREKIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR+ REK     +  A +   P+WF  R++N Y  +   +I      P  IDL
Sbjct: 131 GLVNALLRRMGREKESRLSELTATVPPFPDWFVSRIQNAYS-QEADSILSMLSVPPAIDL 189

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L   +LPTG +R+      +  L G+  G WWVQDA+ASIP Q+F  L
Sbjct: 190 TVKTDPAGWAERLGGTVLPTGSVRIARPAGPVTDLEGYDGGDWWVQDAAASIPAQMFSRL 249

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           + L V DLCAAPGGKTAQL ++GA+VTA D S  RLE+L+ NL RL L         A D
Sbjct: 250 DGLEVADLCAAPGGKTAQLALAGARVTACDQSANRLERLKGNLSRLGLE-VSTHLSRAQD 308

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           +   + FD VLVDAPCSSTGT+RRHPD+ +T+  +DI +    QR LL      V+P G 
Sbjct: 309 FKAPEGFDGVLVDAPCSSTGTVRRHPDIPYTKGPEDITRLTQVQRALLDHAAGLVRPKGE 368

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCSLD ++ E +VQ  L   P    + P++++ W  ++ A  ++  G +R  P ML
Sbjct: 369 LVFSNCSLDPEEGELMVQGFLADHPSW-RIKPVDASRWPGMEAA--ITELGEVRTHPAML 425

Query: 421 EKIDGVSSGMDGFFAVAL 438
              D   +G+DGF+AV L
Sbjct: 426 SDDDPAQAGLDGFYAVVL 443


>gi|218460752|ref|ZP_03500843.1| RNA methyltransferase - sun protein [Rhizobium etli Kim 5]
          Length = 466

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 222/423 (52%), Positives = 288/423 (68%), Gaps = 4/423 (0%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR LPRIDA +  +L S LP 
Sbjct: 46  VVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHLPRIDAAIASLLESPLPE 105

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR FAKLVN++LRR+ REK E
Sbjct: 106 GARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRFAKLVNAVLRRLGREKEE 165

Query: 138 LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +L  I  ++ +P WF  RLE  YG+E  LAIS + + P  IDLTVK D E WA +LN V 
Sbjct: 166 VLAEIGKVAPMPSWFLARLEKAYGREAALAISQSQLEPAAIDLTVKSDAEGWAKRLNGVA 225

Query: 198 LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTA 257
           LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG L      DLCAAPGGKTA
Sbjct: 226 LPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDLAGKRAADLCAAPGGKTA 285

Query: 258 QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCS 317
           QLI++G  VTALD S+ RL +LR NLDRL L AE +   D   + P + FDA+L+DAPCS
Sbjct: 286 QLILAGGAVTALDQSESRLRRLRSNLDRLGLTAETV-AADLTTFKPPEGFDAILLDAPCS 344

Query: 318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           STGT RRHPDVLWT+  DDI + A  Q +LL   ++ + P G++VFSNCSLD  + EEVV
Sbjct: 345 STGTTRRHPDVLWTKGPDDIARLAALQERLLRHALTLLTPFGMLVFSNCSLDPAEGEEVV 404

Query: 378 QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVA 437
            +VL  +   +E VP+N+  W  ++ A  ++P G  R  P ML+  +G++SG+DGF+A  
Sbjct: 405 ARVLSDT-DAIERVPINAGDWPGLEAA--ITPLGEFRTLPTMLKMPEGIASGLDGFYAAV 461

Query: 438 LRR 440
           LRR
Sbjct: 462 LRR 464


>gi|78221293|ref|YP_383040.1| Fmu, rRNA SAM-dependent methyltransferase:Nop2p [Geobacter
           metallireducens GS-15]
 gi|78192548|gb|ABB30315.1| Fmu, rRNA SAM-dependent methyltransferase:Nop2p [Geobacter
           metallireducens GS-15]
          Length = 446

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 125/462 (27%), Positives = 196/462 (42%), Gaps = 40/462 (8%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +  N R  +  +L  V R R     LLD E        L+  D+ L+  +V   LR    
Sbjct: 2   TRSNPRRTALDILLRVERDRAFAEQLLDRELS---LGTLTGPDRGLLTELVYGVLRRQGT 58

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +D ++D    S   + + ++  +LR+ + Q+ +LD +   A V+ +V  AK        A
Sbjct: 59  LDFLVDAFAASRSGKLERAILVILRLGLYQLFFLDRIPTSAAVNESVNLAKAV--APRAA 116

Query: 122 KLVNSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             VN++LRR  RE+  L            IA     P W  E+     G      ++ A 
Sbjct: 117 GFVNAVLRRADRERDSLPWPDRGADPAAYIAVRHSHPRWLVEQWIEQLGIPEAEELAVAM 176

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVW 223
                + + V       E +  +L A  +                  ++ +LPGFAEG++
Sbjct: 177 AEQAPLTIRVNTLKTTREAFMEELAAAGITAEPTVWAPHGVRILSRTAVTTLPGFAEGLF 236

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQD S+ +            +LD+CAAPGGK   L   + +  +V A D+S ++L  + 
Sbjct: 237 TVQDESSQLAAFFLDPQPGERILDVCAAPGGKATYLAQLMENRGEVLACDISAKKLRLVA 296

Query: 281 CNLDRLHLYAEDIIEMDAFDY-CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
               RL +     +  DA      +  FD +L+DAPCS  G IRR+P+  W +  DD+ +
Sbjct: 297 EAAARLGIGIIRTMAGDATKPGAGEPPFDRILLDAPCSGFGVIRRNPEGKWWKTPDDLAR 356

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  QR +L      ++PGG++++S CS    + E+VV   L      V    L      
Sbjct: 357 LAATQRNILAAVAPRLRPGGVLLYSTCSTMVAEDEDVVDDFLSRHEDFV----LEDLNAI 412

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           S D     +  G  R  P           GMDGFFA  +R+L
Sbjct: 413 SPDFPGQFTGRGHFRSWPH--------RHGMDGFFAARIRKL 446


>gi|85714014|ref|ZP_01045003.1| tRNA and rRNA methylase [Nitrobacter sp. Nb-311A]
 gi|85699140|gb|EAQ37008.1| tRNA and rRNA methylase [Nitrobacter sp. Nb-311A]
          Length = 454

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 168/442 (38%), Positives = 251/442 (56%), Gaps = 7/442 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
             G+  R  ++ +L  ++ KR +L   L+        + L+ RD+ L+R +V   LR L 
Sbjct: 16  APGLATRRTAADILDGILHKRRTLDEQLEGATAHPGLKALADRDRALMRRLVATILRRLG 75

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +  +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A
Sbjct: 76  TLGHLLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYA 135

Query: 122 KLVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR +RE   L++ +   S  +P W   R    YG+    AI+ A      +DL
Sbjct: 136 GLVNAVLRRCAREGQALIEEVRSESLDVPPWLMARWSRHYGENTAKAIAAAINYEPALDL 195

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D   WA +L+   LPTG +R   L  S+  LPGF++G WWVQDA+A++P +LFG +
Sbjct: 196 TVKADAAYWATRLHGEALPTGTVR-TSLQGSVTMLPGFSDGQWWVQDAAAALPARLFGDI 254

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLY--AEDIIEMDA 298
           +   ++DLCAAPGGKTAQL  +GA VTA+D S  R+ +LR NL RL L   +     ++ 
Sbjct: 255 SGRRIIDLCAAPGGKTAQLAQAGADVTAMDRSPNRVARLRENLGRLSLTVRSIVADAIEW 314

Query: 299 FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
            +      FD VLVDAPCS+TGTIRRHPDV W +   DI      Q++LL + I+ +KPG
Sbjct: 315 QNDVGVDSFDGVLVDAPCSATGTIRRHPDVAWLKQESDIGALTALQQRLLKKAITLLKPG 374

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G +++  CSL+ ++ E+VV  +L S P  +  VP++ A  +   +   ++P G +R  P 
Sbjct: 375 GTLIYCTCSLEPEEGEQVVAALLASEPG-IRRVPVSGA--EVAGLTDIVTPAGDLRTLPC 431

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
            L   D    G+DGF+A  L +
Sbjct: 432 HLPHDDPTLGGLDGFYAARLTK 453


>gi|86359687|ref|YP_471579.1| RNA methyltransferase - sun protein [Rhizobium etli CFN 42]
 gi|86283789|gb|ABC92852.1| probable RNA methyltransferase - sun protein [Rhizobium etli CFN
           42]
          Length = 464

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 223/423 (52%), Positives = 289/423 (68%), Gaps = 4/423 (0%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR LPRIDA +  +L S LP 
Sbjct: 44  VVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHLPRIDAAIASLLESPLPE 103

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR FAKLVN++LRR+ REK E
Sbjct: 104 GARALHHVLAIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRFAKLVNAVLRRLGREKDE 163

Query: 138 LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +L RI  ++ +P WF  RLE  YG++  LAIS + + P  IDLTVK D E WA +LN V 
Sbjct: 164 VLARIGKVAPMPSWFLARLEKAYGRDAALAISQSQLEPAAIDLTVKSDAEGWAKRLNGVA 223

Query: 198 LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTA 257
           LPTGG+RL      I SL GF EG WWVQDA+ASIP +LFG L+     DLCAAPGGKTA
Sbjct: 224 LPTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDLSGKRAADLCAAPGGKTA 283

Query: 258 QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCS 317
           QLI++G  VTALD S+ RL +LR NLDRL L AE +   D   + P + FDA+L+DAPCS
Sbjct: 284 QLILAGGAVTALDQSESRLRRLRSNLDRLALKAETV-AADLMTFKPSEGFDAILLDAPCS 342

Query: 318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           STGT RRHPDVLWT+  DDI + A  Q +LL   ++ +KP G +VFSNCSLD  + EEVV
Sbjct: 343 STGTTRRHPDVLWTKGPDDIARLAALQERLLRHALTLLKPLGTLVFSNCSLDPAEGEEVV 402

Query: 378 QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVA 437
            +VL  +   +E V +N+  W  ++ A  ++P G  R  P ML+  DG++SG+DGF+A  
Sbjct: 403 ARVLSDT-NAIERVAINAGDWPGLEAA--ITPLGEFRTLPTMLKMPDGIASGLDGFYAAV 459

Query: 438 LRR 440
           LRR
Sbjct: 460 LRR 462


>gi|327191218|gb|EGE58261.1| putative RNA methyltransferase - sun protein [Rhizobium etli
           CNPAF512]
          Length = 464

 Score =  291 bits (744), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 216/423 (51%), Positives = 285/423 (67%), Gaps = 4/423 (0%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+ +++ L   LD E+G+ A++ L + D+ LVRAI+N TLR LPRIDA +  +L S LP 
Sbjct: 44  VVDRKLPLDGALDHEHGNPAYKALGESDRALVRAILNTTLRHLPRIDAAIASLLESPLPE 103

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L +  AQILYLDV D++ VDLAVEQA +D  NR FAKLVN++LRR+ REK  
Sbjct: 104 GARALHHVLSIGAAQILYLDVPDHSAVDLAVEQANQDPRNRRFAKLVNAVLRRLGREKDA 163

Query: 138 LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVM 197
           +L  I  ++ +P WF  RLE  YG++  LAIS + + P  IDLTVK D E WA +LN V 
Sbjct: 164 VLAEIGKVAPMPSWFLARLEKAYGRDAALAISQSQLEPGAIDLTVKSDAEGWAKRLNGVA 223

Query: 198 LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTA 257
           L TGG+RL      I SL GF EG WWVQDA+ASIP +LFG L+     DLCAAPGGKTA
Sbjct: 224 LLTGGVRLAAFDGGIPSLEGFDEGAWWVQDAAASIPARLFGDLSGKRAADLCAAPGGKTA 283

Query: 258 QLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCS 317
           QLI++G  VTALD S+ RL +LR NLDRL L AE +   D   + P + FDA+L+DAPCS
Sbjct: 284 QLILAGGTVTALDQSESRLRRLRSNLDRLGLKAETV-AADLTTFKPAEGFDAILLDAPCS 342

Query: 318 STGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVV 377
           STGT RRHPDVLWT+  +DI + A  Q +LL   ++ +KP G +VFSNCSLD  + EEVV
Sbjct: 343 STGTTRRHPDVLWTKGPEDIARLAALQERLLRHALTLLKPLGTLVFSNCSLDPAEGEEVV 402

Query: 378 QKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVA 437
            +VL  +   +E V +++  W  ++ A  ++  G  R  P ML+  +G++SG+DGF+A  
Sbjct: 403 ARVLSDT-DAIERVAISAGDWPGLEAA--ITSLGEFRTLPTMLKMPEGIASGLDGFYAAV 459

Query: 438 LRR 440
           LRR
Sbjct: 460 LRR 462


>gi|220906120|ref|YP_002481431.1| sun protein [Cyanothece sp. PCC 7425]
 gi|219862731|gb|ACL43070.1| sun protein [Cyanothece sp. PCC 7425]
          Length = 443

 Score =  291 bits (743), Expect = 2e-76,   Method: Composition-based stats.
 Identities = 127/457 (27%), Positives = 199/457 (43%), Gaps = 40/457 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR ++   L  V  +       ++            +R++ L   +V   +R    +D
Sbjct: 1   MNARQLAFITLQAV-HRGAYADVAVERSLRQHPLT--EERERRLATELVYGCVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
           A++D +      ++   L+ LL + + Q+ YL+ +   A V   VE  K  +     A  
Sbjct: 58  ALVDQLAKKPARQQPPDLRTLLHLGLYQLRYLNHIPANAAVHTTVELVK-HRGLAGLAGF 116

Query: 124 VNSILRRVSRE---------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN +LR+  R+           + +Q++A +   P+W         G      +      
Sbjct: 117 VNGLLRQYIRQSAGGDPLSLPTDPVQQLALLHSYPDWIVANWMEQIGTTETDQLCQWLNR 176

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGI-------RLKELPESIVSLPGFAEGVWW 224
           P  IDL +      IE       +  +    +       RL E   +I  LPGFA+G W 
Sbjct: 177 PPSIDLRINPLQTSIEQVGSAFQSAGVSVQPLAGLPQGLRLTEPSGAIEQLPGFAQGWWS 236

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           VQDASA +   L        ++D CAAPGGK+  +   I     V A D +  RL+KL  
Sbjct: 237 VQDASAQLVSHLLNPQPGEVIIDACAAPGGKSTHIAELIGDKGIVWACDRTPSRLKKLEQ 296

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           N  RL L +  I + D+         D VL+DAPCS  GT+ RH D  W +  + + + A
Sbjct: 297 NRQRLKLNSIRICQGDSRMSEFTAQADRVLLDAPCSGLGTLHRHADARWRQTPESVAQLA 356

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q +LL    ++VKPGG +V++ C+L   ++E V+Q+ L   P      P +  +    
Sbjct: 357 QLQTELLHHTATWVKPGGTLVYATCTLHPTENEAVIQQFLAHHPQWQIQAPRHPPF---- 412

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
             A  L+P+GWI++ P            MDGFF V L
Sbjct: 413 -SADWLAPQGWIKVWPH--------RHQMDGFFMVRL 440


>gi|284050071|ref|ZP_06380281.1| Fmu, rRNA SAM-dependent methyltransferase [Arthrospira platensis
           str. Paraca]
 gi|291566504|dbj|BAI88776.1| ribosomal RNA small subunit methyltransferase B [Arthrospira
           platensis NIES-39]
          Length = 447

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 117/462 (25%), Positives = 199/462 (43%), Gaps = 47/462 (10%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++   L  + R+      +LD +        L   D+ L   +V    R    +DA
Sbjct: 4   NPRQLAFVTLRDIQRRGAFADIVLDEKLR---QADLKDADRRLGTELVYGCTRRRRTLDA 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D +      ++   L+ +L + + Q+ +  ++   A V+  V+  K +  +      V
Sbjct: 61  IIDRLAKKPAHQQPPDLRIILHLGLYQLCFSSNIPPSAAVNTTVDLTKVNNLS-GLGGFV 119

Query: 125 NSILRRVSREKIELLQRIAGI-------------SIIPEWFKERLENFYGKERVLAISDA 171
           N +LR+  R         + +                P+W  +      G+ +   + D 
Sbjct: 120 NGLLRQYLRLVEAGNSLESILQLPENPVSRLGILHSFPDWMIKFWLEELGESQTQQLCDW 179

Query: 172 CISPLYIDLTVKF------DIETWAHKLNAVMLP----TGGIRLKELPESIVSLPGFAEG 221
                 +DL +         +ET   +   +  P      G RL     +I +LPG+ +G
Sbjct: 180 FNQSPSLDLRINPLSTTLETVETAFQQQEIIGSPLPKLPQGWRLSSGVGAIRNLPGYDQG 239

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
            W VQDASA +   +        ++D CAAPGGKT  +   +    KV A+D S  RL+ 
Sbjct: 240 WWTVQDASAQLVGYIVDPQPGEIIIDACAAPGGKTTHIAELMGDNGKVIAIDRSPGRLKP 299

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           L+ N++RL L +  +   D+  +     + D VL+DAPCS  GT+ R  D  W +  D I
Sbjct: 300 LKQNINRLKLRSIQVEVGDSRHFPQYNNMADRVLLDAPCSGGGTLHRRSDSRWRQTPDQI 359

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            + +  Q +LL     +VKPGG++V++ C+L  Q++E  +   L   P     VP     
Sbjct: 360 RQLSQLQAELLEMVSHWVKPGGVLVYATCTLYPQENEWAIASFLSRHPSWRVEVP----- 414

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
             ++D+ +  + EGW++I P            MDGFF   LR
Sbjct: 415 --NLDLPVEPTKEGWLKIWPH--------RHQMDGFFIAKLR 446


>gi|16329552|ref|NP_440280.1| Fmu and Fmv protein [Synechocystis sp. PCC 6803]
 gi|2500952|sp|P72943|RSMB_SYNY3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|1652035|dbj|BAA16960.1| Fmu and Fmv protein [Synechocystis sp. PCC 6803]
          Length = 446

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 116/460 (25%), Positives = 193/460 (41%), Gaps = 40/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           ++AR ++  +L  + R+       +D          LS  D+     +V   +R    +D
Sbjct: 2   ISARQLAFLILRDINRRDSYTDVAIDRALQKHP---LSPPDRRFCTELVYGVVRRQRTLD 58

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +++ +    + ++   L++++++ + Q+ YLD V   A V+  V+ AK +   +  +K+
Sbjct: 59  CLIEQLGDRPIGKQPPDLRRIVQLGLYQLRYLDQVPASAAVNTGVDLAKAN-GLKGLSKV 117

Query: 124 VNSILRRVSREKIELLQRIAG-------ISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LRR  R + +    +             P+W  E  E  +GK    ++        
Sbjct: 118 VNGMLRRYQRAEEQGKNILDQEKISLGEQYSFPDWLMELFEQTWGKAETESLCAYFNQNP 177

Query: 177 YIDLTVKF----------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
            +DL +             +        A+     G+RL     +I  LPGFAEG W VQ
Sbjct: 178 SLDLRINPLKTSRVEVAQSLAELNLTTTAMAGLPQGLRLGGKTGAITQLPGFAEGWWTVQ 237

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           DASA    Q+       ++ D+CAAPGGKT  +   +    ++ A D    RL+KL    
Sbjct: 238 DASAQWVAQILNPQPEETIFDVCAAPGGKTTHIAELMGDQGQIYAGDRHGWRLQKLAVTQ 297

Query: 284 DRLHLYAEDIIEMDAFDY---CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            RL L +  I E D        P +L D  L+D PCS  GT+ R+PD+ W +    I   
Sbjct: 298 QRLGLTSIKIWEGDLTQPGVKPPVELVDRALLDVPCSGLGTLHRNPDLRWRQTPATIATL 357

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q+ LL      VK GG +V+S C+L+  ++E  +++ L+               W S
Sbjct: 358 LPLQQALLKAIAPLVKSGGTLVYSTCTLNPAENEAQIERFLQDHEDWRS----EPFEWTS 413

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                     G + I P             DGFF   L++
Sbjct: 414 PQGQTNSVTSGMLTILPHH--------HHQDGFFIANLKK 445


>gi|209524134|ref|ZP_03272685.1| sun protein [Arthrospira maxima CS-328]
 gi|209495509|gb|EDZ95813.1| sun protein [Arthrospira maxima CS-328]
          Length = 458

 Score =  290 bits (742), Expect = 3e-76,   Method: Composition-based stats.
 Identities = 116/462 (25%), Positives = 198/462 (42%), Gaps = 47/462 (10%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++   L  + R+      +LD +        L   D+ L   +V    R    +DA
Sbjct: 4   NPRQLAFVTLRDIQRRGAFADLVLDEKLR---QADLKDADRRLGTELVYGCTRRRRTLDA 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILY-LDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D +      ++   L+ +L + + Q+ +  ++   A V+  V+  K +  +      V
Sbjct: 61  IIDRLAKKPAHQQPPDLRIILHLGLYQLSFSTNIPPSAAVNTTVDLTKVNHLS-GLGGFV 119

Query: 125 NSILRRVS-------------REKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
           N +LR+               +     + R+  +   P+   +      G+ +   + D 
Sbjct: 120 NGLLRQYLRLLEAGNSLESILQLPENPVSRLGILHSFPDSMIKFWLEELGESQTEQLCDW 179

Query: 172 CISPLYIDLTVKF------DIETWAHKLNAVMLP----TGGIRLKELPESIVSLPGFAEG 221
                 +DL +         +ET   +   +  P      G RL     +I +LPG+ +G
Sbjct: 180 FNQSPSLDLRINPLSTTLETVETAFQQREIIGSPIPKLPQGWRLSYGVGAIANLPGYDQG 239

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
            W VQDASA +   +        ++D CAAPGGKT  +   +    K+ A+D S  RL+ 
Sbjct: 240 WWTVQDASAQLVGYVVDPQPGEIIIDACAAPGGKTTHIAELMGDNGKIIAIDRSPGRLKP 299

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           L+ N+ RL L +  +   D+  +       D VL+DAPCS  GT+ R  D  W +  D I
Sbjct: 300 LQQNIKRLKLRSIQVEVGDSRHFPQYNNTADRVLLDAPCSGGGTLHRRSDARWRQTPDQI 359

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            + +  Q +LL     +VKPGG++V++ C+L  Q++E  +   L   P     VP     
Sbjct: 360 RQLSQLQAELLEMVSHWVKPGGVLVYATCTLHPQENEWAIASFLSRHPTWRVEVP----- 414

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
             +ID+ +  + EGW++I P            MDGFF   LR
Sbjct: 415 --NIDLPVEPTKEGWLKIWPH--------RHQMDGFFIAKLR 446


>gi|222054190|ref|YP_002536552.1| sun protein [Geobacter sp. FRC-32]
 gi|221563479|gb|ACM19451.1| sun protein [Geobacter sp. FRC-32]
          Length = 448

 Score =  290 bits (741), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 119/466 (25%), Positives = 196/466 (42%), Gaps = 43/466 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M S  N R  +  +L  + ++R     L+D E    A +     D+ L+  +V   LR  
Sbjct: 1   MSSS-NPRSAAFEILLRIDKERSYADILIDRELSAGALQG---PDRGLLTELVYGVLRRQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D ++       L R + S+  LLR+ + Q+ YLD V   A V+  V+ AK       
Sbjct: 57  ATLDHIIRRFSSQRLERLERSVLLLLRIGLYQMFYLDRVPVSAAVNETVKLAKVLV--PR 114

Query: 120 FAKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISD 170
            +  +N++LR   RE+  +             A +   P W         G +    ++ 
Sbjct: 115 ASGFINAVLRNADRERDHISYPDREKDPAAYLATVYSHPVWLAAAWIGQLGLDEAEMLAR 174

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRL------KELPESIVSLPGFAEG 221
           A   P  I +         +     L+A  +     R         L  S+  L  F +G
Sbjct: 175 AMAEPPAITVRTNTLKTTRQQLMEILSAEGVQCETGRFSPMAIRINLSGSVSRLKSFRDG 234

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
           +++VQD S+ +     G      VLD CAAPGGK+ QL   +    ++ A DV  R+L+ 
Sbjct: 235 LFFVQDESSQLAAMFLGPQAGERVLDACAAPGGKSTQLAQLMGDRGEILACDVIGRKLKL 294

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYC---PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           +  N  RL + +   + +D         +   D +L+DAPCS  G IRR+P+  W +   
Sbjct: 295 VDENAARLGISSIRTVLLDTARPLKSLERSPLDRILLDAPCSGLGVIRRNPEGKWWKSAA 354

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D++  A  QR LL      ++ GG ++++ CS   +++E V++  L      V    +  
Sbjct: 355 DVIDLAKGQRALLENLAGHLRSGGSLLYATCSTAVEENEAVIEAFLSRHDEFV----IED 410

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                 D+A   +P G+ R  P           GMDGFFA  L++ 
Sbjct: 411 LRLLFPDLAELFTPAGFFRAWPH--------RHGMDGFFAARLKKK 448


>gi|126656069|ref|ZP_01727453.1| Fmu, rRNA SAM-dependent methyltransferase [Cyanothece sp. CCY0110]
 gi|126622349|gb|EAZ93055.1| Fmu, rRNA SAM-dependent methyltransferase [Cyanothece sp. CCY0110]
          Length = 452

 Score =  289 bits (740), Expect = 4e-76,   Method: Composition-based stats.
 Identities = 118/464 (25%), Positives = 205/464 (44%), Gaps = 42/464 (9%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K   NAR ++  +L  + R+       LD          L+  D+ L   +V   +R   
Sbjct: 5   KKNTNARQLTLDILRHIDRQHTYTDIALDRSLT---QNNLNPSDRSLCTQLVYGIVRHQR 61

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHF 120
            +D ++D +      ++   L+++L + + Q+ YL+ +   A V+ +V  AK  + NR  
Sbjct: 62  TLDTLIDQLGKKKAQQQPPDLRRILHIGLYQLRYLNHIPPSAAVNTSVNLAKDYQLNR-L 120

Query: 121 AKLVNSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
           + +VN ILR+  R+              +++IA     P W  E     +G+E    +  
Sbjct: 121 SGVVNGILRQYIRKSKESQDPLILPSNPIEKIAIQYSFPNWMIETWVKQWGEETTEKLCY 180

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFAE 220
                  ID+ +      ++T  ++L                +RL+    +I +LPGF E
Sbjct: 181 WFNQTPTIDIRINPLKTTLQTLENQLIETGVNVTPLPPFPCTLRLQGKIGTIQTLPGFHE 240

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLE 277
           G W +QD+SA +   L       +++D CAAPGGKT  +   +     V A D +  RL+
Sbjct: 241 GHWTIQDSSAQLVSYLLDPQPGETIIDACAAPGGKTTHIAELMGDQGTVIACDRTPSRLK 300

Query: 278 KLRCNLDRLHLYAEDIIEMD-AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           K++ N  RL L +   I  D           D VLVD PCS  GT+ RHPD+ W +  + 
Sbjct: 301 KVQQNAQRLQLNSIQTILGDSRHFTQFIDQGDRVLVDVPCSGLGTLHRHPDIRWRQTPEQ 360

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           I + +  Q+++L Q   +VKP G +V++ C+L+  +++++++  L          P    
Sbjct: 361 IQELSRLQQEILTQAAQWVKPQGTLVYATCTLNPTENQQIIETFLTHHSHWTIEPPSVDW 420

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +        ++   WI+I P             DGFF V L++
Sbjct: 421 LFYP-----FVTSSKWIQILPH--------EHHTDGFFMVKLKK 451


>gi|86747213|ref|YP_483709.1| RNA methyltransferase [Rhodopseudomonas palustris HaA2]
 gi|86570241|gb|ABD04798.1| RNA methyltransferase [Rhodopseudomonas palustris HaA2]
          Length = 450

 Score =  289 bits (740), Expect = 5e-76,   Method: Composition-based stats.
 Identities = 171/440 (38%), Positives = 251/440 (57%), Gaps = 6/440 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V++KR  L   L+        + L  RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLPDRDRALMRRLVATILRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LEHLLARMLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE   L+  +AG +  +PEW   R    YG +   AI+ A      +D+T
Sbjct: 133 LVNAVLRRCAREGHPLIDAVAGQALDVPEWLMARWRAHYGDDAAKAIALAISHEPSLDIT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D + WA +L   +LPTG +R   L  S+  LPGF +G WWVQDA+A++P +LFG L 
Sbjct: 193 VKSDPDHWAGRLYGELLPTGTVR-TLLQGSVKMLPGFDDGQWWVQDAAAALPARLFGDLA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFD 300
             SV DLCAAPGGKTAQL  +GA+V+A+D S  R+ +LR NL RL L A   + +   + 
Sbjct: 252 GKSVADLCAAPGGKTAQLAQAGARVSAIDRSPARVARLRENLARLGLEAETAVADATEWR 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FD VLVDAPC+STGTIRRHPDV W +   DI   +  Q +LL + ++ +KPGG 
Sbjct: 312 SDAPGSFDGVLVDAPCASTGTIRRHPDVAWLKQESDIGALSAVQSRLLHKAVALLKPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+VV  +L + P    L        +   +A  ++ EG +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQVVGALLDAEPGMRRL---PVEPAEVAGLAEIVTAEGDVRTLPSHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D   +G DGF+A  L +
Sbjct: 429 PHADPRLAGFDGFYAARLTK 448


>gi|15615070|ref|NP_243373.1| hypothetical protein BH2507 [Bacillus halodurans C-125]
 gi|10175127|dbj|BAB06226.1| BH2507 [Bacillus halodurans C-125]
          Length = 450

 Score =  289 bits (738), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 113/462 (24%), Positives = 202/462 (43%), Gaps = 36/462 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +  + R V+   L  + + +     LL+ +        L  RD  L+  +V  T++  
Sbjct: 1   MAAK-SVREVALETLVQIEKSQAYSNLLLNQKIK---QANLEPRDIGLLTELVYGTVQRQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  +   +     + +  ++ LLR+SV Q++YLD V  +A++  AV  AK+ + ++ 
Sbjct: 57  KTLDYYIASFVAKGKRKLEDWVRILLRLSVYQLVYLDKVPPHAIIHEAVNIAKK-RGHKG 115

Query: 120 FAKLVNSILRRVSREKIELL-------QRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            + LVN +LR + R+ +          +R+A     PEW  +R  + YG+E  ++I +  
Sbjct: 116 ISGLVNGVLRSMQRQGMPPFAAIEDKVKRLAVEYSYPEWLVKRWIDQYGEEETVSICEEM 175

Query: 173 ISPLYIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P  +   V     T    L         A         +     +I S   F +G   
Sbjct: 176 LLPPKVTARVNVRKRTVEEALERLEHEGVQATNGVLSDDAIVVDKGTITSTRLFQDGELT 235

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +         +LD CAAPGGK+  +   +     + +LD+ + +++ +  
Sbjct: 236 IQDESSMLVARAVAPRPGERILDACAAPGGKSTHMAERMDGEGTIVSLDMHRHKVKLIEE 295

Query: 282 NLDRLHLYAEDIIEMDAFDYCP---KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G IRR PD+ WT+   D+ 
Sbjct: 296 QAKRLGLDNIKAQTLDARKAREVFADEPFDRILVDAPCSGLGVIRRKPDIKWTKREADMK 355

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
                Q  +L      VKPGG++++S C++D+ ++E+V+ + + +      +        
Sbjct: 356 AIRNVQLDILSSVAKLVKPGGLLIYSTCTIDQLENEQVIAEFMEAH-GEFSIDDTVLDRL 414

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +   A     EG + I P           G DGFF   L++
Sbjct: 415 PAAVQATCNIREGMVTILPHHF--------GTDGFFITCLKK 448


>gi|75674355|ref|YP_316776.1| tRNA and rRNA cytosine-C5-methylase [Nitrobacter winogradskyi
           Nb-255]
 gi|74419225|gb|ABA03424.1| tRNA and rRNA cytosine-C5-methylase [Nitrobacter winogradskyi
           Nb-255]
          Length = 450

 Score =  289 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 173/442 (39%), Positives = 254/442 (57%), Gaps = 7/442 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
             G+ AR +++ +L  V+ KR +L   L+        + L+ RD+ L+R +V   LR L 
Sbjct: 12  APGLAARRIAADILDGVLHKRRTLDEQLEGPTAHPGLKALADRDRALMRRLVATILRRLG 71

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +  +L  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A
Sbjct: 72  TLGHLLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYA 131

Query: 122 KLVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR +RE   L++ +   S   P W   R   +YG+    AI+ A      +DL
Sbjct: 132 GLVNAVLRRCAREGQSLIEEVRSESLDTPSWLMARWSGYYGEGTAKAIAAAISHEPALDL 191

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK +   WA +L+   LPTG +R   L  S+  LPGF+EG WWVQDA+A++P +LFG L
Sbjct: 192 TVKANAAHWATRLHGETLPTGTVR-TSLHGSVTMLPGFSEGQWWVQDAAAALPARLFGDL 250

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
               V+DLCAAPGGKTAQL+ +GA+VTA+D S  R+ +LR NL RL L A  ++      
Sbjct: 251 RGRRVIDLCAAPGGKTAQLVQAGAEVTAIDRSPNRVARLRENLGRLSLDARSLVADAIEW 310

Query: 301 YCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
                   FD VLVDAPCS+TGTIRRHPDV W +   DI      Q++LL + I+ ++PG
Sbjct: 311 QDDVAGDGFDGVLVDAPCSATGTIRRHPDVAWLKQDSDIAALTALQQRLLNKAITLLRPG 370

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G +V+  CSL+ ++ E+VV  +L  +   +  VP+++   +   +A  ++PEG +R  P 
Sbjct: 371 GTLVYCTCSLEPEEGEQVVAALLA-TDTGIRRVPVSAD--EVAGLADIVTPEGDLRTLPC 427

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
            L   D    G+DGF+A  L R
Sbjct: 428 HLAHDDPTLGGLDGFYAARLTR 449


>gi|119487592|ref|ZP_01621202.1| Fmu, rRNA SAM-dependent methyltransferase [Lyngbya sp. PCC 8106]
 gi|119455761|gb|EAW36897.1| Fmu, rRNA SAM-dependent methyltransferase [Lyngbya sp. PCC 8106]
          Length = 450

 Score =  289 bits (738), Expect = 8e-76,   Method: Composition-based stats.
 Identities = 116/465 (24%), Positives = 198/465 (42%), Gaps = 48/465 (10%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++  +L  V R+ +     LD          LS  ++ L   +V   +R    +DA
Sbjct: 4   NPRQLAFIILREVERRGVYADIALDENLRK---ADLSAVNRRLTTELVYGCVRRRRSLDA 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D        ++   L+ +L +   Q+ YL  +   A V+ +VE AK +      +  V
Sbjct: 61  LIDQFAQKKSHQQPPDLRIILHLGFYQLYYLSQIPASAAVNTSVELAKTN-GLSGLSGFV 119

Query: 125 NSILRRVSREKIELLQRIA--------------GISIIPEWFKERLENFYGKERVLAISD 170
           N ILR   R++ +  Q                  +   P+W  E   N  G E    +  
Sbjct: 120 NGILREYLRQQEKQTQNRPILRLEDENLIQTLGNLYSFPDWILEYWLNQLGLEETEKLCQ 179

Query: 171 ACISPLYIDLTVK---FDIETWAHKLN-------AVMLPTGGIRLKELPESIVSLPGFAE 220
                  IDL +       +T   +L         +   +  +RL      I +LPG+ +
Sbjct: 180 WFNQSPTIDLRINALKTSRDTVETELKLAGINVTPIPHLSQALRLSGSIGEIQNLPGYRQ 239

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLE 277
           G W +QD+SA     +        ++D CAAPGGKT  +   +     + A D +K RL+
Sbjct: 240 GWWSIQDSSAQWVSHILDPQPGEIIIDACAAPGGKTTHIAELMQDTGTILAFDRAKSRLK 299

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPKKLF-DAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           K++ N +RL L +      D  +        D VL+DAPCS  GT+ R  D  W     +
Sbjct: 300 KVQQNQERLQLKSITTQLADIRELSEYNSCADRVLLDAPCSGLGTLHRRADARWRHTQQN 359

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           + + +  Q +LL +  ++VKPGG +V++ C++   ++E ++Q  L  +      +P    
Sbjct: 360 VQELSELQTELLEKTATWVKPGGYLVYATCTIHPLENETIIQSFLSHNLNWEIDLP---- 415

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               I +   L+ EG++++ P            MDGFF V L+R+
Sbjct: 416 ---EIPLQDVLTSEGYLKVWPH--------RQNMDGFFIVKLKRI 449


>gi|169831743|ref|YP_001717725.1| sun protein [Candidatus Desulforudis audaxviator MP104C]
 gi|169638587|gb|ACA60093.1| sun protein [Candidatus Desulforudis audaxviator MP104C]
          Length = 452

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 119/460 (25%), Positives = 192/460 (41%), Gaps = 38/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           ++AR ++ H+L  V          L+    +     L   D+     +   TLR L  +D
Sbjct: 4   VSAREIALHVLKAVEADGAYANLALNRALEEFRPSKL---DRAFATELAYGTLRTLNTLD 60

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            ++   L   L  +    + +LR+   Q+ Y+D V   A    AVE AK+       A+ 
Sbjct: 61  WIVSRYLQQPLGDQTVWSRNILRLGAYQLFYMDKVPAGAACFEAVELAKKY-GTPGTARF 119

Query: 124 VNSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN +LR V+R K EL            I+     P W  +R     G E  +A+  A  +
Sbjct: 120 VNGVLRNVARHKDELQFPDPETDLVTHISLKYFHPTWLVKRWLTELGPEETIALCQANNT 179

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWV 225
                + V     D ++ A +L    L     R            S+ +LP F +G++ +
Sbjct: 180 IPPNTIRVNTLRVDRDSLAVRLEQEGLTVRKTRFAPEGLEIGGFVSMRALPSFQQGLFQI 239

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD S+ +          + +LD C+APGGKT  L   + +   + ALD+ + +L+ +  N
Sbjct: 240 QDESSMLVAHAVNPARGVRILDACSAPGGKTTHLAQLMENEGIIKALDIHQHKLKLVSDN 299

Query: 283 LDRLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
             RL +   +   +DA D     +   D VLVDAPCS  G +RR PD  W ++   I   
Sbjct: 300 CRRLGIDNVETELLDARDLPGEFEGWADFVLVDAPCSGLGVLRRRPDARWRKEPGQITGL 359

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q  +L      V+ GG++V+S C++  +++   VQ  L   P  +     N   +  
Sbjct: 360 VRLQEAILAGAAQCVRAGGVLVYSTCTITYEENLGQVQSFLAHHPDFLLE---NLRPFLP 416

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +       G++ I P           GMDGFF   +RR
Sbjct: 417 AGLGEEQMARGYLEIFPH-------THEGMDGFFIARMRR 449


>gi|91975197|ref|YP_567856.1| Fmu (Sun) [Rhodopseudomonas palustris BisB5]
 gi|91681653|gb|ABE37955.1| Fmu (Sun) [Rhodopseudomonas palustris BisB5]
          Length = 450

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 172/441 (39%), Positives = 258/441 (58%), Gaps = 6/441 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
             G+ AR +++ +L  V++KR +L   L+        + L  RD+ L+R +V   LR L 
Sbjct: 12  TPGLAARRIAADILDGVLQKRRTLDEQLEGPAAHPGLKTLPDRDRALMRRLVATILRRLG 71

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            ++ +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A
Sbjct: 72  TLEHLLARMLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYA 131

Query: 122 KLVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
            LVN++LRR +RE   L++ +AG +  +PEW   R    YG++   AI+ A      +D+
Sbjct: 132 GLVNAVLRRCAREGQPLIEEVAGQALDVPEWLMARWRAHYGEDAAKAIAVAISHEPSLDI 191

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVK D + WA +L   +LPTG +R   L  S+  LPGF +G WWVQDA+A++P +LFG L
Sbjct: 192 TVKSDPQHWAGRLYGELLPTGTVR-TLLQGSVKMLPGFEDGEWWVQDAAAALPARLFGDL 250

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAF 299
              SV DLCAAPGGKTAQL  +GA+V+A+D S  R+ +LR NL RL L A   + +   +
Sbjct: 251 AGKSVADLCAAPGGKTAQLAQAGARVSAIDRSPARVARLRENLARLSLEAETGVADATEW 310

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FD VLVDAPC+STGTIRRHPDV W +   DI   +  Q +LL +  + +KPGG
Sbjct: 311 RSDAPGSFDGVLVDAPCASTGTIRRHPDVAWLKQESDIGALSAVQSRLLEKAAALLKPGG 370

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E+ + K+L + P  +  VP+  A  +   +A  ++P+G +R  P  
Sbjct: 371 TLVYCTCSLEPEEGEQAIAKLLAAEP-QMRRVPVEPA--EVAGLADIVTPQGDLRTLPSH 427

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D   +G DGF+A  L +
Sbjct: 428 LPHADPRLAGFDGFYAARLTK 448


>gi|67924848|ref|ZP_00518244.1| Fmu, rRNA SAM-dependent methyltransferase [Crocosphaera watsonii WH
           8501]
 gi|67853307|gb|EAM48670.1| Fmu, rRNA SAM-dependent methyltransferase [Crocosphaera watsonii WH
           8501]
          Length = 452

 Score =  288 bits (737), Expect = 1e-75,   Method: Composition-based stats.
 Identities = 122/468 (26%), Positives = 215/468 (45%), Gaps = 45/468 (9%)

Query: 1   MKSGM---NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTL 57
           M++ +   NAR ++  +L  + RK       L+     S    LS  D+ L   +V   +
Sbjct: 1   MRNKLSTSNARQLALKILLKIDRKNSYTDVALNRALNQS---NLSSSDRSLCTELVYGII 57

Query: 58  RFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKE 116
           R    +D+++D +      ++  +L+++L + + Q+ YLD +   A V+ +V+ AK +K 
Sbjct: 58  RHQRTLDSLIDQLGKKKAQQQPPNLRRILHIGLYQLRYLDHIPPSAAVNTSVDLAKDNKL 117

Query: 117 NRHFAKLVNSILRRVSREKIELLQRI----------AGISIIPEWFKERLENFYGKERVL 166
            +  + +VN ILR+  R        +          A     P+W  E     +G+E   
Sbjct: 118 -QRLSGVVNGILRQYIRSIQGNHDPLILPNDTLKKLAIQYSFPDWIIETWLQKWGEETTE 176

Query: 167 AISDACISPLYIDLTVKF---DIETWAHKLNAVM-------LPTGGIRLKELPESIVSLP 216
            +         ID+ V     ++ET   +L +              +RLK    +I +LP
Sbjct: 177 KMCHWFNQSPNIDIRVNPLKTNLETLQTQLTSAGVNVTPLGRFPCALRLKGKIGTIPTLP 236

Query: 217 GFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSK 273
           GF++G W VQD SA +           +++D CAAPGGKT  +   +     + A D + 
Sbjct: 237 GFSQGHWTVQDTSAQLVSYFLDPQPGETIIDACAAPGGKTTHIAELMGDQGTIFACDRTP 296

Query: 274 RRLEKLRCNLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTR 332
            RL+K++ N  RL L   + +  D+          D VLVD PCS  GT+ RHPD+ W +
Sbjct: 297 SRLKKVQENAQRLELNCIETVVGDSRYLQQFINKGDRVLVDVPCSGLGTLHRHPDIRWRQ 356

Query: 333 DTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVP 392
             ++I +    Q ++L Q   +VKP G +V+S C+L+  +++E++Q  L +     ++ P
Sbjct: 357 TPENIRELTSLQLEILNQAAQWVKPQGTLVYSTCTLNPPENQEIIQTFLSTHSHW-KIEP 415

Query: 393 LNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            N  +      +  ++   WI++ P   +         DGFF V L++
Sbjct: 416 PNPHWA----FSPFVTSSQWIQMLPHKQDS--------DGFFMVKLKK 451


>gi|49476251|ref|YP_034292.1| SUN protein (Fmu protein) [Bartonella henselae str. Houston-1]
 gi|49239059|emb|CAF28362.1| SUN protein (FMU protein) [Bartonella henselae str. Houston-1]
          Length = 447

 Score =  287 bits (735), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 200/445 (44%), Positives = 275/445 (61%), Gaps = 9/445 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R VS  LL  V+ K+ SL+ L D EYG   +  LSQRD++L RAI+   LR   +
Sbjct: 7   PGLAVRQVSVRLLGVVLDKKTSLSGLTDNEYGHPQYLGLSQRDRLLCRAILAAALRHRGQ 66

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L   LP +  SLQ LL +S AQILYLD+ D+A +DLAV  AK D     F+ 
Sbjct: 67  ITDALRRFLKRPLPSQALSLQHLLHISAAQILYLDIPDHAAIDLAVRVAKLDPRMCRFSG 126

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
            VN++LR V+RE + L Q+   I  IP WF + L + YGKE+   I +   +P  +DLTV
Sbjct: 127 GVNALLRNVAREAVFLRQKAPHIEGIPVWFGQLLVSTYGKEKTEQILEIQSAPPPLDLTV 186

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  V+LP G +RL  L  S+  LPG+ EG WW+QD +AS+P  L G ++ 
Sbjct: 187 KSDSRGWAERLGGVVLPNGSVRLSRLEGSVSELPGYMEGAWWIQDFAASLPACLLGNIHG 246

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL + GA VTA+++S  RL++L+ N++RLH       E D  ++ 
Sbjct: 247 KQVADLCASPGGKTAQLALQGADVTAIELSANRLKRLKENMERLHFS-VRCCEGDVKNFH 305

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           PK+LFDAVL+DAPCSSTGTIRRHPD+LWT+  +D++K A  Q  LL+  I+ +K GG +V
Sbjct: 306 PKQLFDAVLLDAPCSSTGTIRRHPDILWTKSMNDVIKLAALQYDLLVAAIALLKKGGRIV 365

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           FSNCSL K++ E+++ ++L      + L P+ +   +   MA  LS EG +R TP     
Sbjct: 366 FSNCSLAKEEGEDLITRILSER-GDIVLEPILAE--EMGVMAHLLSVEGILRTTPADFCH 422

Query: 423 IDGVSS-----GMDGFFAVALRRLI 442
            +  +      GMDGFFA  LR++ 
Sbjct: 423 ENFDAEKNIFLGMDGFFAARLRKVA 447


>gi|125973090|ref|YP_001037000.1| sun protein [Clostridium thermocellum ATCC 27405]
 gi|256004593|ref|ZP_05429571.1| sun protein [Clostridium thermocellum DSM 2360]
 gi|281417285|ref|ZP_06248305.1| sun protein [Clostridium thermocellum JW20]
 gi|125713315|gb|ABN51807.1| sun protein [Clostridium thermocellum ATCC 27405]
 gi|255991465|gb|EEU01569.1| sun protein [Clostridium thermocellum DSM 2360]
 gi|281408687|gb|EFB38945.1| sun protein [Clostridium thermocellum JW20]
 gi|316940689|gb|ADU74723.1| sun protein [Clostridium thermocellum DSM 1313]
          Length = 455

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 96/468 (20%), Positives = 204/468 (43%), Gaps = 40/468 (8%)

Query: 1   MKSGM-NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M++ +   R  +  +L  +  K       L+       F  +   D+  +  IV  TL++
Sbjct: 3   MRTKVDKVRETALKILYDINEKGAYSNISLNKYLNGQEFESI---DRAFITDIVYGTLKW 59

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENR 118
              ID +++      + +    +  +LR+ + Q++Y D +  +A  + +V+ A +   + 
Sbjct: 60  QYTIDYLIEKFSSVKIKKISPWIFNILRMGIYQLIYTDKIPFFAACNESVKLAAKY-GHA 118

Query: 119 HFAKLVNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS 169
             +K VN++LR                +    ++     P W  +   + +G+E    + 
Sbjct: 119 ASSKYVNAVLRNIARNKENLPYPDRNNDTAHYLSVKYSHPVWMVKDWLDCFGEEFTEGLL 178

Query: 170 DACISPLYIDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAE 220
            A        + V     +    ++                   +   P ++  +  FA+
Sbjct: 179 KANNEVAPFTVRVNDLKISKKELVDILTKDGFEVENGKYLDEALIIRNPSAVQKMDAFAK 238

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLE 277
           G + VQD S+ +  ++       ++LD+C+APGGK+  +   + +   V + D+ + +++
Sbjct: 239 GYFQVQDESSMLVAKVLDPKPGETILDVCSAPGGKSTHIAQIMKNRGTVISRDIHEHKIK 298

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            +    +RL L        DA     K  +  D VLVDAPC+  G IRR PD+ W+++++
Sbjct: 299 LIEQAKERLGLEIIKTEVFDAAVLDGKLIEKIDRVLVDAPCTGFGIIRRKPDIKWSKNSE 358

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D  +    Q K+L     +VK GG++V+S C+L+ +++E+ V++ +  +     L  +  
Sbjct: 359 DKAEIVSLQHKILSTASKYVKDGGVLVYSTCTLEPEENEKAVERFIEENKDFY-LEDITE 417

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
               ++    A   +G+I++ P++         G+DGFF   +R+  +
Sbjct: 418 FLPDALRKESA--GKGYIQLYPNI--------DGIDGFFIARMRKRSK 455


>gi|92115829|ref|YP_575558.1| Fmu (Sun) [Nitrobacter hamburgensis X14]
 gi|91798723|gb|ABE61098.1| Fmu (Sun) [Nitrobacter hamburgensis X14]
          Length = 450

 Score =  287 bits (734), Expect = 2e-75,   Method: Composition-based stats.
 Identities = 172/441 (39%), Positives = 245/441 (55%), Gaps = 7/441 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V+ K  +L   L+        + L+ RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLHKHRTLDEQLEGAAAHPGLKALADRDRALMRRLVATILRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  VL  +L   +P      Q  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LGHVLSRLLDRGIPTDAPRAQSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE    + +  +    IP W   R    YG+    AI+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGQPLIDEVRSEALDIPPWLMTRWIANYGENTAKAIATAISHEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK     WA +L+  +LPTG +R   L   +  LPGF+EG WWVQDA+A++P +LFG L 
Sbjct: 193 VKAGAAQWATRLHGEVLPTGTVR-TALQGPVTMLPGFSEGRWWVQDAAAALPARLFGDLQ 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDR--LHLYAEDIIEMDAF 299
              V DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL R  L   A     ++  
Sbjct: 252 GRRVADLCAAPGGKTAQLAQAGAEVTAIDRSPNRVARLRDNLGRLSLGARALVADAVEWQ 311

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D      FD VLVDAPCSSTGTIRRHPDV W +   DI      Q++LL +  + +KPGG
Sbjct: 312 DDAAGSGFDGVLVDAPCSSTGTIRRHPDVAWLKQDSDIAALTALQKRLLQKAFALLKPGG 371

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E +V  +L S    V  VP+ +A    ++    ++P G +R  P  
Sbjct: 372 TLVYCTCSLEPEEGEHLVGALLAS-EAGVRRVPIGAAEVAGLE--DIVTPAGDLRTLPCH 428

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D   SG+DGF+A  L +
Sbjct: 429 LPHDDPRLSGLDGFYAARLIK 449


>gi|218778410|ref|YP_002429728.1| sun protein [Desulfatibacillum alkenivorans AK-01]
 gi|218759794|gb|ACL02260.1| sun protein [Desulfatibacillum alkenivorans AK-01]
          Length = 455

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 125/470 (26%), Positives = 206/470 (43%), Gaps = 43/470 (9%)

Query: 1   MKS---GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTL 57
           MK       +R+ ++ +L  +      L  +LD          L+++D+ LV A+V   L
Sbjct: 1   MKPPAGKDKSRITAARILDRLESGDQVLDVVLDRALDKEP--GLTRKDRALVMALVYGVL 58

Query: 58  RFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKE 116
           R   RID ++     + L + +  +  +LR+ V Q+L+LD V     VD +VE AK+   
Sbjct: 59  RNRGRIDWIISSFSKTKLKKIQPEILNILRMGVFQLLFLDRVPPALAVDSSVEMAKK-AA 117

Query: 117 NRHFAKLVNSILRRV---------SREKIELLQRIAGISIIPEWFKERLENFYGKERVLA 167
               +K VN +LR V              + L+ I      PEW  +R    +G E  L 
Sbjct: 118 PVFVSKFVNGLLRNVERKGRGLQLPDFAKDPLKAICVAESYPEWMVKRWIKRFGAEETLE 177

Query: 168 ISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGGIRLKELP----------ESIVSLPG 217
           +  A      I + V     T     + +      + L + P            +  LPG
Sbjct: 178 LCKAGNRIAPITIRVNSLAATRDEAADEIRDQVKNLELHDWPPMALSFSAPLVPVFELPG 237

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKR 274
           F+EG + VQDA++ +            VLD CA  G KT+ +   + +  ++ A D+   
Sbjct: 238 FSEGKFSVQDAASQMTALCLDPRPGEKVLDACAGLGSKTSHIAQLMENTGEILAADLEPG 297

Query: 275 RLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTR 332
           +L+KL   + RL +       +D       +   FD VLVDAPC+  G IRR+PD  W++
Sbjct: 298 KLKKLEEEMARLKVSIVKTHALDFTRELSLEPQGFDKVLVDAPCTGLGVIRRNPDSKWSK 357

Query: 333 DTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVP 392
             + I K A  Q  +L +    V+PGG++++S CS++ ++++ V++  LR++        
Sbjct: 358 TLNSIHKHAKLQGMILSRAAELVRPGGLILYSVCSMEPEETDGVIKAFLRNNEDFT---- 413

Query: 393 LNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           L  +          L  +G +R  P           GMDGFFA  +RR  
Sbjct: 414 LEPSPLPKDGDQTMLDEQGCMRTFPH--------RQGMDGFFAARMRRRA 455


>gi|284928897|ref|YP_003421419.1| ribosomal RNA small subunit methyltransferase RsmB [cyanobacterium
           UCYN-A]
 gi|284809356|gb|ADB95061.1| ribosomal RNA small subunit methyltransferase RsmB [cyanobacterium
           UCYN-A]
          Length = 453

 Score =  287 bits (733), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 126/465 (27%), Positives = 216/465 (46%), Gaps = 43/465 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   NAR +   +L  + +    +   LD  +  +    LS++D+ L   +V   +R  
Sbjct: 1   MKVS-NARQLVLKILREIDKNNSFINISLDSAFKHN---ELSRQDRGLCTELVYGIIRCQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D+++D +      ++   L+++L + + Q+LYLD V   A V+ +V+ AK +  N  
Sbjct: 57  RTLDSLIDQLGNKKSQKQSPVLRRILHIGLYQLLYLDHVPLSAAVNTSVDLAKNNNLN-V 115

Query: 120 FAKLVNSILRRVSREKIELLQR----------IAGISIIPEWFKERLENFYGKERVLAIS 169
            +K+VN+ILR   R K +   +           A     P W  +     +G +  + + 
Sbjct: 116 LSKVVNAILREYIRVKKKENCKLILSKDFVNTTAIKYSFPNWIVKNWYQQWGGDTSVKLC 175

Query: 170 DACISPLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLPGFA 219
                   ID+ V    +T              +  +      +RLK     I +LPGF 
Sbjct: 176 YWFNQSPTIDIRVNVLGKTTQEIKNELIMANVNVEYLPHLPCSLRLKGQTGDIKNLPGFI 235

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRL 276
           +G W VQD SA +   L       +V+D CAAPGGKT  +   +     + A D    RL
Sbjct: 236 KGDWTVQDISAQLVSYLLDPKIGETVIDACAAPGGKTTHIAELMRDKGLILACDRISSRL 295

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            K++ N++RL L +  +++ D+          D VLVDAPCS  GT+ R+PD+ W +  +
Sbjct: 296 TKIQQNIERLKLRSIKLVKGDSRYLQQFNNFADRVLVDAPCSGLGTLHRNPDIRWRQTPE 355

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            I + +  Q+++L +   +VKP G++V+S C+L+  ++E +V   L+++P      PL S
Sbjct: 356 KIKQLSIIQQEILDKASKWVKPNGVLVYSTCTLNVSENETIVCNFLKNNPEWNIEKPLFS 415

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +        ++  GW++  P            MDGFF V LR+
Sbjct: 416 KLFSP-----FITSSGWLQTLPH--------EHNMDGFFMVKLRK 447


>gi|110635746|ref|YP_675954.1| Fmu (Sun) [Mesorhizobium sp. BNC1]
 gi|110286730|gb|ABG64789.1| Fmu (Sun) [Chelativorans sp. BNC1]
          Length = 460

 Score =  286 bits (732), Expect = 4e-75,   Method: Composition-based stats.
 Identities = 201/439 (45%), Positives = 266/439 (60%), Gaps = 5/439 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G++AR  ++ LL+ V+  R  L  L D E+G   +  L QRD+ LVRAI+   LR   
Sbjct: 26  KPGLDARRTAAKLLAAVIDARTPLDALTDNEHGHPQYLSLEQRDRALVRAILISALRHRC 85

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+ ++   L   LP   +SL  +L V  AQIL+LDV D A VDLAV QAK D     F+
Sbjct: 86  TIEKLVGRRLDRPLPPNAHSLSHILHVGAAQILFLDVPDSAAVDLAVTQAKADPRAARFS 145

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            LVN++LR ++R K EL + +      P WF ERLE  YG ++  AI  A       D T
Sbjct: 146 GLVNAVLRNLARRKHELPKALENTRDAPAWFAERLEAVYGHDQTDAILKAHRLEAPTDFT 205

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           V+ D   WA +L   +LP G +RL  LP  I  LPGFAEG WWVQDA+AS+P +L G + 
Sbjct: 206 VRSDPALWAERLGGRVLPNGSVRLDRLPSPIPELPGFAEGAWWVQDAAASLPARLLGDVE 265

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
            L V DLCAAPGGKTA L + GA V+A+D+S  RL++L+ NLDRL L AE + + D   +
Sbjct: 266 GLFVADLCAAPGGKTAALALEGAWVSAVDISASRLKRLKANLDRLGLSAEIV-QADVLSW 324

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P++ FDAVL+DAPCSSTGT+RRHPDV WT+  +DI K A  QR+LL + ++ + P GIV
Sbjct: 325 EPERKFDAVLLDAPCSSTGTVRRHPDVPWTKTPEDIAKLADLQRRLLERALTLIHPSGIV 384

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           VFSNCSLD  + EE+V+ VL      + L P+        +    ++ EG++R TP    
Sbjct: 385 VFSNCSLDPSEGEELVRDVLGK-QAGIALDPILPEELPGAE--HFVTAEGFLRTTPAHFG 441

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G+DGFFA  LRR
Sbjct: 442 TES-QLDGIDGFFAARLRR 459


>gi|308069674|ref|YP_003871279.1| ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Paenibacillus
           polymyxa E681]
 gi|305858953|gb|ADM70741.1| Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Paenibacillus
           polymyxa E681]
          Length = 471

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 118/459 (25%), Positives = 204/459 (44%), Gaps = 39/459 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR V+  +L  V ++       L+          LS  D  L   +V  T+     +D  
Sbjct: 27  AREVALDVLIGVEQEGAYSNLELNRRLQ---QAGLSASDAGLATELVYGTVARRNTLDYF 83

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L+  +     + +  ++ LLR+SV Q++YLD V D+AVV  AV  AKR + ++  + +VN
Sbjct: 84  LNKFVQKGTAKLQAWVRSLLRMSVYQLVYLDRVPDHAVVSEAVTIAKR-RGHQGISGMVN 142

Query: 126 SILRRVSREKIE--------LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +LR + RE  +          +RI+     P+W  +R    YG +   AI  A   P  
Sbjct: 143 GVLRSMLREPDKLRIPDDLSPEERISLEHSHPQWLVKRWIKQYGADTAEAICQANNEPPA 202

Query: 178 IDLTV---KFDIETWAHKLNAVMLP------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V       +    ++N+  L       +    +     ++     + +G+  VQD 
Sbjct: 203 VSVRVNTTMTSRDQLLDEMNSKGLDAVPSAVSPYGIVVRSGGNMALTSWYTDGLLSVQDE 262

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +       + VLD CAAPGGKTA +   +    ++ A D+   + + +R   +R
Sbjct: 263 SSMLVAEAVAPEPGMLVLDCCAAPGGKTAHMAELMKDHGRIVANDLHAHKHQLIREQANR 322

Query: 286 LHLYAEDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L A + +  DA +   +     FD +L+DAPCS  G IRR PD+ W++   D+     
Sbjct: 323 LGLDAVETVTGDALELKERYAPASFDRILLDAPCSGFGVIRRKPDLRWSKTAQDVRDITQ 382

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q +LL      +KPGGI+V+S C+++  ++E  + + L   P   E        +  ++
Sbjct: 383 LQHELLDSVAGLLKPGGILVYSTCTIEPDENEGQLTQFLSEHP---EYEWAEGHSFPDVN 439

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                   G +++ P             DGF+   LRR+
Sbjct: 440 REKDSIQGGSVQLLPQHF--------HSDGFYIARLRRV 470


>gi|310642738|ref|YP_003947496.1| ribosomal RNA small subunit methyltransferase b [Paenibacillus
           polymyxa SC2]
 gi|309247688|gb|ADO57255.1| Ribosomal RNA small subunit methyltransferase B [Paenibacillus
           polymyxa SC2]
          Length = 471

 Score =  286 bits (731), Expect = 5e-75,   Method: Composition-based stats.
 Identities = 118/459 (25%), Positives = 205/459 (44%), Gaps = 39/459 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR V+  +L+ V ++       L+          LS  D  L   +V  T+     +D  
Sbjct: 27  AREVALDVLTGVEQEGAYSNFELNRRLQ---QAGLSASDVGLTTELVYGTVARRNTLDYF 83

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L+  +     + +  ++ LLR+SV Q++YLD V D+AVV  AV  AKR + ++  + +VN
Sbjct: 84  LNKFVQKGTAKLQPWVRSLLRMSVYQLVYLDRVPDHAVVSEAVTIAKR-RGHQGISGMVN 142

Query: 126 SILRRVSREKIELLQRI--------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +LR + RE  +L            +     P+W  +R    YG +   AI  A   P  
Sbjct: 143 GVLRSMLREPDKLRIPDGLSAEERISLEHSHPQWLVKRWIKQYGVDTAEAICKANNEPPA 202

Query: 178 IDLTV---KFDIETWAHKLNAVMLP------TGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V       +    ++ A  +       +    +     ++     + +G+  VQD 
Sbjct: 203 VSVRVNTTMTSRDQLLDEMVAKGIDAVPSPVSPYGIVVRSGGNMALTSWYTDGLLSVQDE 262

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +       ++VLD CAAPGGKTA +   +    ++ A D+   + + +R    R
Sbjct: 263 SSMLVAEAVAPEPGMTVLDCCAAPGGKTAHMAELMKDRGRIVANDLHAHKHQLIREQASR 322

Query: 286 LHLYAEDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L A + +  DA D   +     FD +L+DAPCS  G IRR PD+ W++  +D+     
Sbjct: 323 LGLDAVETVTGDALDLKERYAPASFDRILLDAPCSGFGVIRRKPDLRWSKTAEDVRDITQ 382

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q +LL      +KPGGI+V+S C+++  ++E  + + L   P   E        +  ++
Sbjct: 383 LQHELLDSVAGLLKPGGILVYSTCTIEPDENEGQLARFLSEHP---EYELAKDHSFPDVN 439

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             M    +G +++ P             DGF+   LRR+
Sbjct: 440 HEMDGIQKGSVQLLPQHF--------HSDGFYIARLRRV 470


>gi|222150167|ref|YP_002551124.1| Sun protein [Agrobacterium vitis S4]
 gi|221737149|gb|ACM38112.1| Sun protein [Agrobacterium vitis S4]
          Length = 493

 Score =  286 bits (730), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 215/448 (47%), Positives = 295/448 (65%), Gaps = 11/448 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR+ +S LL+ V+ ++ SL  ++D ++G+ A+  LS+ D+ LVRAI+N +LRFLP
Sbjct: 49  KPGLEARMAASRLLAAVIDRKTSLDGMMDGDHGNPAYAALSEADRGLVRAILNTSLRFLP 108

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
           RI+A+L  +L + LP    +L   L V+ AQ++YLDV D++ VDLAVEQA RD  +R FA
Sbjct: 109 RIEAMLARLLDAPLPDGARALYHSLIVAAAQMVYLDVPDHSAVDLAVEQANRDPRSRRFA 168

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           KLVN++LRR+ REK  LL  +  +  +P+WF ERL   YG+E    I+ A ++P  IDLT
Sbjct: 169 KLVNAVLRRLGREKQALLADVEDVICMPDWFFERLIAVYGEEEARRIAQAQLTPAAIDLT 228

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KLN V+LPTG IRL     ++ +LPGF EG WWVQDA+A++PV++FG+L 
Sbjct: 229 VKADPAVWAEKLNGVVLPTGSIRLASFAGAVSALPGFEEGAWWVQDAAAALPVRMFGSLE 288

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIE--MDAF 299
               +DLCAAPGGKTAQL  +GA VTA++ S  RL++L  NL RL   A+ + +  M+  
Sbjct: 289 GKRAVDLCAAPGGKTAQLAAAGAVVTAVEQSANRLKRLNGNLQRLGFSAQLVHQDLMEFN 348

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FDAVL+DAPCSSTGT RRHPDV +T+   DIVK A  Q +LL   ++ + PGG
Sbjct: 349 LGEDHPGFDAVLLDAPCSSTGTTRRHPDVFYTKGPQDIVKLAGVQERLLRHAVTLLAPGG 408

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRIT--- 416
            +VFSNCSLD Q+ E+VV +VL   P  +E V +  A W  ++ A  ++P G  R T   
Sbjct: 409 SIVFSNCSLDPQEGEDVVARVLADHP-ELERVAMQVADWPGLEDA--ITPLGEFRTTPAM 465

Query: 417 ---PDMLEKIDGVSSGMDGFFAVALRRL 441
              P ML   D  + G+DGF+A  LRR+
Sbjct: 466 LPGPAMLPGGDSHAGGLDGFYACRLRRV 493


>gi|220928955|ref|YP_002505864.1| sun protein [Clostridium cellulolyticum H10]
 gi|219999283|gb|ACL75884.1| sun protein [Clostridium cellulolyticum H10]
          Length = 449

 Score =  286 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 103/457 (22%), Positives = 200/457 (43%), Gaps = 38/457 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR  +  +L  +          ++    +   R +   D+     +V  T+++L +ID V
Sbjct: 6   ARETALKILYDITENHAYSNISVNRHLENDKLREI---DRSFATELVYGTVKWLLQIDYV 62

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L       L +    ++ +LR+ + Q+L+ D +   A  +  VE AKR   ++  ++ VN
Sbjct: 63  LGKYSSVKLKKLSPWIKNILRLGIYQLLHTDRIPVSAACNTGVELAKRY-GHQASSRFVN 121

Query: 126 SILRR--------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           ++LR            +K + +  ++ +   P W  E+    YG E    +  +      
Sbjct: 122 AVLRNIAKSKNNIPYPDKSDNVNYLSILYSHPVWMVEKWIELYGTEFTEELLKSNNQVPD 181

Query: 178 IDLTVK---FDIETWAHKLNAV------MLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
             +       D  T    L+                + + P SI +L  F  G + VQD 
Sbjct: 182 FIIRTNTLKTDRVTLLDMLHKEGISAEPGRYIEEAVILKSPSSITNLEVFKNGYFQVQDE 241

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  ++       +V+D+C+APGGK   +   + +   + A DV + +L+ +  +  R
Sbjct: 242 SSMLAAKILDPKEGETVIDVCSAPGGKATHMAQLMNNKGTIIARDVYQHKLKLIEQSCCR 301

Query: 286 LHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +        DA           D VL+DAPCS  G IR+ PD+ ++R   ++ +    
Sbjct: 302 LGIDIIKTEIHDACCLDETFTGKADRVLIDAPCSGLGIIRKKPDIKYSRTEKELREITGL 361

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR++L     ++KPGG +++S C++ ++++ ++V   L  +P    L         ++D+
Sbjct: 362 QREILKNSSKYLKPGGYLLYSTCTIQQEENLDIVSDFLEDNP-DFRLTGFQELMPPTLDI 420

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           A   S EG+I++ P++ +         DGFF   ++R
Sbjct: 421 AS--SAEGYIQLFPNINQ--------TDGFFISKIKR 447


>gi|90421014|ref|ZP_01228918.1| putative ribosomal RNA methyltransferase [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90334792|gb|EAS48568.1| putative ribosomal RNA methyltransferase [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 472

 Score =  286 bits (730), Expect = 7e-75,   Method: Composition-based stats.
 Identities = 202/442 (45%), Positives = 269/442 (60%), Gaps = 6/442 (1%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           + G+ ARLV++ LLS ++  R S   LLD   G   FR L  RDQ LV+AI+   LRF  
Sbjct: 35  RPGLGARLVATKLLSAIVDARTSADGLLDAAGGHPGFRALEGRDQGLVKAIILSALRFRG 94

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I   LD  L   LP    +L+ +L V   QIL+LDV D A VDLAV  A  D  +R FA
Sbjct: 95  TISRALDACLDRPLPPNAAALKHILHVGATQILFLDVPDSAAVDLAVAAANVDSRSRRFA 154

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            ++N++LRR+SREK  L +       +P+W   R+   YG ER  AI+ A ++P  +DLT
Sbjct: 155 GMINAVLRRLSREKDALREVATATENMPDWLAARMVAAYGPERTEAIARAHLTPAPLDLT 214

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA KL  V LP G +RL      + +L GFAEG WWVQDA+A++P QLFG L 
Sbjct: 215 VKRDPAGWAGKLGGVALPNGTVRLGSFDGPVTALEGFAEGEWWVQDAAAALPAQLFGDLT 274

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQLI +G  VTALD++  R+++L+ NL RL L AE +   D   +
Sbjct: 275 GKRVADLCAAPGGKTAQLIAAGGAVTALDINANRMKRLKANLARLSLEAETV-VGDIAAF 333

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P + FDA+L+DAPCSSTGTIRRHPDV +T+D ++I K A  Q +LL + +  + PGG +
Sbjct: 334 EPAEPFDAILLDAPCSSTGTIRRHPDVPYTKDAEEIAKLAGVQARLLGEAVRLLAPGGRL 393

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML- 420
           VFSNCSLD  + E +V  +L      V   P+       ++ A  L+PEG +R TPDM+ 
Sbjct: 394 VFSNCSLDPAEGEAIVAALLTDRSDIVR-DPVQPGELPGMEFA--LTPEGDLRTTPDMMG 450

Query: 421 -EKIDGVSSGMDGFFAVALRRL 441
                  + G+DGF+A  L+R+
Sbjct: 451 GAADAPATGGLDGFYAARLKRI 472


>gi|81299771|ref|YP_399979.1| sun protein [Synechococcus elongatus PCC 7942]
 gi|81168652|gb|ABB56992.1| sun protein [Synechococcus elongatus PCC 7942]
          Length = 451

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 125/461 (27%), Positives = 196/461 (42%), Gaps = 42/461 (9%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           S  NAR V+   L+ + R+       LD     S    L   D+ LV  +V   +R    
Sbjct: 5   SRGNARWVAFQTLTTI-REGAFADLALDRHLQRS---GLVGADRRLVTELVYGCVRRQRT 60

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +DA++D +      ++   L+ +L++ + Q+ YL+ +   A V   V+ AK+       +
Sbjct: 61  LDALIDLLAQRPAAQQPPVLRTVLQLGLYQLRYLEQIPTAAAVAETVQLAKQLGLG-GLS 119

Query: 122 KLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDAC 172
             VN+ILR+  R+  E              A     P+W  +   +  G +    +    
Sbjct: 120 GAVNAILRQYLRQSEERDPLPLPSDPIAALAIHQSFPDWLVQLWSDRLGLDEAEFLCHWF 179

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVMLP-------TGGIRLKELPESIVSLPGFAEGV 222
             P  IDL +     +       L AV +           +RL + P  I  LPGF EG 
Sbjct: 180 NQPPSIDLRINPLRTERSQVQAALEAVGIRSTPDPQLPQALRLIDPPGPIRQLPGFDEGW 239

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKL 279
           W VQD+SA +   L       +VLD+CAAPGGK+  L   +    +V A D S +RL K+
Sbjct: 240 WMVQDSSAQLIAHLVDPQPGETVLDVCAAPGGKSTHLAELMGDRGQVIACDSSAKRLRKV 299

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           + N  RL L +     +D          D +LVDAPCS  GT+ RH D  W +  D + +
Sbjct: 300 QENAQRLQLSSITTRAIDGRQI-KGIQADRILVDAPCSGLGTLHRHADGRWRQSPDSVAE 358

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  Q ++L    + +KP G +V++ C+L   ++E V+++ L+  P         +    
Sbjct: 359 LAQLQSEILDAAAACLKPAGTLVYATCTLHPAENEAVIEQFLQRHPDWQM-----APLAA 413

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                      G +RI P             DGFF   L+R
Sbjct: 414 DSPFQAWAEANGTLRIWPH--------RHDRDGFFGARLQR 446


>gi|39933110|ref|NP_945386.1| Sun/ nucleolar Nop1/Nop2 [Rhodopseudomonas palustris CGA009]
 gi|39652735|emb|CAE25474.1| Bacterial Sun/eukaryotic nucleolar Nop1/Nop2 [Rhodopseudomonas
           palustris CGA009]
          Length = 450

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 172/441 (39%), Positives = 254/441 (57%), Gaps = 8/441 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V++KR  L   L+        + LS RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLSDRDRALMRRLVATILRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LEGLLAKLLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE    + +  AG   +P+W   R    YG E   AI+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGQPLVEELAAGTPDVPQWLLARWSEHYGAETTRAIAHAISHEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L+  +LPTG +R   L  S+  LPGF EG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDPAHWAARLHGEVLPTGTVR-TLLQGSVRMLPGFDEGQWWVQDAAAALPARLFGDIA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             SV DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL L   +    DA ++
Sbjct: 252 GKSVADLCAAPGGKTAQLAAAGARVTAIDRSPARVARLRENLARLSLK-VETGVADAAEW 310

Query: 302 CPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FDAVL+DAPC+STGTIRRHPDV W +   DI   A  Q +LL +  S ++PGG
Sbjct: 311 RGDATAEFDAVLIDAPCASTGTIRRHPDVAWLKQESDIGALAAVQNRLLKKAASLLRPGG 370

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E+ +  +L +    +   P++ A  +   +A  ++ +G +R  P  
Sbjct: 371 TLVYCTCSLEPEEGEQAIAALLDA-ESSMRRQPIDPA--EVAGLAEIVTTDGALRTLPCH 427

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D   +G+DGF+A  L +
Sbjct: 428 LPHSDPRLAGLDGFYAARLVK 448


>gi|332710036|ref|ZP_08429991.1| ribosomal RNA small subunit methyltransferase RsmB [Lyngbya
           majuscula 3L]
 gi|332351179|gb|EGJ30764.1| ribosomal RNA small subunit methyltransferase RsmB [Lyngbya
           majuscula 3L]
          Length = 477

 Score =  285 bits (729), Expect = 8e-75,   Method: Composition-based stats.
 Identities = 126/483 (26%), Positives = 205/483 (42%), Gaps = 64/483 (13%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++   L  + R+       L+    +     L+  D+ LV  +V  ++R    +DA
Sbjct: 13  NPRQLAFLALRDIHRRGAFADIALNRVLHN---AQLTGADRGLVTELVYGSVRRQRTLDA 69

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +LD +      ++   L+ +L + + Q+ Y   +   A V+  V+ AK +   +  A +V
Sbjct: 70  LLDQLGKKKANQQPPDLRTILHLGLYQLRYQGRIPASAAVNTTVDLAK-NNGFKGLAGVV 128

Query: 125 NSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           N +LR  +R               ++R+  +   P+W  E      G E    +      
Sbjct: 129 NGLLRNYARLAANSPDPLELPAGDMERLGILHSFPDWMIELWLQQLGLEETEQLCQWFNQ 188

Query: 175 PLYIDLTVKF---DIETWAHKLNAV----------------------------MLPTGGI 203
              IDL +      IE     + +                                   +
Sbjct: 189 SPTIDLRINPLKVSIEEVEAGMQSAELAIQRVPTLVSHQDEGNGEIIPMFSNPAQLPQAL 248

Query: 204 RLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---I 260
           R+     +I  LPGF EG W VQD SA +   L        V+D CAAPGGKT  +   +
Sbjct: 249 RIVGGVGAIQELPGFKEGWWTVQDCSAQLVSYLLDPQPGDVVIDACAAPGGKTTHIAELM 308

Query: 261 VSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK-KLFDAVLVDAPCSST 319
               K+ A D S  RL+K++ N  RL L +  I   D+ D      + +AVL+DAPCS  
Sbjct: 309 ADQGKIWACDRSASRLKKVQQNAQRLELQSIQISTGDSRDCPEFTNVANAVLLDAPCSGN 368

Query: 320 GTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQK 379
           GT+ R PD+ W    + + +    Q++LL    ++VKPGG++V++ C+L+ Q++E V+Q 
Sbjct: 369 GTLHRRPDIRWRMTPEKVQELTVLQKELLEHTATWVKPGGVLVYATCTLNPQENEAVIQW 428

Query: 380 VLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
            L          P  S       +    +PEGW+++ P            MDGFF V L+
Sbjct: 429 FLEGHSQWQIEPPTVSF------LKEFSTPEGWLKVVP--------YRDQMDGFFMVRLK 474

Query: 440 RLI 442
           R+I
Sbjct: 475 RMI 477


>gi|83589751|ref|YP_429760.1| sun protein [Moorella thermoacetica ATCC 39073]
 gi|83572665|gb|ABC19217.1| sun protein [Moorella thermoacetica ATCC 39073]
          Length = 457

 Score =  285 bits (729), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 111/466 (23%), Positives = 190/466 (40%), Gaps = 37/466 (7%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K  ++AR  +  ++  V  +       LD          L  R++ L   +    ++   
Sbjct: 5   KPAVSAREAALQVIYRVTEEGAYAGLALDEVLKS---AGLDGRERALATELAYSAIKAWG 61

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILY-LDVADYAVVDLAVEQAKRDKENRHF 120
            +D  L   L   L +    ++ +LR+   Q+LY   +   A +   VE AK+   +R  
Sbjct: 62  TLDWALGLFLRQPLEKLPPWIRCVLRLGATQLLYVPRIPPRAAIYETVELAKKY-GHRGT 120

Query: 121 AKLVNSILRRVSREKIELLQRIAG---------ISIIPEWFKERLENFYGKERVLAISDA 171
             LVN +LR + R+K  L                   P W  ER    +G +    +  A
Sbjct: 121 TGLVNGVLRHLDRQKDALPYPDWKTDPAGYLALRYYHPRWLVERWLEEFGYQETEYLCRA 180

Query: 172 CISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGV 222
              P      V       +  A +L A        R      + E   ++ + P F EG+
Sbjct: 181 DNEPPPTIARVNTLKTRKDVLAARLQAEGATVRPARYAPEGLVVEGLGALEASPSFQEGL 240

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKL 279
           ++VQD  + +        +   V+D  AAPGGKT  L   +     + A DV + RL+ +
Sbjct: 241 FYVQDEGSQLVSHALHPDSGAWVIDASAAPGGKTTHLAQLMADRGTILACDVHRGRLDLI 300

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
             N  RL +     + +DA +   +     D +L+DAPCS  G +RR PD  W ++    
Sbjct: 301 AANCRRLGVTCVRTVLVDARELGERYPAAADYLLIDAPCSGLGVLRRRPDARWRKEAPRT 360

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            + A  Q  +L+     +KPGG++V+S C+L  ++++EVV++ L  +        L    
Sbjct: 361 RELARLQLAILMGARQALKPGGVLVYSTCTLLPEENQEVVREFLERA-GEFRPDSLEPWL 419

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                  M  + +GW++  P           G DGFF   +++L +
Sbjct: 420 PVLPPDLMVTARQGWVQFLPQ--------RHGTDGFFIARIKKLEK 457


>gi|260892752|ref|YP_003238849.1| sun protein [Ammonifex degensii KC4]
 gi|260864893|gb|ACX51999.1| sun protein [Ammonifex degensii KC4]
          Length = 452

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 116/460 (25%), Positives = 194/460 (42%), Gaps = 40/460 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR ++  +L  V  +       L    G    +     ++ L+  +   TLR L  ID V
Sbjct: 4   ARELALKVLYAVDVEGAYGNLALTSVMGKYRPQG---PERSLLTELCYGTLRRLNTIDWV 60

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L   +   L  +   ++ +LR++V QILYLD +   A  + AVE AK+       A  VN
Sbjct: 61  LAKFIKRPLCEQNPWIRNILRLAVYQILYLDRIPPAAATNEAVELAKKY-APPSMAGFVN 119

Query: 126 SILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           ++LRR             +   +  +A     P W  E     +G E  + I +A   P 
Sbjct: 120 AVLRRVVREKDNLTFPDIRTNPVDHLALKYSHPTWLVEMWLKEFGLEETIRICEANNQPA 179

Query: 177 YIDLT---VKFDIETWAHKLNAVMLPTGGIRLKELPE-------SIVSLPGFAEGVWWVQ 226
              L    ++   E    +L           L             +  LP + EG++++Q
Sbjct: 180 AATLRTNLLRTTREELMERLRREADLRVSPTLYAPEGIRVQGFFDLQHLPSYQEGLFYIQ 239

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ +        +   VLD+C APGGK      L+    ++  +D+   RL  +  N 
Sbjct: 240 DESSMLAAHALAPASGSFVLDVCGAPGGKATHLAELMRDSGRILVVDIYAHRLALVVANS 299

Query: 284 DRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
            RL L + + ++ DA     +     D VL D PCS  G +RR PD+ W ++ +      
Sbjct: 300 RRLGLKSVETLQADARSLDQQFAGQADYVLADVPCSGLGVLRRKPDIRWRKEPEIFPGLV 359

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q+++L    + V+PGG++++  C+L + ++   +++ L   P  + L  L     +++
Sbjct: 360 TLQQEILESAAACVRPGGVLLYCTCTLGEAENLGQIKRFLSRHPDFL-LEDLRPFLPEAL 418

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           D    L   G+I+I P           GMDGFF   LRR 
Sbjct: 419 DREGTL-RHGYIQIMP---------YQGMDGFFIARLRRK 448


>gi|302392192|ref|YP_003828012.1| sun protein [Acetohalobium arabaticum DSM 5501]
 gi|302204269|gb|ADL12947.1| sun protein [Acetohalobium arabaticum DSM 5501]
          Length = 448

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 114/464 (24%), Positives = 190/464 (40%), Gaps = 38/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R  +   +  V  +      +L+  +       L+ +D+ L   ++  +LR  
Sbjct: 1   MTK--NGRQTAVEAVYRVNEEGAYSNLILNHLFKKY---NLADQDRGLATELIYGSLRMR 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L+      + +     + +LR+ + QI +LD + D    +  VE AK  + +  
Sbjct: 56  NHLDWILNQFADRRVNKMDKWTRNILRLGLYQIRFLDSIPDAVACNETVELAKDYQ-HSG 114

Query: 120 FAKLVNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
            A  VN ILR            + K   +Q I      P+W  E     YG E  + I  
Sbjct: 115 AAGFVNGILRSILRSLDEIEFPQLKSNPVQHIRYKYSFPQWMVETWVKRYGVELTVDICS 174

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTG------GIRLKELPESIVSLPGFAEG 221
           A        +         E     L +V + T                S+     F  G
Sbjct: 175 AFNQIPSKIIRQNRLKVTAEELQADLASVGIETEAISEIPQAFRVTNSSSLFQSNSFTAG 234

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
            + +Q  ++ I   +        VLDLC+APGGKT  L   + +  ++ A D+ + +LE 
Sbjct: 235 YFQIQGLASIIAGHIMNPQPKDIVLDLCSAPGGKTTHLAELMANQGEIVANDLHEDKLEL 294

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           +  N +RL +        D      +K FD +LVDAPCS  G I + P++ W +   DI 
Sbjct: 295 IERNCNRLGIRIVRTRAGDGRSLKFEKKFDRILVDAPCSGLGMIAKKPEIKWQKKPQDID 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
             A  Q +LL     F+KP G +V+S C++  Q++ EV+ K L  +    ELV L+S + 
Sbjct: 355 SLAELQLELLNNAGRFLKPKGELVYSTCTITHQENLEVINKFLAQN-SDFELVDLSS-WA 412

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
             + ++     EG I++ P              GFF   L++ +
Sbjct: 413 DKLGISSEFILEGSIQLLPTWQTNE--------GFFIAKLKKRV 448


>gi|254423387|ref|ZP_05037105.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           PCC 7335]
 gi|196190876|gb|EDX85840.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           PCC 7335]
          Length = 491

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 118/468 (25%), Positives = 211/468 (45%), Gaps = 51/468 (10%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSA-----FRLLSQRDQILVRAIVNVTLRFLP 61
           AR ++   L  +  +      ++D +   +         LS +D+ LV  +V  ++R   
Sbjct: 38  ARQIAFEALRAID-QGAFADVVIDRKLKGTQTGTQLGIQLSSQDKGLVTELVYGSVRRRR 96

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHF 120
            +DA++D        ++   L Q+LR+   Q+ YLD V  +AVVD  V+ AK  +  +  
Sbjct: 97  TLDALIDQFGKRPASKQHRDLLQILRLGFYQLRYLDHVPVHAVVDTTVQLAKSQRLGK-L 155

Query: 121 AKLVNSILRRVSREKIELLQRIAG--------------ISIIPEWFKERLENFYGKERVL 166
           + +VN++LR+ +RE +     IA               +   P+W  +   +    ++V 
Sbjct: 156 SGVVNAMLRQYAREAMPAANVIADPLKLPEERTRRLGILHSYPDWIIDVWRSMLPDDQVE 215

Query: 167 AISDACISPLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLP 216
           A+ +      Y++L +    ++ +           +   +      +RL     ++  LP
Sbjct: 216 ALCEYFNRSPYLELRINLQRQSLSAAIALFADAGIEALPIEGVPSALRLTTHAGAVTQLP 275

Query: 217 GFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSK 273
           G+AEG W VQD+SA +   L        ++D CAAPGGK+  +   + +   V + D + 
Sbjct: 276 GYAEGWWAVQDSSAQLVSYLLDPQPGEVIIDACAAPGGKSLHIAELMRNEGTVWSCDRTS 335

Query: 274 RRLEKLRCNLDRLHLYAEDIIEMDAFDYC-PKKLFDAVLVDAPCSSTGTIRRHPDVLWTR 332
            R +K++ N+DRL       I  D+ +        D VL+D PCS  GT+ RH D  W +
Sbjct: 336 SRTKKIQQNIDRLGATIVRPIMGDSRNQPTFLGQGDRVLLDVPCSGLGTLNRHADARWRQ 395

Query: 333 DTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVP 392
             D +      Q+++L+   ++VKPGG++V++ C+L  Q++E  ++  L  +       P
Sbjct: 396 TPDSVDSLVTLQQEILMHASTWVKPGGVLVYATCTLHPQENEAQIKTFLSQNAGWTIEAP 455

Query: 393 LNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                       +  +  GWI++ P +          MDGFF V LRR
Sbjct: 456 -------PPSFGIEPTEAGWIKVWPHIQ--------HMDGFFIVKLRR 488


>gi|192288464|ref|YP_001989069.1| Fmu (Sun) domain protein [Rhodopseudomonas palustris TIE-1]
 gi|192282213|gb|ACE98593.1| Fmu (Sun) domain protein [Rhodopseudomonas palustris TIE-1]
          Length = 450

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 169/440 (38%), Positives = 251/440 (57%), Gaps = 6/440 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V++KR  L   L+        + LS RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLSDRDRALMRRLVATILRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LEGLLAKLLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE    + +  AG   +P+W   R    YG E   AI+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGQPLVEELAAGTPDVPQWLLARWSEHYGAETARAIAHAISHEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L+  +LPTG +R   L  S+  LPGF EG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDPAHWAARLHGEVLPTGTVR-TLLQGSVRMLPGFDEGQWWVQDAAAALPARLFGDIA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA-EDIIEMDAFD 300
             SV DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL       + +   + 
Sbjct: 252 GKSVADLCAAPGGKTAQLAAAGARVTAIDRSPARVARLRENLARLSFEVETGVADAAEWR 311

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
                 FDAVL+DAPC+STGTIRRHPDV W +   DI   A  Q +LL +  S ++PGG 
Sbjct: 312 GDETAEFDAVLIDAPCASTGTIRRHPDVAWLKQESDIGALAAVQNRLLKKAASLLRPGGT 371

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +V+  CSL+ ++ E+ +  +L +    +   P++ A  +   +A  ++ +G +R  P  L
Sbjct: 372 LVYCTCSLEPEEGEQAIAALLDA-ESSMRRQPIDPA--EVAGLAEIVTADGALRTLPCHL 428

Query: 421 EKIDGVSSGMDGFFAVALRR 440
              D   +G+DGF+A  L +
Sbjct: 429 PHSDPRLAGLDGFYAARLVK 448


>gi|170077132|ref|YP_001733770.1| ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Synechococcus sp.
           PCC 7002]
 gi|169884801|gb|ACA98514.1| ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Synechococcus sp.
           PCC 7002]
          Length = 447

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 129/465 (27%), Positives = 204/465 (43%), Gaps = 45/465 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M S   AR ++   L  +M         LD     S    L+  D+ LV  +V  T+R  
Sbjct: 1   MSS---ARQLAFLALRQIMYHNAYTDVALDRVLHKS---NLTGSDRALVAELVYGTVRRQ 54

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +DA++D +    + ++   L+ LL++ + Q+ YLD +   A V+ +VE AK +K  + 
Sbjct: 55  KTLDAIIDQLGKKPIDQQPPDLRVLLQLGLYQLRYLDQIPPSAAVNTSVEIAKTNKLGQ- 113

Query: 120 FAKLVNSILRRVSREKIELLQRI----------AGISIIPEWFKERLENFYGKERVLAIS 169
            A +VN  LR   R++ +    +          A     PEW   +    +G E    + 
Sbjct: 114 LAGVVNGCLRGYLRQRDKGHDPLQLPEAAAERLALQYSFPEWLIGQWLEQFGAEETEQLC 173

Query: 170 DACISPLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLPGFA 219
                P  +DL V       A           K  A+      +RL E    I  LPG+ 
Sbjct: 174 QWFNRPAQLDLRVNPLRANVAAVQDKLNQAGVKAEAIANLPNALRLVEKRGLIQDLPGYK 233

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRL 276
           EG W +QDASA +   L        ++D CAAPGGKT      +     + A D  + R+
Sbjct: 234 EGWWTIQDASAQLVTHLLDPQPGEVIIDACAAPGGKTTHIAEKMQDRGTIWASDKYQARI 293

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFDYC-PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            K+  N  RL L     +  D+  Y   + + D VL+D PCS  GT+ + PD+ W ++  
Sbjct: 294 NKIEQNARRLKLSMIRTLIGDSRTYSQFRNMADRVLLDVPCSGLGTLHKRPDIRWQQNPQ 353

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            I +    Q +LL  G ++VKPGG +V++ C+L+  ++E +  + L   P   ++VP + 
Sbjct: 354 KIAQLTQLQGELLTTGATWVKPGGYLVYATCTLNPAENEAIANQFLVEHPDW-QIVPPSP 412

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                         +GWI++ P            MDGFF V L+R
Sbjct: 413 DLPAFPYAQ----EQGWIQVLPQ--------RHDMDGFFMVKLQR 445


>gi|163869265|ref|YP_001610521.1| SUN-family protein [Bartonella tribocorum CIP 105476]
 gi|161018968|emb|CAK02526.1| SUN-family protein [Bartonella tribocorum CIP 105476]
          Length = 454

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 271/445 (60%), Gaps = 10/445 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ +   L+ L D E+G   +  LSQRD++L RAI+  +LR   +
Sbjct: 15  PGLAVRQVCVRLLGAVVDRYTPLSGLTDNEHGHPQYLKLSQRDRLLCRAILTTSLRHRGQ 74

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I A L   L   LP +  SLQ LL +SVAQILYLD+ D+A +DLAV  AK D   R F+ 
Sbjct: 75  ITAALSCFLERPLPSQALSLQHLLHISVAQILYLDIPDHAAIDLAVRVAKFDPRMRRFSG 134

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           +VN++LR V+RE   L Q++  I  +P WF + L + YG E+   I +       +DLTV
Sbjct: 135 VVNALLRNVAREAAPLRQQVPTIEGVPAWFSQLLVSAYGIEKAQQIIELQSVEPPLDLTV 194

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  V+LP G +RL  L  S+  LPG+ EG WWVQD +A++P  L G L  
Sbjct: 195 KSDSIGWAERLGGVVLPNGSVRLNRLECSVSDLPGYREGAWWVQDFAAALPACLLGELRG 254

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL + GA+VTA+++S  R+++L+ N++RL+     I + D  ++ 
Sbjct: 255 KRVADLCASPGGKTAQLALQGAEVTAIELSANRVKRLKENMERLYFS-VHIWQGDVRNFH 313

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P +LFDAVL+DAPCSSTGTIRRHPD+LWT+  DD++K A  Q  LL+  I+ VK GG +V
Sbjct: 314 PTQLFDAVLLDAPCSSTGTIRRHPDILWTKSRDDVIKLAALQYDLLVAAIALVKKGGRIV 373

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM--- 419
           FSNCSL +++ E++++K+L      V    L+  Y + +     L  EG +R TP     
Sbjct: 374 FSNCSLAREEGEDLIEKILSIRNDIV----LDPIYPEEMGALAHLLSEGMVRTTPADFCH 429

Query: 420 --LEKIDGVSSGMDGFFAVALRRLI 442
              +       GMDGFFA  LR++ 
Sbjct: 430 KNFDAEKTAPLGMDGFFAARLRKIA 454


>gi|312111726|ref|YP_003990042.1| sun protein [Geobacillus sp. Y4.1MC1]
 gi|311216827|gb|ADP75431.1| sun protein [Geobacillus sp. Y4.1MC1]
          Length = 447

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 121/464 (26%), Positives = 206/464 (44%), Gaps = 39/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R V+   L  V  K      LL+          LS+RD  L+  IV  T++  
Sbjct: 1   MKAK-NVREVALETLLAVEEKEAYSNLLLNNMIETHR---LSERDVRLLTEIVYGTIQRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L  +  + +  ++ LLR+++ Q+LYLD + D A +  AVE AK+ + ++ 
Sbjct: 57  DTLDYYLAPFLKKA-RKLERWVRVLLRLTLYQVLYLDRIPDRAAIFEAVEIAKK-RGHQG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A LVN ++R + R+ +  L+ I       A  +  P W  +R    YG      + +  
Sbjct: 115 IASLVNGVMRAILRQGVPPLENIEDEVERLAVATSHPRWLVKRWVEQYGWMETKRMCETN 174

Query: 173 ISPLYIDLTVKFDIETWAHKLNAVMLPTGGIR--------LKELPESIVSLPGFAEGVWW 224
           + P      V     T A  L+ +      +         ++    ++ +   F  G   
Sbjct: 175 LLPPKQTARVNTARITIAETLDRLRQEGMEVSRGEVAAEAIQAKKGNLANTEAFRRGWIT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +  G   +  VLD CAAPGGK+  +   + +  +V   D+ + ++  +  
Sbjct: 235 IQDESSMLVARALGPKEHERVLDSCAAPGGKSTHIAELMNNTGQVICADIHEHKVNLIEE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           N  RL L       +D+        ++ FD +LVDAPCS  G IRR PD+ + +   DI 
Sbjct: 295 NAKRLQLTNISARTLDSRRLGEVFERETFDKILVDAPCSGFGVIRRKPDIKYAKTEADIS 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
             A  QR++L      +K GG +V+S C++D +++E V+ + L   P   E  P  +   
Sbjct: 355 SLAALQREILDAVAPLLKKGGTLVYSTCTIDHEENEAVIAQFLNDHP---EFSPDETMKQ 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +  +        G + + P           G DGFF  +LR+ +
Sbjct: 412 RLPEKVQPYVRNGQLHLLPHYF--------GSDGFFIASLRKKV 447


>gi|302389593|ref|YP_003825414.1| sun protein [Thermosediminibacter oceani DSM 16646]
 gi|302200221|gb|ADL07791.1| sun protein [Thermosediminibacter oceani DSM 16646]
          Length = 450

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 119/466 (25%), Positives = 203/466 (43%), Gaps = 42/466 (9%)

Query: 1   MKS-GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MKS  +  R ++  +L+ V  +       L+          +S+ D+ L+  +V   ++ 
Sbjct: 1   MKSVKLKPRELAVRILTEVE-RGSYSNLSLNRHLT----AEISREDRALITELVYGVIKH 55

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENR 118
             R+D VL       L      +   LRV + QIL+LD + DYA V+ +V  AK    ++
Sbjct: 56  RIRLDYVLSKFSKIGLNDINPIILNCLRVGLYQILFLDKIPDYAAVNESVNIAKLY--SK 113

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGI---------SIIPEWFKERLENFYGKERVLAIS 169
             A  VN +LR V R K  +                   P+W   R  + +G E   ++ 
Sbjct: 114 KAAGFVNGVLRNVIRSKDGIDYPDRVKDPLRYLVVYYSFPKWMIRRWLDLFGFEFTESLC 173

Query: 170 DACISPLYIDLTVK---FDIETWAHKLNAVMLPTGGIRL------KELPESIVSLPGFAE 220
            A      + + V     +       L+   +              +    +  L  F  
Sbjct: 174 KAFNEKPRMCVRVNELKINKTGLQAFLDKEGVVHNPGLFLEEALYIDDGPPLTELDSFKN 233

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLE 277
           G +  QD S+ +  +  G  +  +VLD+ AAPGGKT  L   + +  ++ A D+   R++
Sbjct: 234 GYFQPQDESSMLVARALGAASGETVLDVAAAPGGKTTHLAQLMKNSGRIYAWDIHPHRVQ 293

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            L+    RL +        DA          FD VLVDAPCS  G IRR PD+ WT+  +
Sbjct: 294 LLKETCQRLGVSIVYPEVRDARVPDKNLFGKFDRVLVDAPCSGLGVIRRKPDIKWTKKPE 353

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           DI      Q +++     +VKPGGI+++S CS++ +++ EVV++ L+ +    +L  +  
Sbjct: 354 DIPVLKREQLQIIRVSSQYVKPGGILIYSTCSIEPEENREVVKEFLKEN-RDFDLDDIRP 412

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +++  A      G+I+I P++          +DGFF   L+R+
Sbjct: 413 HLPEAL-SADVKEQYGYIQIYPNL--------HSIDGFFIARLKRI 449


>gi|51892487|ref|YP_075178.1| hypothetical protein STH1349 [Symbiobacterium thermophilum IAM
           14863]
 gi|51856176|dbj|BAD40334.1| conserved hypothetical protein [Symbiobacterium thermophilum IAM
           14863]
          Length = 459

 Score =  285 bits (728), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 108/460 (23%), Positives = 182/460 (39%), Gaps = 42/460 (9%)

Query: 8   RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVL 67
           R  +   L  V  K       LD     S    L  R++ L   +     R    +D  +
Sbjct: 13  REAALRALYDVDIKAAYANLALDHHLSRSQ---LDGRERALATELAYGVTRRRATLDWAI 69

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNS 126
             V    L +    ++ +LR +  QILY+D +   A VD AVE A++   +   AK VN 
Sbjct: 70  GQVAARPLEKMDPWVRNILREAAYQILYMDRIPPAAAVDQAVELARQY-GHEGVAKFVNG 128

Query: 127 ILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           +LR + R    L             A     PEW   +    +G+   + + +A      
Sbjct: 129 VLRNLIRRLPGLPWPDEAADPVRALAVQHSYPEWLVAQWLERFGRGEAVRLLEAGNQVPP 188

Query: 178 IDLTVKFDIET------------WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
           + + V     T               +          I+      S+  L    +G+  V
Sbjct: 189 LTVRVNRLKATREEAAAALAAEGVRTEPTRHSPQGLIIQDLTSASSLERLEAMKQGLITV 248

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCN 282
           QD S+ +   +        V+D+ AAPGGK      L+ +  +V ALD+   ++  +  N
Sbjct: 249 QDESSMLAAAVLNPQPGWMVIDVAAAPGGKATHLAELMDNRGRVIALDIHPHKVALIEEN 308

Query: 283 LDRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            +RL     + + +DA           DAVL D PCS  GT+ R PD  W +  +D+   
Sbjct: 309 AERLGTTIVEAVCLDARRVGEAMPERADAVLCDLPCSGLGTLARRPDARWRKSPEDVEAL 368

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              QR +L      +KPGG++V+S C++  +++EE+V+  +   P   E        +  
Sbjct: 369 VPIQRAILESAAKALKPGGVLVYSTCTIQPKENEELVEGFVADHP---EFRFDRVWDYLP 425

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             ++     EG++++ P +         G DGFF   + +
Sbjct: 426 GTISPEGQAEGYVQLLPHV--------HGTDGFFIARMVK 457


>gi|144899806|emb|CAM76670.1| Fmu (Sun)/eukaryotic nucleolar NOL1/Nop2p:Antitermination protein
           NusB [Magnetospirillum gryphiswaldense MSR-1]
          Length = 437

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 163/436 (37%), Positives = 243/436 (55%), Gaps = 14/436 (3%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
            R +   LL CV+ ++  L   LD    +     L++RD+   R +V  TLR L +IDAV
Sbjct: 14  PRSIVLDLLECVLAQKRLLDETLD---SEPRLTKLAERDRAFTRMLVATTLRRLGQIDAV 70

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNS 126
           +   +   LP K   ++ +LR+  AQ+L+LD   +A +   V+ AK       FAKL+N+
Sbjct: 71  IARCIDRPLPAKAGRVRNMLRLGAAQLLFLDTPPHAAISTTVDLAKNSPL-AGFAKLINA 129

Query: 127 ILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFD 185
           +LRR+ RE    + ++ AG    P W  +   + YG +    I+ A  +   +D++V  D
Sbjct: 130 VLRRLDREGRAWVAEQDAGPLNTPAWMWQSWLDTYGPDTARLIAQAHQTEAPVDISVAGD 189

Query: 186 IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSV 245
              WA +L A ++PTG +R ++    +  LPGFAEG WWVQD +AS+P +L G +    V
Sbjct: 190 PALWAERLEADIMPTGTLR-RQAGGDVTQLPGFAEGAWWVQDLAASLPAKLMGAVKGKRV 248

Query: 246 LDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKK 305
            DLCAAPGGK  QL V+ A+VTA+D S +R+ + R NL+RL L A  + E D   + P  
Sbjct: 249 ADLCAAPGGKALQLAVAEAEVTAVDRSAKRMVRFRRNLERLKLAATIV-ETDVAGWQPPA 307

Query: 306 LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN 365
            FDAVL+DAPC++TGT+RRHPD +  +   D+   A  Q  LL    + VKPGGI+V+  
Sbjct: 308 PFDAVLLDAPCTATGTLRRHPDGVHLKGPGDVAYLADQQHALLKAAAAMVKPGGILVYCV 367

Query: 366 CSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDG 425
           CSL+ Q+ E  + ++L S   P+   P+  +    +D    L+ +G IR  P  L +   
Sbjct: 368 CSLEPQEGEAQIIRLLES-GAPLVRDPIEPSEIPGLDF--VLTKQGEIRTLPHYLAE--- 421

Query: 426 VSSGMDGFFAVALRRL 441
              GMD FF   L+R+
Sbjct: 422 -KGGMDAFFIARLKRM 436


>gi|113474586|ref|YP_720647.1| sun protein [Trichodesmium erythraeum IMS101]
 gi|110165634|gb|ABG50174.1| sun protein [Trichodesmium erythraeum IMS101]
          Length = 443

 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 123/458 (26%), Positives = 206/458 (44%), Gaps = 40/458 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++  +L  + RK++     LD     +    L   ++ LV  +V   +R    +DA
Sbjct: 4   NPRQLAFIILQEIYRKQVFTDVALDRHLKKN---DLIDANRRLVTELVYGCVRRQRSLDA 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D +     P++   L+ +L + + Q+ YL+ + + A VD  VE AK++K  +  A  V
Sbjct: 61  IIDQLAKKKSPQQHPYLRIILHIGLYQLSYLEQIPESAAVDTTVELAKQNKFAK-LAGFV 119

Query: 125 NSILRRVSREKIELLQRIAGI------SIIPEWFKERLENFYGKERVLAISDACISPLYI 178
           N +LR   R+ + +      +         P W  +      G      +         I
Sbjct: 120 NGLLREYIRQNLTINLPENPVQKLGISYSFPNWIVKYWIEELGLTEAEKLCYWFNLSPSI 179

Query: 179 DLTVKFDIETWAHKLNA----------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           DL +     +      A          ++     +RL      I  LPG+ EG W +QD+
Sbjct: 180 DLRINPLKTSVEEVEIAMKNIGISVSRILQVPQALRLNGAVGQIQKLPGYNEGWWSIQDS 239

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA +   L        ++D CAAPGGKT  +   +    K+ A+D++  RL+KL  N +R
Sbjct: 240 SAQLVCYLLNPQPGEIIIDACAAPGGKTTHIGELMGDNGKIFAIDMTASRLKKLESNTER 299

Query: 286 LHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L L +  I   D+ +        D VL+D PCS  GT+ R  D  W +  ++I + A  Q
Sbjct: 300 LQLKSISISRGDSRNLTEFINQADRVLLDVPCSGLGTLHRRADARWRKTLENIGELAKLQ 359

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +LL     +VKPGG++V++ C++   ++E V++K L ++       P       ++D  
Sbjct: 360 GELLENAAKWVKPGGVLVYATCTIYPLENEGVIEKFLTNNYEWEIEAP-------TVDFM 412

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           ++   EGWI+I P            MDGFF V LRR +
Sbjct: 413 VSPCREGWIKIWPH--------REQMDGFFMVKLRRKV 442


>gi|295399764|ref|ZP_06809745.1| sun protein [Geobacillus thermoglucosidasius C56-YS93]
 gi|294978167|gb|EFG53764.1| sun protein [Geobacillus thermoglucosidasius C56-YS93]
          Length = 447

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 121/464 (26%), Positives = 206/464 (44%), Gaps = 39/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R V+   L  V  K      LL+          LS+RD  L+  IV  T++  
Sbjct: 1   MKAK-NVREVALETLLAVEEKEAYSNLLLNNMIETHR---LSERDVRLLTEIVYGTIQRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L  +  + +  ++ LLR+++ Q+LYLD + D A +  AVE AK+ + ++ 
Sbjct: 57  DTLDYYLAPFLKKA-RKLERWVRVLLRLTLYQVLYLDRIPDRAAIFEAVEIAKK-RGHQG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A LVN ++R + R+ +  L+ I       A  +  P W  +R    YG      + +  
Sbjct: 115 IASLVNGVMRAILRQGVPPLENIEDEVERLAVATSHPRWLVKRWVEQYGWIETKRMCETN 174

Query: 173 ISPLYIDLTVKFDIETWAHKLNAVMLPTGGIR--------LKELPESIVSLPGFAEGVWW 224
           + P      V     T A  L+ +      +         ++    ++ +   F  G   
Sbjct: 175 LLPPKQTARVNTARITIAETLDRLRQEGMEVSRGEVAAEAIQAKKGNLANTEAFRRGWIT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +  G   +  VLD CAAPGGK+  +   + +  +V   D+ + ++  +  
Sbjct: 235 IQDESSMLVARALGPKEHERVLDSCAAPGGKSTHIAELMNNTGQVICADIHEHKVNLIEE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           N  RL L       +D+        ++ FD +LVDAPCS  G IRR PD+ + +   DI 
Sbjct: 295 NAKRLQLTNISARTLDSRRLGEVFERETFDKILVDAPCSGFGVIRRKPDIKYAKTEADIS 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
             A  QR++L      +K GG +V+S C++D +++E V+ + L   P   E  P  +   
Sbjct: 355 SLAALQREILDAVAPLLKKGGTLVYSTCTIDHEENEAVIAQFLNDHP---EFSPDETMKQ 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +  +        G + + P           G DGFF  +LR+ +
Sbjct: 412 RLPEKVQPYVRNGQLHLLPHYF--------GSDGFFIASLRKKV 447


>gi|307150080|ref|YP_003885464.1| sun protein [Cyanothece sp. PCC 7822]
 gi|306980308|gb|ADN12189.1| sun protein [Cyanothece sp. PCC 7822]
          Length = 450

 Score =  284 bits (727), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 123/465 (26%), Positives = 214/465 (46%), Gaps = 42/465 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   + R ++  +L  + RK       LD     +  + L   D+ LV  +V   +R +
Sbjct: 1   MKLETDPRQLAVTILRDIYRKDAYTDIALDQGLKQAQLKSL---DRGLVTELVYGIVRRV 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D ++  +   +  ++   L+ +L++ + Q+ YLD +   A V+ +VE AK+++  + 
Sbjct: 58  RTLDQLITQLGKKTATQQPPDLRIILQIGLYQLRYLDQIPVSAAVNTSVELAKKNQLGK- 116

Query: 120 FAKLVNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAIS 169
            + +VN ILR+  R + +    +            +   P W  ++    +G+     + 
Sbjct: 117 LSGVVNGILRQYDRIQAQGKDPLELPSDRINRLGVLHSFPNWIVQQWLEEWGEGETEKLC 176

Query: 170 DACISPLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLPGFA 219
           +    P  ID+ V     T             K+  V      +RL     SI  LPGF 
Sbjct: 177 EWFNQPAMIDIRVNLLKTTVEEVELGFSKAGVKVLPVPHLPQALRLIGGSRSISQLPGFE 236

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRL 276
           EG W VQD+SA +   L        ++D CAAPGGKT  +   +     + A D    RL
Sbjct: 237 EGWWTVQDSSAQLVTHLLDPQPEEIIIDACAAPGGKTTHIAELMQDRGTIWACDRVASRL 296

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            K++ N  RL L +  I   D+      ++  D VL+DAPCS  GT+ + PD+ W +  +
Sbjct: 297 RKVQQNAQRLQLNSIKICSGDSRQLTQFRETADRVLIDAPCSGLGTLHKRPDIRWRQTPE 356

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            I + +  QR+LL +  S++KP G++V++ C+L+  ++E++++  L   P      PL+S
Sbjct: 357 KIEELSVLQRELLEEAASWIKPKGVLVYATCTLNPLENEKLIEAFLHHHPNWQIQPPLSS 416

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +       A   +  GWI++ P +          MDGFF V L +
Sbjct: 417 S-----PAAAFATTPGWIKVLPHL--------HLMDGFFMVKLVK 448


>gi|121533700|ref|ZP_01665527.1| sun protein [Thermosinus carboxydivorans Nor1]
 gi|121307691|gb|EAX48606.1| sun protein [Thermosinus carboxydivorans Nor1]
          Length = 442

 Score =  284 bits (725), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 107/460 (23%), Positives = 184/460 (40%), Gaps = 44/460 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR V+  +++ V          L  E      R L+ RD+  +  +V  T++    +D
Sbjct: 1   MNAREVALKVINRVDIDGAYANIALAQEMS---QRDLTDRDRRFITELVYGTVKAGATLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            +L       L +    ++ +LR+ + QI +L  +   A  + AV+ A++   +    K 
Sbjct: 58  WILSHYSSRPLDKIHPVIRNILRMGIYQIFFLSRIPVSAACNEAVKLAQKY-GHAGTVKF 116

Query: 124 VNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN++LR              + +  + IA     PEW   R    +G      + +A   
Sbjct: 117 VNAVLRSAGRSPDKVVYPDRERDPEKYIALRYFHPEWLVRRWVARFGAAICERLCEANNE 176

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWV 225
              + L              +L    +            L     ++  L     G++ V
Sbjct: 177 TPPLSLRTNTLKTSRADLLRRLAGEGVVCEPSAWAPEGILCHEYPALSKLASLRAGLFQV 236

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD S+     +        V+D C APGGK+  +   + +  KV A D+ + +L  +R N
Sbjct: 237 QDESSMTVAHVLSPRPGDFVIDACGAPGGKSTHIAALMGNKGKVLATDIYEHKLALMRDN 296

Query: 283 LDRLHLYAEDIIEMDAFDYCPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
             RL +   +   +DA           D VLVDAPCS  G +RR PD  W ++   +   
Sbjct: 297 AVRLGISILETQLLDAVKLGELYPGQADRVLVDAPCSGLGVLRRKPDSRWRKNEQMLTDL 356

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q  +L      +KPGGI+V+S C+ + +++ EVV+  L ++P  + L P        
Sbjct: 357 PRLQLAILASAAKCLKPGGILVYSTCTTEPEENGEVVKSFLATNPEFI-LEPAGRYLPVG 415

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                    E  +++ P         + G+DGFF   + R
Sbjct: 416 R-------QEEMVQLWPH--------ADGVDGFFIARMVR 440


>gi|75910625|ref|YP_324921.1| Fmu, rRNA SAM-dependent methyltransferase [Anabaena variabilis ATCC
           29413]
 gi|75704350|gb|ABA24026.1| Fmu, rRNA SAM-dependent methyltransferase [Anabaena variabilis ATCC
           29413]
          Length = 449

 Score =  284 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 120/461 (26%), Positives = 198/461 (42%), Gaps = 43/461 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            N+R ++   L  V  K       LD          LS  D+ LV  ++  ++R    +D
Sbjct: 2   TNSRQIAFIALRDV-HKGAYTDVALDRALQK---ANLSDIDRRLVTELLYGSVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D +      ++   L+ +L + + Q+ Y   +   A V+  VE AK D         
Sbjct: 58  FIIDQLAKKKSHQQPTELRSILHLGLYQLRYQERIPASAAVNTTVELAK-DNGFAGLTGF 116

Query: 124 VNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAISDACI 173
           VN +LR+  R        +            +   P+W  +      G      + +   
Sbjct: 117 VNGLLRQYIRLAEASPDFLELPENPVERLGILHSFPDWIIKVWLEQLGLTETEKLCEWMN 176

Query: 174 SPLYIDLTVKFDIETWAHKLNA----------VMLPTGGIRLKELPESIVSLPGFAEGVW 223
               +DL V     + A    A          +      +RL     SI  LPGF++G W
Sbjct: 177 QTPTLDLRVNPLRTSVAEVETALKSAGVLARPIPHLPQALRLIGNTGSIQKLPGFSQGWW 236

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQDASA +   L        ++D CAAPGGKT  +   +    KV A D +  RL KL+
Sbjct: 237 VVQDASAQLVSHLLDPQPGEVIIDACAAPGGKTTHIAELMKDQGKVWAGDRTASRLRKLK 296

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKK-LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
            N  RL+L++ +I   D+ +      + D VL+DAPCS  GT+ RH D  W +  + + +
Sbjct: 297 ENAQRLNLHSIEICTGDSRNLPQFYNVADRVLLDAPCSGLGTLHRHADARWRQTPESVQE 356

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            +  Q++LL     FVK GG++V++ C+L   ++EEV+ + +  +       P   +   
Sbjct: 357 LSTLQQELLSHTSKFVKVGGVLVYATCTLHPAENEEVITEFMARNSDWQIEPPSPDS--- 413

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
               +   +P+GW+++ P         +  MDGFF V LR+
Sbjct: 414 --PYSDYTTPQGWLKVWPH--------NQDMDGFFMVRLRK 444


>gi|288553113|ref|YP_003425048.1| rRNA SAM-dependent methyltransferase RmsB [Bacillus pseudofirmus
           OF4]
 gi|288544273|gb|ADC48156.1| rRNA SAM-dependent methyltransferase RmsB [Bacillus pseudofirmus
           OF4]
          Length = 448

 Score =  284 bits (725), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 118/462 (25%), Positives = 200/462 (43%), Gaps = 37/462 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R V+  +L  + + +     LL+     S    L +RD  L+  +V  T++  
Sbjct: 1   MSK--NVREVAVDVLLQIEKNQAYSNLLLNQTINKSK---LDRRDIGLLTELVYGTIQRR 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   +   + + +  ++ LLR+SV Q++YLD + D AVV  AV  AK+ + ++ 
Sbjct: 56  DTLDYFLAPFVKKGIDKLEDWVKVLLRLSVYQLVYLDRIPDRAVVHEAVTIAKK-RGHKG 114

Query: 120 FAKLVNSILRR-------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            + +VN +LR          + + + ++R+A  +  P+W   R    +G+E    + +  
Sbjct: 115 ISGMVNGVLRSIGREGVPDIKNEKDPIKRLALETSHPKWLVARWVKQFGEEDTRLMCEEN 174

Query: 173 ISPLYIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +    + + V     T    ++        AV        L      +     F +G   
Sbjct: 175 LVSPAVTVRVNQTKATREEVISMLEADGIAAVKGELSEDALIIKSGQVFESKAFKQGYVT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
            QD S+ +  +  G  +   V D+CAAPGGKT      + +   V A D+   +++ +R 
Sbjct: 235 AQDESSMLVGRALGANSGERVADVCAAPGGKTTHIAEQMNNEGSVLAFDLHDHKVKLIRG 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L   D    DA         + FD +LVDAPCS  G I+R PD+ W +   DI 
Sbjct: 295 QAARLDLSIIDTQAADARKLAEKFEPESFDRILVDAPCSGFGVIKRKPDIKWAKKEADIK 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
                Q+ +L      +K GG +V+S C++DK ++EE V+  L   P  V+   L +   
Sbjct: 355 AIQSIQQAILNAVAPLLKKGGTLVYSTCTVDKDENEETVEAFLAEHPSFVKDEDLKNRLP 414

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           K +  +      G + I P             DGFF  +L +
Sbjct: 415 KQVIDSKRF-KSGMVTILPQDF--------NSDGFFISSLVK 447


>gi|121602907|ref|YP_988410.1| putative ribosomal RNA small subunit methyltransferase B
           [Bartonella bacilliformis KC583]
 gi|120615084|gb|ABM45685.1| putative ribosomal RNA small subunit methyltransferase B
           [Bartonella bacilliformis KC583]
          Length = 456

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 196/453 (43%), Positives = 270/453 (59%), Gaps = 18/453 (3%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+  R V   LL  V+ K  SL+ L D E+G   +  LS RD++L RAI+   LR   +I
Sbjct: 8   GLAVRQVCVRLLGAVLDKHTSLSGLTDHEHGHPLYLKLSYRDRLLCRAILIAALRHRGQI 67

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
            A L   L   LP K ++LQ L  +S AQILYLD+ DYA +DLAV  AK D   R F+ L
Sbjct: 68  QAALSRFLTRPLPSKAFALQHLFHISAAQILYLDIPDYAAIDLAVRAAKIDPRTRCFSGL 127

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN+ILR  +R+ + L ++    + +P+WF + L + YG+E+   I         +DLTVK
Sbjct: 128 VNAILRNFARDAMVLKRQALTFNEVPDWFWQLLVSTYGEEKAQRILAMQSETPPLDLTVK 187

Query: 184 FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
            D E WA +L  V+L  G +RLK L  S+V LPG+AEG WWVQD +A++P +  G ++  
Sbjct: 188 SDSEGWAKRLGGVVLSNGSVRLKALESSVVDLPGYAEGAWWVQDVAAALPARFLGDIHGK 247

Query: 244 SVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCP 303
            V DLCA+PGGKTAQL + GA VTA+D+S  RL++L  N+ RL+         D  ++ P
Sbjct: 248 RVADLCASPGGKTAQLALQGADVTAVDLSANRLKRLTANMHRLNFS-VSYWNGDVRNFHP 306

Query: 304 KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVF 363
           +KLFDAVL+DAPCSS GTIRRHPD+LW +  +DI+K A  Q  LLL  I+ VK GG +VF
Sbjct: 307 EKLFDAVLLDAPCSSLGTIRRHPDILWIKSREDIMKLAAVQYDLLLAAIAVVKKGGHIVF 366

Query: 364 SNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKI 423
           SNCSL +++ E++++KVL +    V L P+     +  DM   L+ EG +R TP      
Sbjct: 367 SNCSLAREEGEDLIEKVLATR-DDVVLEPI--LENELGDMKHVLTVEGIVRTTPADFCGS 423

Query: 424 DGVSS--------------GMDGFFAVALRRLI 442
              +               GMDGF+A  LR++ 
Sbjct: 424 VEFADFKSENFYAENKLLFGMDGFYAARLRKIA 456


>gi|52785554|ref|YP_091383.1| YloM [Bacillus licheniformis ATCC 14580]
 gi|163119428|ref|YP_078968.2| rRNA SAM-dependent methyltransferase RmsB [Bacillus licheniformis
           ATCC 14580]
 gi|52348056|gb|AAU40690.1| YloM [Bacillus licheniformis ATCC 14580]
 gi|145902935|gb|AAU23330.2| rRNA SAM-dependent methyltransferase RmsB [Bacillus licheniformis
           ATCC 14580]
          Length = 448

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 126/463 (27%), Positives = 208/463 (44%), Gaps = 40/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R V+   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKN--NVREVALDALIKLDQNQAYSNLLLQSAMKAN---DLSDKDRGLLTELVYGTLQNK 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  +  LLR+S+ Q+ YL+ + D A +  AVE AKR + ++ 
Sbjct: 56  LALDYMLKPFIKKP-EKVKDWVIHLLRMSLYQMEYLEKIPDRAALFEAVEIAKR-RGHKG 113

Query: 120 FAKLVNSILRRVSREKIELLQRIAG-------ISIIPEWFKERLENFYGKERVLAISDAC 172
            +  VN +LR V RE +     IA         +  PEW      + YG E    I    
Sbjct: 114 ISSFVNGVLRSVQREGVPSFADIADPIERLAVETSHPEWLVREWTDAYGFEAAEQICRIH 173

Query: 173 ISPLYIDLTVK---FDIETWAHKLNAVMLPTGGIRLKE-----LPESIVSLPGFAEGVWW 224
           + P    + V     D +T   +LN   +      L +     L  +I S P F EG   
Sbjct: 174 MIPPKQTIRVNRLKNDRDTLLSRLNEAGIEAEEGDLSKDAVKLLKGTIASTPFFKEGEVT 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV---SGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +  G     +VLD CAAPGGK+  +        KV +LD+ + +++ ++ 
Sbjct: 234 IQDESSMLVARALGPERGETVLDACAAPGGKSTHIGELLEDTGKVVSLDLHQHKVKLIKE 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              R+ L   +   +DA         + FD +LVDAPCS  G IRR PD+ +++  +D  
Sbjct: 294 AAGRIGLSNIEARALDARKAGEVFEPEQFDRILVDAPCSGFGVIRRKPDLKYSKTPEDSA 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q  +L +    +K GG +V+S C++D  ++E+V+   L       E     +   
Sbjct: 354 RLAGIQLAILNEIAPLLKTGGTLVYSTCTMDPTENEQVMHAFLEEHD---EFEADPTLAE 410

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  + A     +G I+I P           G DGFF  ++R+ 
Sbjct: 411 RLPEKAAPYVKDGSIQILPHYF--------GTDGFFICSMRKK 445


>gi|322384328|ref|ZP_08058026.1| RNA-binding Sun-like protein/16S rRNA
           adenosyl-L-methionine-dependent methyltransferase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
 gi|321150830|gb|EFX44267.1| RNA-binding Sun-like protein/16S rRNA
           adenosyl-L-methionine-dependent methyltransferase-like
           protein [Paenibacillus larvae subsp. larvae B-3650]
          Length = 461

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 121/459 (26%), Positives = 210/459 (45%), Gaps = 38/459 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR  +  +L  V ++      +L+          LS++D  L   IV  T++ L  ID  
Sbjct: 16  AREAALQVLLEVEKEHAYSNLMLNKVLRH---ADLSRQDAGLATEIVYGTIQRLNTIDCF 72

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L   +   L + +  ++ LLR+S  Q+ YLD + D+A V+ AV+ AK+ + ++  + +VN
Sbjct: 73  LARFVKKRLDKLEPWVKCLLRLSFYQLYYLDRIPDHAAVNEAVKIAKK-RGHQGISGMVN 131

Query: 126 SILRRVSREKIE--------LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +LR V R+K +         ++RIA     P+W   R    YG+E+   +  A      
Sbjct: 132 GVLRNVIRQKGDLLLPADLSPIRRIALEQSHPDWLVRRWVEQYGEEKTAEMCLANNKAPK 191

Query: 178 IDLT---VKFDIETWAHKLNAVMLPTG------GIRLKELPESIVSLPGFAEGVWWVQDA 228
           I +    +K   E    +L    +            +     ++     +A G + +QD 
Sbjct: 192 ISIRNNILKHCREELIERLLDEGIQAEASFLAPQGIIITGGGNMALTKEYANGDYSIQDE 251

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +L      + VLD CAAPGGKT      + +   V A D+ + + + ++   +R
Sbjct: 252 SSMLVAELVDPKEGMIVLDCCAAPGGKTTHLAEKMNNKGIVKAFDLYEHKEQLIQEQAER 311

Query: 286 LHLYAEDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L + +    DA     +     FD +L+DAPCS  G IRR PD+ W +   DI +   
Sbjct: 312 LQLTSVETAVADARKLGERFNRETFDRILLDAPCSGLGVIRRKPDLKWMKKEQDIEEIRK 371

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+ LL      +KPGGI+V+S C+++  ++E+ V + L   P  + ++     +    +
Sbjct: 372 VQQDLLCAVPGLLKPGGILVYSTCTVEIAENEDQVNRFLEKHPDFIPVLEPVPGWPP--E 429

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           + + L   G ++I P   +         DGFF V LR+ 
Sbjct: 430 LNVQLMNRGMVQIFPQDYQS--------DGFFMVRLRKK 460


>gi|240851336|ref|YP_002972739.1| SUN-family protein [Bartonella grahamii as4aup]
 gi|240268459|gb|ACS52047.1| SUN-family protein [Bartonella grahamii as4aup]
          Length = 454

 Score =  283 bits (724), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 198/445 (44%), Positives = 273/445 (61%), Gaps = 10/445 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ K   L+ L D E+G   +  LSQRD++L RAI+  +LR   +
Sbjct: 15  PGLAVRQVCVRLLGAVVDKHTPLSGLTDNEHGHPQYLKLSQRDRLLCRAILTASLRHRGQ 74

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I A L  +L   LP +  SLQ LL +SVAQILYLD+ D+A +DLAV  AK D   R F+ 
Sbjct: 75  ITAALSRLLARPLPSQALSLQHLLHISVAQILYLDIPDHAAIDLAVRVAKLDPRMRRFSG 134

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           +VN++LR ++RE + L Q+I  I  +P WF + L + YG E+   I          DLTV
Sbjct: 135 VVNALLRNIAREAVSLRQQIPSIEGVPAWFGQLLMSAYGTEKAHQIIAIQSVEPPFDLTV 194

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  ++LP G +RL  L  S+  LPG++EG WWVQD +A++P  L GTL  
Sbjct: 195 KSDSVGWAERLGGLVLPNGSVRLNRLECSVSDLPGYSEGTWWVQDFAAALPACLLGTLRG 254

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL + GA+VTA+++S  R+++L+ N++RLH     I + D  ++ 
Sbjct: 255 KRVADLCASPGGKTAQLALQGAQVTAIELSANRVKRLKENMERLHFS-VHIWQGDVRNFH 313

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P +LFDAVL+DAPCSSTGTIRRHPD+LWT+  DDIVK A  Q  LL+  IS VK GG +V
Sbjct: 314 PTQLFDAVLLDAPCSSTGTIRRHPDILWTKSRDDIVKLAALQHDLLVAAISLVKVGGRIV 373

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           FSNCSL +++ E++++K+L +    V    L   Y + +     L   G +R TP     
Sbjct: 374 FSNCSLAREEGEDLIEKILSTRNDIV----LEPIYPEEMGALAHLLCGGMLRTTPADFCH 429

Query: 423 IDGVSS-----GMDGFFAVALRRLI 442
            +  +      GMDGFFA  LR++ 
Sbjct: 430 KNFDAEKTAFLGMDGFFAARLRKIA 454


>gi|56419708|ref|YP_147026.1| RNA-binding Sun protein [Geobacillus kaustophilus HTA426]
 gi|56379550|dbj|BAD75458.1| RNA-binding Sun protein [Geobacillus kaustophilus HTA426]
          Length = 444

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 119/460 (25%), Positives = 197/460 (42%), Gaps = 38/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R ++   L  + +K       L+          L  RD  L+  IV  T++    +D
Sbjct: 1   MNVRELALDTLLAIEQKGAYSHLQLNEAIQKGR---LDGRDAALLTEIVYGTVQRRDTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
             L   L     R +  ++ LLR+++ Q++YLD V D A V  AVE AKR + +R  A L
Sbjct: 58  YYLAPFL-RKARRLEPWVRVLLRLTLYQMVYLDRVPDRAAVFEAVEIAKR-RGHRGIASL 115

Query: 124 VNSILRRVSREKIELL-------QRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR + RE +  +       +R+A  +  PEW   R    YG E    + +  + P 
Sbjct: 116 VNGVLRAIGREGLPSIEAVDDAGKRLALATSHPEWLVRRWIQQYGYEEAARMCETNLRPP 175

Query: 177 YIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                V     T    L         A+        ++    ++     F  G   +QD 
Sbjct: 176 QSTARVNRLRATVEEALERLRAEGMQAIPGHVAPEAIRAEKGNLAHTETFRAGWLTIQDE 235

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +         VLD CAAPGGKT      +    +V A+D+ +R++  +     R
Sbjct: 236 SSMLVARALDPAPGERVLDCCAAPGGKTTHIAERMDGRGEVVAVDIHERKVMMIEQQAKR 295

Query: 286 LHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L     + +D+         + FD VLVDAPC+  G IRR P++ +T+  D I     
Sbjct: 296 LGLDNVATLALDSRRLGERFAPESFDRVLVDAPCTGFGVIRRKPEIKYTKGKDAIAALVE 355

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+ +L      +K GG +V+S C+++++++EE + + L   P       L     + + 
Sbjct: 356 IQQAILRAAAPLLKKGGTLVYSTCTVEREENEEAIARFLADHPDFFLDASLAERMPEPVR 415

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
             +     G +++ P   +         DGFF   LR+ +
Sbjct: 416 PHV---KGGMLQLLPHHFDS--------DGFFIARLRKKV 444


>gi|197119890|ref|YP_002140317.1| 16S rRNA (5-methyl-C967)-methyltransferase [Geobacter bemidjiensis
           Bem]
 gi|197089250|gb|ACH40521.1| 16S rRNA (5-methyl-C967)-methyltransferase [Geobacter bemidjiensis
           Bem]
          Length = 448

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 112/466 (24%), Positives = 190/466 (40%), Gaps = 43/466 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M S  N R  +  +L  + +++     L+D E       ++   D+ L+  +V   LR  
Sbjct: 1   MSSK-NPRRAAFDILLRIEKEKSFADILIDHELSK---DIIKGADRGLLTELVYGVLRRQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D ++         + +  ++ LLR+ + Q  +LD V   A V+  V  AK       
Sbjct: 57  GTLDYIISQFSKQRPEKLELFVRLLLRLGIYQCFFLDRVPVSAAVNETVNLAKE--LAPR 114

Query: 120 FAKLVNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
            +  +N++LR                   + +A     P W  ++  +  G E    ++ 
Sbjct: 115 ASGFINAVLRNADRGRDTIAYPDRAERPAEYLAARYSHPAWLAQQWCDQLGLEAAEELAA 174

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEG 221
           A   P  + + V       E    +L    +                   I  LP F +G
Sbjct: 175 AMSEPPPLTVRVNTLRITREELIQRLAGEGVSCSATSWSPDGIRLNQSGQITRLPSFRDG 234

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
           ++ VQD S+ +            VLD CAAPGGKT Q+   +    ++ A DV+ ++L  
Sbjct: 235 LFTVQDESSQLAPLFLAPGKGERVLDACAAPGGKTTQIAQLMQDSGEIYACDVNNKKLRL 294

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYC---PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           ++   DRL + +     MDA        +  F  +LVDAPCS  G IRR+P+  W++  D
Sbjct: 295 IKETCDRLGINSVRTFTMDATAPSNAIKETTFHRILVDAPCSGLGVIRRNPEGKWSKSGD 354

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D+++ A  Q  +L     +++P G ++++ CS   Q++E VV   L   P  V    +  
Sbjct: 355 DLLQLARTQVSILENLCRYLEPKGTILYATCSTSVQENEYVVDSFLAQHPEFV----VED 410

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                   A   +  G+ R  P           GMDGFF+  L+R 
Sbjct: 411 LRPLFPQYAPLFTERGFFRSWPH--------RDGMDGFFSARLKRK 448


>gi|138894694|ref|YP_001125147.1| 16S rRNA m(5)C 967 methyltransferase [Geobacillus
           thermodenitrificans NG80-2]
 gi|196247686|ref|ZP_03146388.1| sun protein [Geobacillus sp. G11MC16]
 gi|134266207|gb|ABO66402.1| 16S rRNA m(5)C 967 methyltransferase [Geobacillus
           thermodenitrificans NG80-2]
 gi|196212470|gb|EDY07227.1| sun protein [Geobacillus sp. G11MC16]
          Length = 444

 Score =  283 bits (723), Expect = 4e-74,   Method: Composition-based stats.
 Identities = 118/459 (25%), Positives = 196/459 (42%), Gaps = 38/459 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R ++   L  + +K       L+          L  RD  L+  IV  T++    +D
Sbjct: 1   MNVRELALDTLLAIEQKGAYSHLQLNNAIQKGR---LDGRDAALLTEIVYGTIQRRDTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
             L   L     R +  ++ LLR+++ Q++YLD V D+A +  AVE AKR + +R  A L
Sbjct: 58  YYLTPFL-RKARRLEQWVRVLLRLTLYQMVYLDRVPDHAAIFEAVEIAKR-RGHRGIASL 115

Query: 124 VNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR + RE         +  +R+A  +  PEW   R    YG E    + +  + P 
Sbjct: 116 VNGVLRTIGREGLPSLDAINDSAKRLAVATSHPEWLVRRWIEQYGPEETARMCETNLRPP 175

Query: 177 YIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                V     T    L         AV        ++    +      F  G   +QD 
Sbjct: 176 QSTARVNRMRATVEEALERLGSEGVKAVRGLLAPEAIRAENGNFAHTEAFHSGWLTIQDE 235

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +         VLD CAAPGGKT      +    +V A+D+ + +++ +     R
Sbjct: 236 SSMLVARALDPAAGERVLDCCAAPGGKTTHIAERMDGRGEVVAVDIHEHKVKLIEQQAQR 295

Query: 286 LHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L     + +D+     +   + FD +LVDAPC+  G IRR P++ +T+  DD+     
Sbjct: 296 LGLDNIRTLALDSRRLGEWFAPESFDRILVDAPCTGFGVIRRKPEIKYTKGNDDVAALVE 355

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+ +L      +K GG +V+S C+++++++EE + + L   P       L        D
Sbjct: 356 IQQAILRAAAPLLKKGGTLVYSTCTIEREENEEAIARFLADHPDFSLDDRLVERLP---D 412

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                  +G +++ P   +         DGFF   LR+ 
Sbjct: 413 AVRPYVQKGMLQLLPHYFDS--------DGFFIARLRKK 443


>gi|255657701|ref|ZP_05403110.1| ribosomal RNA small subunit methyltransferase B [Mitsuokella
           multacida DSM 20544]
 gi|260849889|gb|EEX69896.1| ribosomal RNA small subunit methyltransferase B [Mitsuokella
           multacida DSM 20544]
          Length = 452

 Score =  283 bits (723), Expect = 5e-74,   Method: Composition-based stats.
 Identities = 103/462 (22%), Positives = 185/462 (40%), Gaps = 41/462 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
            AR  +  +L  V          L           L ++D+  V  +V   ++    +D 
Sbjct: 3   KARETAVRILYEVHENGAYANVALAKALR---QLDLGEQDRRFVTELVYGAVKAGGTLDW 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L   +   + + +  ++++LR+ + QI YLD V   A  + AV+ AK     +  +  V
Sbjct: 60  ILRRYVSRPVRKIQPFVREILRLGLYQIFYLDKVPASAACNTAVDLAKGM-GVKGLSGFV 118

Query: 125 NSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR              K    + +A  S  PEW        +G E    +       
Sbjct: 119 NAVLRTAVREPEKAAFPSGKGHATENLALRSQHPEWLVRHWVRTFGFEAAEKLCAFDNEQ 178

Query: 176 LYIDLTVKFDIETWAHKLNAVM---------LPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
             + +            L  +                 L     ++ +L    EG   VQ
Sbjct: 179 PVLSVRANTLRTDREALLAELAAAGAEAEPSQWAPEGILVRHHGALDALAPLQEGRCQVQ 238

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ +   + G      ++D CAAPGGKT  +   +    ++ A D+   +L+++  N 
Sbjct: 239 DESSMLVAHVVGPQPGEFIIDCCAAPGGKTTHMAALMHDEGRILAGDIYSHKLQRIEENA 298

Query: 284 DRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
            RL + + +  E+DA +   +   + D VLVDAPCS  G +RR PD  W +   +I    
Sbjct: 299 ARLGIQSIETEEIDAREIGEQYEAMADRVLVDAPCSGLGVLRRKPDARWRKTQQEIAALP 358

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L      VKPGG++V+S C+++  +++ VV + L   P   EL          +
Sbjct: 359 DLQLAILESAARAVKPGGVLVYSTCTIELAENQGVVSRFLEQHP-EFELE----TTGHYL 413

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
            +    +    +++ P +         G DGFF   ++++ Q
Sbjct: 414 PLPTKHAESKMVQLLPHI--------DGTDGFFICRMKKMDQ 447


>gi|150390542|ref|YP_001320591.1| sun protein [Alkaliphilus metalliredigens QYMF]
 gi|149950404|gb|ABR48932.1| sun protein [Alkaliphilus metalliredigens QYMF]
          Length = 444

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 200/461 (43%), Gaps = 41/461 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M AR  +  +L  +  +       L+ ++        +  D+  V  +V   +  L  ID
Sbjct: 1   MKARESALKVLYAITEQEAYSNIALNQQFRAETH---TPVDKAFVTELVYGVVENLIWID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            V+D    +   +       LLR+++ QI +LD V  +A V+ +V+ +K+  ++      
Sbjct: 58  YVIDQFSTTKTIKMNPWTLSLLRLAIYQIFFLDRVPVFAAVNESVDLSKKYCKHTTA--F 115

Query: 124 VNSILRRVSREKIELL---------QRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           +N +LR + R+K  +          Q ++     P+W  ++    +  E   ++  A   
Sbjct: 116 INGVLRNILRKKEIIRLPDKSRDLLQYLSVKYSHPKWLVQQFMAQFDDEFTESLLKANNE 175

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWV 225
              + + V      IE     L    +              +   +I  L  + +G  ++
Sbjct: 176 RPDLYVRVNTLKISIEDCITALREKGITVEQSPYIEEALKVKGIHTIEKLDLYLKGQIYI 235

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD S+ +  ++        ++D+C+APGGK   L   + +  +V A DV + +L+ ++ N
Sbjct: 236 QDFSSMLVARIMDPHPGALIMDVCSAPGGKATHLAQLMGNQGEVVARDVHEHKLKLIKEN 295

Query: 283 LDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
           + RL +        DA +  P      D VL+DAPCS  G IRR P++ + +  +DI + 
Sbjct: 296 VKRLGVKIIKTEVFDAKELDPTMLQRADGVLIDAPCSGLGIIRRKPEIKYRKKQEDIKEL 355

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L  G  +VKPGG +V+S C++D +++  V+++ L+ +    EL  +N  Y   
Sbjct: 356 QQLQIEILNHGAEYVKPGGTLVYSTCTIDPRENHHVIKQFLKEN-NEFELEDINEKYKAL 414

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +        E  +++ P +           DGFF   L + 
Sbjct: 415 LP---GQHSEQMVQLYPHV--------HHTDGFFIAKLIKK 444


>gi|326203177|ref|ZP_08193043.1| sun protein [Clostridium papyrosolvens DSM 2782]
 gi|325986823|gb|EGD47653.1| sun protein [Clostridium papyrosolvens DSM 2782]
          Length = 467

 Score =  282 bits (722), Expect = 6e-74,   Method: Composition-based stats.
 Identities = 104/457 (22%), Positives = 203/457 (44%), Gaps = 38/457 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR  +  +L  +   +      ++    +   R +   D+     +V  T+++L +ID +
Sbjct: 24  ARETALKILYDITENQAYSNISVNRHLDNDKLREI---DRSFATELVYGTVKWLLQIDYI 80

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +       L +    ++ +LR+ V Q+L+ D +   A  + AVE AKR   ++  ++ VN
Sbjct: 81  IGKYSSVKLKKLSPWIKNVLRLGVYQLLHTDRIPVSAACNTAVELAKRY-GHQASSRFVN 139

Query: 126 SILRRVSREKIELLQRI--------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           ++LR +S+    +            +     P W  ++    YGKE    +  +      
Sbjct: 140 AVLRNISKNIDNIPYPDKSDIASYLSIFYSHPVWMVQKWIELYGKEFTEELLKSNNQVPD 199

Query: 178 IDLTVK---FDIETWAHKLNAV------MLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
             +       D +T    L+                + + P SI +L  F +G + VQD 
Sbjct: 200 FIIRTNTLKTDRQTLLDLLHKEGINAEPGRYIEEAVILKNPSSISNLETFKKGYFQVQDE 259

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  ++       +V+D+C+APGGK      ++ +   V A D+ + +L  +  +  R
Sbjct: 260 SSMLAGKILDPKEGETVIDVCSAPGGKATHIAQIMNNNGTVLARDIYEHKLNLIEQSCRR 319

Query: 286 LHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +        DA D         D VL+DAPCS  G IR+ PD+ ++R  +++ +    
Sbjct: 320 LGIDIIKTEIHDACDIDENLIGKADRVLIDAPCSGLGIIRKKPDIKYSRTENELKEITDL 379

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+K+L     ++K GG +++S C++  Q++ E+VQ  L  +    +L         ++D+
Sbjct: 380 QQKILNIAARYLKVGGYLIYSTCTIQPQENLEIVQDFLAKN-AGFKLSGFRELMPSALDI 438

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +   S EG+I++ P++ +         DGFF   ++R
Sbjct: 439 SS--SEEGYIQLYPNINQ--------TDGFFISKIKR 465


>gi|297530652|ref|YP_003671927.1| sun protein [Geobacillus sp. C56-T3]
 gi|297253904|gb|ADI27350.1| sun protein [Geobacillus sp. C56-T3]
          Length = 444

 Score =  282 bits (722), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 119/460 (25%), Positives = 196/460 (42%), Gaps = 38/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R ++   L  + +K       L+          L  RD  L+  IV  T++    +D
Sbjct: 1   MNVRELALDTLLAIEQKGAYSHLQLNEAIQKGR---LDGRDAALLTEIVYGTVQRRDTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
             L   L     R +  ++ LLR+++ Q++YLD V D A V  AVE AKR + +R  A L
Sbjct: 58  YYLAPFL-RKARRLEPWVRVLLRLTLYQMVYLDRVPDRAAVFEAVEIAKR-RGHRGIASL 115

Query: 124 VNSILRRVSREKIELL-------QRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR + RE +  +       +R+A  +  PEW   R    YG E    + +  + P 
Sbjct: 116 VNGVLRAIGREGLPSIEAVDDAGKRLALATSHPEWLVRRWIQQYGYEEAARMCETNLRPP 175

Query: 177 YIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                V     T    L         A+        ++    ++     F  G   +QD 
Sbjct: 176 QSTARVNRLRATVEEALERLRAEGMQAIPGHVAPEAIRAEKGNLAHTETFRAGWLTIQDE 235

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +         VLD CAAPGGKT      +    +V A+D+ + ++  +     R
Sbjct: 236 SSMLVARALDPAPGERVLDCCAAPGGKTTHIAERMDGRGEVVAVDIHEHKVMLIEQQAKR 295

Query: 286 LHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L     + +D+         + FD VLVDAPC+  G IRR P++ +T+  D I     
Sbjct: 296 LGLDNVATLALDSRRLGERFAPESFDRVLVDAPCTGFGVIRRKPEIKYTKGKDAIAALVE 355

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+ +L      +K GG +V+S C+++++++EE + + L   P       L     K + 
Sbjct: 356 IQQAILRAAAPLLKKGGTLVYSTCTVEREENEEAIARFLADHPDFFLDASLAERMPKPVR 415

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
             +     G +++ P   +         DGFF   LR+ +
Sbjct: 416 PHV---KGGMLQLLPHHFDS--------DGFFIARLRKRV 444


>gi|218899018|ref|YP_002447429.1| sun protein [Bacillus cereus G9842]
 gi|218546015|gb|ACK98409.1| sun protein [Bacillus cereus G9842]
          Length = 444

 Score =  282 bits (721), Expect = 7e-74,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     SA   + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A     P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIAMSHPVWLVQEWTSAYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKVTVEEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +        +VLD CAAPGGKT  +        KV +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPNEGETVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFSNETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+ K L+  P   E     +   +  
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIDKFLKEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYINEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|255525650|ref|ZP_05392583.1| sun protein [Clostridium carboxidivorans P7]
 gi|296185410|ref|ZP_06853820.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           carboxidivorans P7]
 gi|255510636|gb|EET86943.1| sun protein [Clostridium carboxidivorans P7]
 gi|296050244|gb|EFG89668.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           carboxidivorans P7]
          Length = 442

 Score =  282 bits (721), Expect = 8e-74,   Method: Composition-based stats.
 Identities = 118/456 (25%), Positives = 200/456 (43%), Gaps = 41/456 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR  +  +L  V         ++  E   S    ++ +D+ LV  IV  TL++   ID +
Sbjct: 4   ARKTAVKILKEVFYGNSYSNMVIGKELNRS---DMNDKDKALVTEIVYGTLKYKYTIDTI 60

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L++ + S L +    +  +LR+S+ QI YLD + ++AVV+ AVE AKR  +    A+LVN
Sbjct: 61  LNYYIKSGLKKLDVDILNILRISIYQIRYLDKIPEFAVVNEAVELAKR--KAVKTARLVN 118

Query: 126 SILRRVSREKIELLQR-------IAGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
            +LR   R               +      P+W      N YGKE    I         I
Sbjct: 119 GVLRSYLRSNNIDYYNKNSDIEKMCFDYSFPKWMVSLFSNQYGKEETKKILQGLNEVPAI 178

Query: 179 DLTVKFDIETWAHKLNA---------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
            + V      +                        +     +I + P F  G+  VQD S
Sbjct: 179 TVRVNNLKTNYEEAWEELKKNGYDIEEGKVCPEAIIINRGRNIENNPLFKNGLITVQDES 238

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           A +         N++VLDLC+APGGKT  +     +  K+ A D+ + +L  ++ N  RL
Sbjct: 239 AMMVAPSMELKENMTVLDLCSAPGGKTCHIAELTNNQGKIFAFDIHENKLPLIKENAKRL 298

Query: 287 HLYAEDIIEMD--AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
            +       +D   +    ++  D VL+D PCS  G IR+ P++ W +D + +      Q
Sbjct: 299 GITNVKCGTLDASKYMDIYEEKGDRVLIDVPCSGLGIIRKKPEIKWNKDKESLESLVKIQ 358

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           + ++L    +VK  G ++++ C+L+K+++EE ++  ++  P   ++ P+      +I   
Sbjct: 359 KTIMLNAAKYVKKNGKLIYATCTLNKEENEENIKWFIKKRP-DFQIEPIYYGKLDNI--- 414

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                EG+I I P+           MDGFF   + R
Sbjct: 415 -IYHDEGYITILPNKY---------MDGFFIAKMIR 440


>gi|254415201|ref|ZP_05028963.1| ribosomal RNA small subunit methyltransferase B [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178007|gb|EDX73009.1| ribosomal RNA small subunit methyltransferase B [Microcoleus
           chthonoplastes PCC 7420]
          Length = 448

 Score =  282 bits (720), Expect = 9e-74,   Method: Composition-based stats.
 Identities = 125/461 (27%), Positives = 204/461 (44%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++   L  +          LD     +    L++ D+ L+  +V  T R    +DA
Sbjct: 3   NPRQLAFLALRDIHSHGAFTDIALDRVLRHT---TLNRPDRALLTDLVYGTTRHTRTLDA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D +      ++   L+ +L + + Q+ YL  +   A V+ +VE AK ++  +  A +V
Sbjct: 60  LIDQLGKKKAHQQPPDLRLILHLGLYQLRYLQRIPPSAAVNTSVELAKANQL-KGLAGVV 118

Query: 125 NSILRRVSREKIELLQRIA------------GISIIPEWFKERLENFYGKERVLAISDAC 172
           N +LR+ +R                       +   P+W  E   N  G E   A+    
Sbjct: 119 NGVLRQYARLNTNPQLDDPLQLPPQPIQRLGILYSFPDWIIELWLNQLGIEETEALCQWF 178

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFAEGV 222
             P  IDL +      I+T    + A              +R +    SI +LPGF EG 
Sbjct: 179 NQPPTIDLRINPLNASIDTVETAMQAAGIQVQRLPHLPQALRFQGSTGSIQTLPGFNEGW 238

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKL 279
           W +QD+SA +   L     +  ++D CAAPGGKT  L   +     + A D +  RL+K+
Sbjct: 239 WTIQDSSAQLVSHLLNPQPHDVIIDACAAPGGKTTHLAELMRDRGTIWACDKAASRLKKV 298

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPK-KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           + N  RL L +  I   D+ D+    +  D VL+DAPCS  GT+ R PD+ W      + 
Sbjct: 299 KANTQRLQLQSIQICPGDSRDFPQFTQKADTVLLDAPCSGLGTLHRRPDIRWRCTPARVQ 358

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + +  Q +LL Q  ++VKPGG++V++ C+L  Q++E V+Q  L          P      
Sbjct: 359 ELSVLQSELLTQTATWVKPGGVLVYATCTLHPQENEAVIQAFLERHLHWCIDAP------ 412

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
               +    +P+GW+++ P            MDGFF V L+
Sbjct: 413 -PPTLTAFSTPQGWLKVLPH--------QHQMDGFFMVRLK 444


>gi|261419371|ref|YP_003253053.1| sun protein [Geobacillus sp. Y412MC61]
 gi|319766186|ref|YP_004131687.1| sun protein [Geobacillus sp. Y412MC52]
 gi|261375828|gb|ACX78571.1| sun protein [Geobacillus sp. Y412MC61]
 gi|317111052|gb|ADU93544.1| sun protein [Geobacillus sp. Y412MC52]
          Length = 444

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 118/460 (25%), Positives = 194/460 (42%), Gaps = 38/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R ++   L  + +K       L+          L  RD  L+  IV  T++    +D
Sbjct: 1   MNVRELALDTLLAIEQKGAYSHLQLNEAIQKGR---LDGRDAALLTEIVYGTVQRRDTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
             L   L     R +  ++ LLR+++ Q++YLD V D A V  AVE AKR + +R  A L
Sbjct: 58  YYLAPFL-RKARRLEPWVRVLLRLTLYQMVYLDRVPDRAAVFEAVEIAKR-RGHRGIASL 115

Query: 124 VNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR + RE         +  +R+A  +  PEW   R    YG E    + +  + P 
Sbjct: 116 VNGVLRAIGREGLPSIEAVDDAGKRLALATSHPEWLVRRWIQQYGYEEAARMCETNLRPP 175

Query: 177 YIDLTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
                V     T    L          +        ++    ++     F  G   +QD 
Sbjct: 176 QSTARVNRLRATVEEALERLRAEGMQVIPGHVAPEAIRAEKGNLAHTETFRAGWLTIQDE 235

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +         VLD CAAPGGKT      +    +V A+D+ + ++  +     R
Sbjct: 236 SSMLVARALDPAPGERVLDCCAAPGGKTTHIAERMDGRGEVVAVDIHEHKVMLIEQQAKR 295

Query: 286 LHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L     + +D+         + FD VLVDAPC+  G IRR P++ +T+  D I     
Sbjct: 296 LGLDNVATLSLDSRRLGERFAPESFDRVLVDAPCTGFGVIRRKPEIKYTKGKDAIAALVE 355

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+ +L      +K GG +V+S C+++++++EE + + L   P       L     K + 
Sbjct: 356 IQQAILRAAAPLLKKGGTLVYSTCTVEREENEEAIARFLADHPDFFLDASLAERMPKPVR 415

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
             +     G +++ P   +         DGFF   LR+ +
Sbjct: 416 PHV---KGGMLQLLPHHFDS--------DGFFIARLRKRV 444


>gi|308173537|ref|YP_003920242.1| RNA-binding protein [Bacillus amyloliquefaciens DSM 7]
 gi|307606401|emb|CBI42772.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus
           amyloliquefaciens DSM 7]
 gi|328553530|gb|AEB24022.1| 16S rRNA methyltransferase B [Bacillus amyloliquefaciens TA208]
 gi|328911678|gb|AEB63274.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus
           amyloliquefaciens LL3]
          Length = 447

 Score =  282 bits (720), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 131/463 (28%), Positives = 211/463 (45%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R ++   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKK-INVRELALEALEKLEQNQAYSNLLLTSVIKTN---TLSDQDRGLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S  Q+ YL+ + D A +  AVE AK+ + ++ 
Sbjct: 57  IALDYMLKPFIRKP-NKVKPWVIQLLRLSAYQMEYLEKIPDRAAIHEAVEIAKK-RGHKG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN ILR + RE       I       +  +  PEW  +     YG E    I    
Sbjct: 115 IASFVNGILRSLQREGAPSFAEIEDPVLRLSTETSHPEWLVKEWVEAYGFETAEKICRIH 174

Query: 173 ISPLYIDLTVK---FDIETWAHK-----LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P    L V     D ET  ++     L A         +K L  SI S   F  G   
Sbjct: 175 LVPPKQTLRVNRIKADKETLLNEMENAGLEAEAGDLSPDAIKLLKGSIASTEFFQNGQVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +        +VLD CAAPGGK+A +   + +   +T+LD+ + +++ ++ 
Sbjct: 235 IQDESSMLVARALDPKPGETVLDACAAPGGKSAHIAELMKNEGSLTSLDLHRHKVKLIQE 294

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             +RL L   D   MDA           FD +LVDAPCS  G IRR PD+ +T+  +D  
Sbjct: 295 GAERLGLTIIDAQTMDARKAGDAFGAERFDRILVDAPCSGFGVIRRKPDMKYTKTPEDSR 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + +  Q  +L +    VK GG +V+S C++D+ ++EEV+   ++  P   E  P  S   
Sbjct: 355 RLSEIQLGILREIAPLVKKGGTLVYSTCTMDRTENEEVMHAFIQEHP---EFEPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  + A     +G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKARPFVQDGSLQILPHYF--------GTDGFFISSMRKK 446


>gi|157692254|ref|YP_001486716.1| rRNA SAM-dependent methyltransferase RmsB [Bacillus pumilus
           SAFR-032]
 gi|157681012|gb|ABV62156.1| rRNA SAM-dependent methyltransferase RmsB [Bacillus pumilus
           SAFR-032]
          Length = 447

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 208/463 (44%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R V+   L  + + +     LL     D   + L+ +D+ L+  +V  TL+  
Sbjct: 1   MKKS-NVREVALDALIKLEQNQAYSNLLLQSVMKD---KDLADQDKPLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     +    + QLLR+S+ Q++YL+ + D A +  AVE  K+ + ++ 
Sbjct: 57  LALDYMLAPFVKKP-QKVAPWVMQLLRMSLYQMVYLEKIPDRAAIHEAVELTKK-RGHKG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            + LVN +LR V RE +     I       +  +  P W  +     YG E   ++    
Sbjct: 115 ISSLVNGVLRSVQREGVPAFDDIKDPVKRLSIETSHPLWLVQEWVQSYGFEATESMCRIH 174

Query: 173 ISPLYIDLTVK---FDIETWAHKLNAVMLPTG-----GIRLKELPESIVSLPGFAEGVWW 224
           + P    L V     D      KL    + T         LK +  SIVS P F EG   
Sbjct: 175 LVPPKQTLRVNRIKTDRAALKQKLLDAGIETELGDLSEDALKLMKGSIVSTPSFQEGYVT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +        +VLD CAAPGGK+      +    ++ +LD+ + +++ ++ 
Sbjct: 235 IQDESSMLVARALDPQPGETVLDACAAPGGKSTHIAERMNDEGQIVSLDLHEHKVKLIKQ 294

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL+L   +   +DA           FD +L+DAPCS  G IRR PD+ +T+  +D  
Sbjct: 295 AAKRLNLTQIEAKALDARKAKDDYSEASFDRILIDAPCSGFGVIRRKPDMKYTKSPEDSA 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q+ +L +    +KPGG +V+S C++D  ++++V+   L+         P  S   
Sbjct: 355 RLAIIQQAILKETAPLLKPGGTLVYSTCTMDPSENQQVIHAFLQEHQDF---EPDLSLNE 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  +        G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEQVAPFVQNGSVQILPHYF--------GTDGFFICSMRKK 446


>gi|316931426|ref|YP_004106408.1| Fmu (Sun) domain-containing protein [Rhodopseudomonas palustris
           DX-1]
 gi|315599140|gb|ADU41675.1| Fmu (Sun) domain protein [Rhodopseudomonas palustris DX-1]
          Length = 450

 Score =  281 bits (719), Expect = 1e-73,   Method: Composition-based stats.
 Identities = 171/441 (38%), Positives = 254/441 (57%), Gaps = 8/441 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V++KR  L   L+        + LS RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLQKRRMLDDQLEGPAAHPGLKTLSDRDRALMRRLVATILRRLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ +L  +L   +P      +  L +  AQIL++DV D+A VDL+V   + D+    +A 
Sbjct: 73  LEGLLARLLDRGVPTDAPRAKSALLIGAAQILWMDVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE    + +  AG   +P+W   R    YG +   AI+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGQPLVEELAAGTPDVPQWLLARWSAHYGADTARAIAQAISHEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L+  +LPTG +R   L  S+  LPGF EG WWVQDA+A++P +LFG + 
Sbjct: 193 VKSDPAHWATRLHGEVLPTGTVR-TLLQGSVRMLPGFDEGQWWVQDAAAALPARLFGDIA 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             SV DLCAAPGGKTAQL  +GA+VTA+D S  R+ +LR NL RL L   +    DA ++
Sbjct: 252 GKSVADLCAAPGGKTAQLAAAGARVTAIDRSPARVARLRENLARLSLE-VETGVADAAEW 310

Query: 302 CPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
                  FDAVL+DAPC+STGTIRRHPDV W +   DI   A  Q +LL +  S ++PGG
Sbjct: 311 RGDATAEFDAVLIDAPCASTGTIRRHPDVAWLKQESDIGALAAVQNRLLKKAASLLRPGG 370

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL+ ++ E+ +  +L + P  +   P++ A  +   +   ++ +G +R  P  
Sbjct: 371 TLVYCTCSLEPEEGEQAIAVLLAAEP-SMRRQPIDPA--EVAGLTEIVTADGALRTLPCH 427

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
           L   D   +G+DGF+A  L +
Sbjct: 428 LPHSDPRLAGLDGFYAARLMK 448


>gi|315646179|ref|ZP_07899299.1| sun protein [Paenibacillus vortex V453]
 gi|315278378|gb|EFU41694.1| sun protein [Paenibacillus vortex V453]
          Length = 460

 Score =  281 bits (718), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 116/458 (25%), Positives = 202/458 (44%), Gaps = 38/458 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
            R ++ ++L+ V ++      LL+          LS+ D  L   ++  T+  L  +D  
Sbjct: 14  PRELAMNVLTQVEQEGAYSNLLLNSALQK---ASLSKSDAGLATELIYGTISRLNTLDYF 70

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           LD  +   + + +  ++ LLR+S+ Q++YLD + D+AVV  AV  AKR + ++  + +VN
Sbjct: 71  LDRYVNKGVAKLQPWVRALLRMSLYQVVYLDRIPDHAVVSEAVNLAKR-RGHQGISGMVN 129

Query: 126 SILRR--------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +LR            E +   +RI+ +   P+W  ER    YG E   AI  A   P  
Sbjct: 130 GVLRNILRQKADLTIPEDMPAARRISLLHSHPQWLVERWIAQYGTEATEAICAANNEPPA 189

Query: 178 IDLTV---KFDIETWAHKLNAVM------LPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V       E     + +          +    + +   ++     + +G+  +QD 
Sbjct: 190 VSVRVNTTMISREEMLKLMGSHGLDATPSPLSPYGIVVKGAGNMALTDWYRDGLISIQDE 249

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +  +       + VLD CAAPGGK+A +   +     + A D+   + + +     R
Sbjct: 250 SSMLVAEAIQPEPGMRVLDCCAAPGGKSAHMGELMKDEGSIIANDIHTHKGKLISDQASR 309

Query: 286 LHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           L L +   +  DA    D      FD +L+DAPCS  G IRR PD+ W +  +DI + A 
Sbjct: 310 LGLDSIMTVTGDALDLADRFEPASFDRILLDAPCSGLGVIRRKPDLKWGKSEEDIAEIAA 369

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q +LL    S ++PGGI+V+S C+++  ++E VV   L         +  +     S  
Sbjct: 370 LQLRLLESVSSLLRPGGILVYSTCTMEPLENEGVVSAFLEGHAEFA--IADDGLGSLSRL 427

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              +L   G ++I P             DGF+   + R
Sbjct: 428 EEKSLLRGGGVQILPQHY--------HSDGFYIARISR 457


>gi|119512103|ref|ZP_01631196.1| Fmu, rRNA SAM-dependent methyltransferase [Nodularia spumigena
           CCY9414]
 gi|119463261|gb|EAW44205.1| Fmu, rRNA SAM-dependent methyltransferase [Nodularia spumigena
           CCY9414]
          Length = 449

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 120/461 (26%), Positives = 200/461 (43%), Gaps = 43/461 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            N R ++ + L  V  K       L+          L   D+ L+  +V  ++R    +D
Sbjct: 2   TNPRQIAFNALRDV-HKGAYADVALNRALQKV---TLPNHDRRLLTELVYGSVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D +      ++   L+ +L + + Q+ Y   +   A V+  V+ AK +         
Sbjct: 58  TLIDQLATKKSHQQPKDLRSILHLGLYQLRYQERIPASAAVNTTVQLAKEN-GFSGLTGF 116

Query: 124 VNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAISDACI 173
           VN +LR+  R   +L + +            +   P+W  +   +         + D   
Sbjct: 117 VNGLLRQYIRLAQKLPEPLKLPENPVERLGILHSFPDWIIQVWLDQLDLVETENLCDWMN 176

Query: 174 SPLYIDLTVKF---DIETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFAEGVW 223
               IDL +      IE     L +              +RL     +I +LPGF EG W
Sbjct: 177 QTPTIDLRINPLRTSIEEVEAALESAGILTRRVNNCPQALRLIGSTGAIQNLPGFNEGWW 236

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQDASA +   L        V+D CAAPGGKT  +   +    ++ A D +  RL KL+
Sbjct: 237 SVQDASAQLVGYLLHPQAGEVVIDACAAPGGKTTHIAELMGDEGEIWACDRTASRLRKLK 296

Query: 281 CNLDRLHLYAEDIIEMDAFDYC-PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
            N  RLHL +  I   D+ +        D +L+DAPCS  GT+ RH D  W +  + + +
Sbjct: 297 ENAQRLHLQSIQICTGDSRNLPQFNHRGDRLLLDAPCSGLGTLHRHADARWRQTLESVQE 356

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            +  Q +L+ Q   FVKPGG++V++ C+L   ++E V+   L + P   ++ P ++ +  
Sbjct: 357 LSILQTELISQTSQFVKPGGVLVYATCTLHPAENEGVISTFLANHPQW-QIYPPSADFLD 415

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           S       +P+GW+++ P            MDGFF V LR+
Sbjct: 416 S----AYSTPQGWLKVWPH--------RQNMDGFFMVRLRK 444


>gi|326941634|gb|AEA17530.1| sun protein [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 444

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 202/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     SA   + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWLVQEWTSAYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKVTVEEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +        +VLD CAAPGGKT  +        KV +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPNTGDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+ K L+  P   E     +   +  
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIDKFLKEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYINEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|154685990|ref|YP_001421151.1| RsmB [Bacillus amyloliquefaciens FZB42]
 gi|154351841|gb|ABS73920.1| RsmB [Bacillus amyloliquefaciens FZB42]
          Length = 447

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 131/463 (28%), Positives = 212/463 (45%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R ++   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKK-INVRELALEALEKLEQNQAYSNLLLTSVIKTN---TLSDQDRGLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S  Q+ YL+ + D A +  AVE AK+ + ++ 
Sbjct: 57  IALDYMLKPFIRKP-NKVKSWVIQLLRLSAYQMEYLEKIPDRAAIHEAVEIAKK-RGHKG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN ILR + RE +     I       +  +  PEW  +     YG E    I    
Sbjct: 115 IASFVNGILRSLQREGVPSFAEIEDPVLRLSTETSHPEWLVKEWVEAYGFEAAEKICRIH 174

Query: 173 ISPLYIDLTVKF---DIETWAHK-----LNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P    L V     D ET  ++     L A         +K L  SI +   F  G   
Sbjct: 175 LIPPKQTLRVNHIKSDRETVLNEMENAGLEAEAGDLSPDAIKLLKGSIANTAFFQNGRVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +        +VLD CAAPGGK+A +   + +   +T+LD+ + +++ ++ 
Sbjct: 235 IQDESSMLVARALDPKPGETVLDACAAPGGKSAHIAELMENEGSLTSLDLHRHKVKLIKE 294

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             +RL L   D   MDA           FD VLVDAPCS  G IRR PD+ +T+  +D  
Sbjct: 295 GAERLGLTIIDAQTMDARKAGEAFGAERFDRVLVDAPCSGFGVIRRKPDMKYTKTPEDSR 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + +  Q  +L +    VK GG +V+S C++D+ ++EEV+   ++  P   E  P  S   
Sbjct: 355 RLSEIQLGILREIAPLVKKGGTLVYSTCTMDRTENEEVMHAFIQEHP---EFEPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  + A     +G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKARPFVQDGSLQILPHYF--------GTDGFFISSMRKK 446


>gi|30021953|ref|NP_833584.1| sun protein [Bacillus cereus ATCC 14579]
 gi|29897509|gb|AAP10785.1| 16S rRNA m(5)C 967 methyltransferase [Bacillus cereus ATCC 14579]
          Length = 444

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 204/461 (44%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     SA   + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAITTSHPVWLVQEWTSEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A +       ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKVTVEEAIELLASEGIEAKLGDLSDDAIQIERGNVAHTEAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +        +VLD CAAPGGKT  +        KV +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPNTGDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V++K L+  P   E     +   +  
Sbjct: 355 TIQIAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLTPYIDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|209965632|ref|YP_002298547.1| ribosomal RNA small subunit methyltransferase B [Rhodospirillum
           centenum SW]
 gi|209959098|gb|ACI99734.1| ribosomal RNA small subunit methyltransferase B [Rhodospirillum
           centenum SW]
          Length = 447

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 169/427 (39%), Positives = 242/427 (56%), Gaps = 16/427 (3%)

Query: 15  LSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISS 74
           +   +RK +     L+    +   R L  RD+  VR +     R L ++DA++   L   
Sbjct: 34  IQATLRKGVPFDDALE---ANRGVRALEPRDRGFVRLLCATVFRRLGQLDALVQGALAKP 90

Query: 75  LPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE 134
               K  +Q +LR+  AQ+L+L    +A VD +VE A   +    +  LVN++LRR+SRE
Sbjct: 91  GQPVKGPVQDILRLGAAQLLFLGTPAHAAVDTSVELAVA-RGQTPYKGLVNAVLRRLSRE 149

Query: 135 KIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKL 193
              L   + AG    P+W        YG     AI +A ++   +D+TV+ D + WA +L
Sbjct: 150 GAGLLAAQDAGRLNTPDWLWLAWRQAYGTGATRAIVEAHLAEPPLDITVRADADLWAERL 209

Query: 194 NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPG 253
            A  LP G +RL      +  LPGFAEG WWVQDA+A+IP +LFG +    VLDLCAAPG
Sbjct: 210 GAERLPGGSLRLPAG-GPVTELPGFAEGAWWVQDAAAAIPARLFGDVAGREVLDLCAAPG 268

Query: 254 GKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVD 313
           GKTAQL  +GA+VTA+D S++RLE+LR NL RL L   + +  DA  + P    DAVL+D
Sbjct: 269 GKTAQLAAAGARVTAVDRSEKRLERLRENLARLGLE-VETVAADATAWSPDAPVDAVLLD 327

Query: 314 APCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDS 373
           APCS+TGTIRRHPDV   +  +D+ K A  Q +LL++    +KPGG++V++ CSL  ++ 
Sbjct: 328 APCSATGTIRRHPDVQRLKTEEDVAKLARVQARLLIRAADMLKPGGLLVYATCSLQPEEG 387

Query: 374 EEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGF 433
           E  V+ +L   P    LV +     +   +A A++  G +R TP ++        GMDGF
Sbjct: 388 ERQVEALLARRPD---LVRVPVDPAELGGLAGAVTAAGDVRTTPGLIP------GGMDGF 438

Query: 434 FAVALRR 440
           FA  LRR
Sbjct: 439 FAARLRR 445


>gi|304404144|ref|ZP_07385806.1| sun protein [Paenibacillus curdlanolyticus YK9]
 gi|304347122|gb|EFM12954.1| sun protein [Paenibacillus curdlanolyticus YK9]
          Length = 521

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 124/466 (26%), Positives = 202/466 (43%), Gaps = 42/466 (9%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR V+   L  + R+      +L+          LS+ D  L   +V  TL+    +D  
Sbjct: 67  AREVALEALVKIEREEAFSNLVLNSALQH---AELSRADAGLATELVYGTLQRRLSLDHA 123

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L  +    L + +  + QLLR+S  Q+L+LD +  +A V+ AV  AKR + +   + +VN
Sbjct: 124 LSALAAKGLGKLEPWVLQLLRLSAYQLLFLDRIPAHAAVNEAVAIAKR-RGHSGISGMVN 182

Query: 126 SILRR------------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
            +LR              +        RIA     PEW   R    YG+     I  A  
Sbjct: 183 GMLRNLLRRRDELAPEAAAESAARPALRIALRHSYPEWLVARWIAAYGEAAAEQICAAGN 242

Query: 174 SPLYIDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +P +  + V     T    +          A    +    + +   S+    GF +G W 
Sbjct: 243 APPHASIRVNRLRATREEAIAILAESGIEAAKSAVSPAGVVAQRGGSLADTIGFRDGRWT 302

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  Q       ++VLD CAAPGGKT  L   + +  +V A DV   +   +  
Sbjct: 303 IQDESSMLVAQAARPAAGMTVLDCCAAPGGKTTHLAELMGNEGRVIANDVHPHKQALIEQ 362

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             +RL L   + +  DA +   +     FD VL+DAPCS  G I R P++ WT+   DI 
Sbjct: 363 QAERLGLTCVEAVTGDAAELGERYSSESFDLVLLDAPCSGLGVIARKPEIKWTKSEGDIR 422

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q+KL+      VKP G +V+S C++D+ +++  + + L+  P         +   
Sbjct: 423 EIAAIQKKLINGVAGLVKPDGRLVYSTCTIDRDENDRQISQFLKDHPEYTLDAEWPAELL 482

Query: 399 KSIDMAMALSPE--GWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +S+  A A+  E  G +++ P+          G DGF+   LR+  
Sbjct: 483 ESLRSAGAVQGEFTGALQLLPNHF--------GSDGFYIATLRKRT 520


>gi|206971310|ref|ZP_03232261.1| ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           AH1134]
 gi|218233863|ref|YP_002368666.1| sun protein [Bacillus cereus B4264]
 gi|296504360|ref|YP_003666060.1| sun protein [Bacillus thuringiensis BMB171]
 gi|206734082|gb|EDZ51253.1| ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           AH1134]
 gi|218161820|gb|ACK61812.1| sun protein [Bacillus cereus B4264]
 gi|296325412|gb|ADH08340.1| sun protein [Bacillus thuringiensis BMB171]
          Length = 444

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 116/461 (25%), Positives = 203/461 (44%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     SA   + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAITTSHPVWLVQEWTSEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKVTVEEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +        +VLD CAAPGGKT  +        KV +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPNTGDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V++K L+  P   E     +   +  
Sbjct: 355 TIQIAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLTPYIDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|253702184|ref|YP_003023373.1| sun protein [Geobacter sp. M21]
 gi|251777034|gb|ACT19615.1| sun protein [Geobacter sp. M21]
          Length = 448

 Score =  281 bits (717), Expect = 2e-73,   Method: Composition-based stats.
 Identities = 114/466 (24%), Positives = 192/466 (41%), Gaps = 43/466 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M S  N R  +  +L  + +++     L+D E       ++   D+ L+  +V   LR  
Sbjct: 1   MSSK-NPRRAAFDILLRIEKEKSFADILIDHELSK---DIIKGADRGLLTELVYGVLRRQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D ++         + +  ++ LLR+ + Q  +LD V   A V+  V  AK       
Sbjct: 57  GTLDYIISQFSKQRPEKLELFVRLLLRLGIYQCFFLDRVPVSAAVNETVNLAKE--LAPR 114

Query: 120 FAKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISD 170
            +  +N++LR   R +  +             A     P W  ++  +  G E    ++ 
Sbjct: 115 ASGFINAVLRNADRGRDTITYPDRAARPAEYLAARYSHPAWLAQQWCDQLGLEAAEELAA 174

Query: 171 ACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEG 221
           A   P  + + V       E    +L    +                   I  LP F +G
Sbjct: 175 AMSEPPPLTVRVNTLRITREELIRRLVGEGVSCSATSWSPDGIRLNQSGQITRLPSFRDG 234

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
           ++ VQD S+ +            VLD CAAPGGKT Q+   +    ++ A DV+ ++L  
Sbjct: 235 LFTVQDESSQLAPLFLAPGKGERVLDACAAPGGKTTQIAQLMQDSGEIYACDVNNKKLRL 294

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYC---PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           ++   DRL + +     MDA        +  F  +LVDAPCS  G IRR+P+  W++  D
Sbjct: 295 IKETCDRLGINSVRTFTMDATAPSNAIKETTFHRILVDAPCSGLGVIRRNPEGKWSKSGD 354

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D+++ A  Q  +L     +++P G ++++ CS   Q++E VV   L S P  V    +  
Sbjct: 355 DLLQLARTQVSILENLCRYLEPKGTILYATCSTSIQENEYVVDSFLGSHPEFV----VED 410

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                   A   +  G+ R  P           GMDGFF+  L+R 
Sbjct: 411 LRPLFPQYAPLFTERGFFRSWPH--------RDGMDGFFSARLKRK 448


>gi|218245524|ref|YP_002370895.1| sun protein [Cyanothece sp. PCC 8801]
 gi|218166002|gb|ACK64739.1| sun protein [Cyanothece sp. PCC 8801]
          Length = 451

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 126/467 (26%), Positives = 213/467 (45%), Gaps = 44/467 (9%)

Query: 1   MKSG---MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTL 57
           M +     +AR ++  +L  + R+       +D     +    LS  D+ LV  +V   +
Sbjct: 1   MSNSDQITHARPLALVILREIERRGTFTDIAIDRGLKST---DLSGSDRALVTELVYGIV 57

Query: 58  RFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKE 116
           R    +D ++D +   +  ++   L+ +L + + Q+ YL  +   A V+ AV  AK +  
Sbjct: 58  RRKRTLDTLIDQLGKKASHQQPPDLRLILYIGLYQLRYLSQIPPSAAVNTAVNLAKENSL 117

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVL 166
            +  + +VN ILR+  R   E    +            +   P++  +     +G E   
Sbjct: 118 -QRLSGVVNGILRQYIRLAQENNDPLILPDDPISRLGVLYSFPDFMIKLWLEQWGLETTE 176

Query: 167 AISDACISPLYIDLTVKFDIETWAHKLNAVML---------PTGGIRLKELPESIVSLPG 217
            + +    P  +D+ +     T       +              G+RL+    +I  LPG
Sbjct: 177 ELCNWFNQPPVLDIRINPLKTTLEEVKTTLSQGNLTLMPLEIPQGLRLQGKTGAIQDLPG 236

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKR 274
           F EG W VQD+SA +   L     +  ++D CAAPGGKT  +   +     + A D    
Sbjct: 237 FKEGWWTVQDSSAQLVSHLLDPQPSEVIIDACAAPGGKTTHIAELMGDQGTIWACDRYAS 296

Query: 275 RLEKLRCNLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
           RL+KL  N +RL L +  I+  D+      + + D VLVDAPCS  GT+ RHPD+ W + 
Sbjct: 297 RLKKLSANKERLQLNSIKIVTGDSRQLDQFQGIADRVLVDAPCSGLGTLHRHPDIRWRQT 356

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
            + I + A  Q++LL    ++VKP GI+V++ C+L  Q++E V++  L S P     VP 
Sbjct: 357 PEKIEELAILQKELLETTANWVKPQGILVYATCTLTYQENEGVIEHFLASHPHWKIDVPS 416

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            ++      +A  ++  G I+I P   +        MDGFF V L++
Sbjct: 417 PNS-----PVAKWMTASGSIKILPHQQD--------MDGFFMVKLKK 450


>gi|47569491|ref|ZP_00240171.1| sun protein [Bacillus cereus G9241]
 gi|47553820|gb|EAL12191.1| sun protein [Bacillus cereus G9241]
          Length = 444

 Score =  280 bits (716), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 112/461 (24%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPIWLVQEWTSEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAIALLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         VLD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P       +     + +
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHPEFEWDTTIKERMPEKL 414

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
               +   EG ++I P             DGF+   LR+ +
Sbjct: 415 G---SYIDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|52141623|ref|YP_085206.1| sun protein [Bacillus cereus E33L]
 gi|51975092|gb|AAU16642.1| sun protein [Bacillus cereus E33L]
          Length = 444

 Score =  280 bits (715), Expect = 3e-73,   Method: Composition-based stats.
 Identities = 112/461 (24%), Positives = 200/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWLVQEWTSEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         VLD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P       +     + +
Sbjct: 355 TIQFAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHPEFEWDTTIKDRMPEKL 414

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                   EG ++I P             DGF+   LR+ +
Sbjct: 415 ---SPYMDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|324327763|gb|ADY23023.1| 16S rRNA methyltransferase B [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 444

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLATATSHPVWLVQEWASEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIERGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         VLD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLGNVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYIDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|257058561|ref|YP_003136449.1| sun protein [Cyanothece sp. PCC 8802]
 gi|256588727|gb|ACU99613.1| sun protein [Cyanothece sp. PCC 8802]
          Length = 451

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 126/467 (26%), Positives = 211/467 (45%), Gaps = 44/467 (9%)

Query: 1   MKSG---MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTL 57
           M +     +AR ++  +L  + R+       +D     +    LS  D+ LV  +V   +
Sbjct: 1   MSNSDQITHARPLALVILREIERRGTFTDIAIDRGLKST---DLSGSDRALVTELVYGIV 57

Query: 58  RFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKE 116
           R    +D ++D +   +  ++   L+ +L + + Q+ YL  +   A V+ AV  AK +  
Sbjct: 58  RRKRTLDTLIDQLGKKASHQQPPDLRLILYIGLYQLRYLSQIPPSAAVNTAVNLAKENSL 117

Query: 117 NRHFAKLVNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVL 166
            +  + +VN ILR+  R   E    +            +   P++  +     +G E   
Sbjct: 118 -QRLSGVVNGILRQYIRLAQENNDPLILPDDPISRLGVLYSFPDFMIKLWLEQWGLETTE 176

Query: 167 AISDACISPLYIDLTVKFDIETWAHKLNAVML---------PTGGIRLKELPESIVSLPG 217
            + +    P  +D+ +     T       +              G+RL+    +I  LPG
Sbjct: 177 ELCNWFNQPPVLDIRINPLKTTLEEVKTTLSQGNLTLMPLEIPQGLRLQGKTGAIQDLPG 236

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKR 274
           F EG W VQD+SA +   L     +  ++D CAAPGGKT  +   +     + A D    
Sbjct: 237 FKEGWWTVQDSSAQLVSHLLDPQPSEVIIDACAAPGGKTTHIAELMGDQGTIWACDRYAS 296

Query: 275 RLEKLRCNLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
           RL+KL  N +RL L +  I+  D+      + + D VLVDAPCS  GT+ RHPD+ W + 
Sbjct: 297 RLKKLSANKERLQLNSIKIVTGDSRQLDQFQGIADRVLVDAPCSGLGTLHRHPDIRWRQT 356

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
            + I + A  Q++LL    ++VKP GI+V++ C+L  Q++E V++  L S P     VP 
Sbjct: 357 PEKIEELAILQKELLETTANWVKPQGILVYATCTLTYQENEGVIEHFLASHPHWKIDVPS 416

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +       A  ++  G I+I P   +        MDGFF V L++
Sbjct: 417 PDS-----PAAKWMTASGAIKILPHQQD--------MDGFFMVKLKK 450


>gi|254735904|ref|ZP_05193610.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. Western North America USA6153]
          Length = 444

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P WF +     YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWFVQEWTAEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         +LD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVILDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 MIQFAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYMDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|311068095|ref|YP_003973018.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus atrophaeus
           1942]
 gi|310868612|gb|ADP32087.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus atrophaeus
           1942]
          Length = 447

 Score =  280 bits (715), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 125/463 (26%), Positives = 206/463 (44%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R ++   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKKN-NVRDIALEALMKLDQNQAYSNLLLKSVIKSN---ELSDQDRGLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S+ Q+ YL+ +   A +  AVE AK+ + ++ 
Sbjct: 57  TALDYMLKPFINKP-AKVKPWVIQLLRLSLYQMEYLEKIPHRAAIHEAVEIAKK-RGHKG 114

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN +LR V RE         + + R+A  +  PEW  +     YG +    I    
Sbjct: 115 IASFVNGVLRSVQREGVPSFAAINDPVTRLATETSHPEWLVKEWAEAYGFDAAEKICRIH 174

Query: 173 ISPLYIDLTVK---FDIETWAHKLNAVMLPTGGIRLKE-----LPESIVSLPGFAEGVWW 224
           + P    L V     D +     L A  +      L       L  SI     F  G   
Sbjct: 175 LVPPKQTLRVNQMKTDRDELLESLAAEGIEAEKGDLSPDAVKLLKGSIAGSRFFKNGDVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +  G     ++LD CAAPGGK+      + +   V +LD+ + +++ ++ 
Sbjct: 235 IQDESSMLVARALGPEAGETILDACAAPGGKSTHIAERMGNEGSVLSLDLHEHKVKLIKE 294

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             +RL L       MDA           FD +LVDAPCS  G IRR PD+ ++++ +D  
Sbjct: 295 AANRLGLTIIKPEAMDARKASEAFQDDEFDRILVDAPCSGFGVIRRKPDMKYSKNPEDSA 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q  +L +    VK GG +V+S C++D+ ++EEV+   ++  P   E  P  S   
Sbjct: 355 RLAKIQLSILREIAPLVKKGGTLVYSTCTMDRTENEEVIHAFIQEHP---EFEPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  + A      G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKARPFVRGGSLQILPHYF--------GTDGFFICSMRKK 446


>gi|225181330|ref|ZP_03734774.1| sun protein [Dethiobacter alkaliphilus AHT 1]
 gi|225167911|gb|EEG76718.1| sun protein [Dethiobacter alkaliphilus AHT 1]
          Length = 451

 Score =  279 bits (714), Expect = 4e-73,   Method: Composition-based stats.
 Identities = 123/464 (26%), Positives = 199/464 (42%), Gaps = 40/464 (8%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K  ++AR  S   L  V      +   LD          L  RD+ L   I    + +  
Sbjct: 4   KRKIDAREASLLALQRVEADDAYVNLALDEVLSSH---SLDPRDKRLAAEITYGVITYKL 60

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHF 120
            +D +++ V    + +    + Q+LR+   Q+ YLD V   A V   VE  K+ K+ R  
Sbjct: 61  TLDWLIEKVSGRPIKKLDKPIHQILRIGFYQLFYLDRVPPAAAVHATVELVKKGKK-RGL 119

Query: 121 AKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDA 171
           A  VN ++R   R+K  L             +     P W   R  N YG E    +  A
Sbjct: 120 APFVNGVMRGALRKKDHLPWPDKKKDSANYLSVRYSHPLWLVRRWLNRYGPEEAEKLVAA 179

Query: 172 CISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGV 222
                 + + V     D +T   +L A  +      +            +  L  + EG 
Sbjct: 180 NNQAAPLSIRVNTLRTDRDTLLSELTAAGVEAVPSTVVPEGALLTRSGRLTELAPYREGR 239

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKL 279
           + VQ  SA +  ++       +VLD C+APGGKT  L   + +   + ALD+   RLE +
Sbjct: 240 FQVQGESAMLTSRVLDPQAGDAVLDGCSAPGGKTTHLAQLMNNSGDILALDIHPHRLELV 299

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           + N  R+ +       +DA +   +    FD +L+D PCS  G IRR PD+ W R  DDI
Sbjct: 300 KANCRRMGVDIVRTQCLDAREIAKENPDSFDCILLDVPCSGFGVIRRKPDLKWRRSEDDI 359

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            K A  Q  +L    + +KPGG +V+S C+ + ++++EVV+++L++      +VP +   
Sbjct: 360 RKLAHVQCDMLKAAAAVLKPGGTLVYSTCTNEPEETDEVVEELLKNQDD---MVPDDLRP 416

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +   D        G I + P +         G+DGFF   L+++
Sbjct: 417 YLPQDWQQDAGKTG-IHLLPHI--------HGVDGFFISRLKKI 451


>gi|196038686|ref|ZP_03105994.1| sun protein [Bacillus cereus NVH0597-99]
 gi|196030409|gb|EDX69008.1| sun protein [Bacillus cereus NVH0597-99]
          Length = 444

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 111/461 (24%), Positives = 199/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVS-------REKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR +         E  + ++R+A  +  P W  +     YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVNEIKDPVERLAIATSHPVWLVQEWTAEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         +LD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVILDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 MIQFAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYMDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|239826566|ref|YP_002949190.1| sun protein [Geobacillus sp. WCH70]
 gi|239806859|gb|ACS23924.1| sun protein [Geobacillus sp. WCH70]
          Length = 447

 Score =  279 bits (714), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 120/464 (25%), Positives = 206/464 (44%), Gaps = 39/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R V+   L  V  K      LL+          LS+RD  L+  IV  T++  
Sbjct: 1   MKAK-NVREVALETLLAVEEKEAYSNLLLNKMIETHR---LSERDVRLLTEIVYGTIQRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L  +  + +  ++ LLR+++ Q+LYLD + D A +  AVE AK+ + ++ 
Sbjct: 57  DTLDYYLTPFLKKA-RKLERWVRVLLRLTLYQVLYLDRIPDRAAIFEAVEIAKK-RGHQG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A LVN ++R + R+ +  L++I       A  +  P W  +R    YG E    + +  
Sbjct: 115 VASLVNGVMRAIQRQGVPPLEKIEDEVERLAVATSHPLWLVKRWVEQYGLEETKRMCETN 174

Query: 173 ISPLYIDLTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P      V     T    ++         V+       ++    ++     F  G   
Sbjct: 175 LLPPKQTARVNTARITVEEAIDKLKQEGMEVVLGEVAEEAIQAKRGNLAHTDAFRRGWIT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +  G   +  VLD CAAPGGK+  +   + +  +V   D+ + ++  +  
Sbjct: 235 IQDESSMLVARALGPKEHERVLDSCAAPGGKSTHIAELMNNTGQVICADIHEHKVNLIEE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           N  RL L       +D+        +++FD +LVDAPCS  G IRR PD+ + +   DI 
Sbjct: 295 NAKRLQLTNISARVLDSRRLGEVFEREMFDKILVDAPCSGFGVIRRKPDIKYAKTEADIP 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
                QR++L      +K GG +V+S C++D+ ++E V+ + L   P   E  P  +   
Sbjct: 355 SLVALQREILHAVAPLLKKGGTLVYSTCTIDRDENEAVIAQFLDDHP---EFSPDETMKR 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +  +        G + + P           G DGFF  +LR+ +
Sbjct: 412 RLPEKVQPYVHNGQLHLLPHYF--------GSDGFFIASLRKKV 447


>gi|42782957|ref|NP_980204.1| sun protein [Bacillus cereus ATCC 10987]
 gi|42738884|gb|AAS42812.1| sun protein [Bacillus cereus ATCC 10987]
          Length = 444

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWLVQEWASEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         VLD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLGNVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYIDEGQVQILPHYFA--------TDGFYIACLRKRV 444


>gi|30263868|ref|NP_846245.1| sun protein [Bacillus anthracis str. Ames]
 gi|47529294|ref|YP_020643.1| sun protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49186715|ref|YP_029967.1| sun protein [Bacillus anthracis str. Sterne]
 gi|49478421|ref|YP_037926.1| sun protein [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|118479087|ref|YP_896238.1| sun protein [Bacillus thuringiensis str. Al Hakam]
 gi|165872297|ref|ZP_02216934.1| sun protein [Bacillus anthracis str. A0488]
 gi|167636414|ref|ZP_02394713.1| sun protein [Bacillus anthracis str. A0442]
 gi|167641141|ref|ZP_02399396.1| sun protein [Bacillus anthracis str. A0193]
 gi|170688847|ref|ZP_02880050.1| sun protein [Bacillus anthracis str. A0465]
 gi|170708813|ref|ZP_02899249.1| sun protein [Bacillus anthracis str. A0389]
 gi|177654922|ref|ZP_02936639.1| sun protein [Bacillus anthracis str. A0174]
 gi|190565749|ref|ZP_03018668.1| sun protein [Bacillus anthracis Tsiankovskii-I]
 gi|196035830|ref|ZP_03103232.1| sun protein [Bacillus cereus W]
 gi|196047441|ref|ZP_03114653.1| sun protein [Bacillus cereus 03BB108]
 gi|218904995|ref|YP_002452829.1| sun protein [Bacillus cereus AH820]
 gi|227813227|ref|YP_002813236.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. CDC 684]
 gi|229603771|ref|YP_002868102.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. A0248]
 gi|254683426|ref|ZP_05147286.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. CNEVA-9066]
 gi|254721397|ref|ZP_05183186.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. A1055]
 gi|254739848|ref|ZP_05197541.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. Kruger B]
 gi|254751038|ref|ZP_05203077.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. Vollum]
 gi|254756703|ref|ZP_05208732.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. Australia 94]
 gi|301055356|ref|YP_003793567.1| sun protein [Bacillus anthracis CI]
 gi|30258512|gb|AAP27731.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. Ames]
 gi|47504442|gb|AAT33118.1| sun protein [Bacillus anthracis str. 'Ames Ancestor']
 gi|49180642|gb|AAT56018.1| sun protein [Bacillus anthracis str. Sterne]
 gi|49329977|gb|AAT60623.1| sun protein [Bacillus thuringiensis serovar konkukian str. 97-27]
 gi|118418312|gb|ABK86731.1| sun protein [Bacillus thuringiensis str. Al Hakam]
 gi|164711973|gb|EDR17513.1| sun protein [Bacillus anthracis str. A0488]
 gi|167510921|gb|EDR86312.1| sun protein [Bacillus anthracis str. A0193]
 gi|167528156|gb|EDR90943.1| sun protein [Bacillus anthracis str. A0442]
 gi|170126298|gb|EDS95189.1| sun protein [Bacillus anthracis str. A0389]
 gi|170667202|gb|EDT17962.1| sun protein [Bacillus anthracis str. A0465]
 gi|172080433|gb|EDT65520.1| sun protein [Bacillus anthracis str. A0174]
 gi|190562668|gb|EDV16634.1| sun protein [Bacillus anthracis Tsiankovskii-I]
 gi|195991479|gb|EDX55445.1| sun protein [Bacillus cereus W]
 gi|196021749|gb|EDX60444.1| sun protein [Bacillus cereus 03BB108]
 gi|218535394|gb|ACK87792.1| sun protein [Bacillus cereus AH820]
 gi|227005311|gb|ACP15054.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. CDC 684]
 gi|229268179|gb|ACQ49816.1| ribosomal RNA small subunit methyltransferase B [Bacillus anthracis
           str. A0248]
 gi|300377525|gb|ADK06429.1| sun protein [Bacillus cereus biovar anthracis str. CI]
          Length = 444

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 112/461 (24%), Positives = 200/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +     YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWLVQEWTAEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         +LD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVILDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 MIQFAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYMDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|238019375|ref|ZP_04599801.1| hypothetical protein VEIDISOL_01239 [Veillonella dispar ATCC 17748]
 gi|237864074|gb|EEP65364.1| hypothetical protein VEIDISOL_01239 [Veillonella dispar ATCC 17748]
          Length = 451

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 99/461 (21%), Positives = 181/461 (39%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + R        L           LS  D+     +V   +R    +DA
Sbjct: 11  NIRLLAVKALSDINRNGAYANIKLQEYLQKYH---LSDLDRRFFTELVYGVIRRKNYLDA 67

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       L +    + ++LR+ + QI+Y+D V + A V+ +V+ AK     R  +  V
Sbjct: 68  IIIHFAKRPLKKLSSMVVEILRLGIYQIIYMDKVPESAAVNESVKLAK--NLTRGLSGFV 125

Query: 125 NSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR V RE   +            I+ I   P W      N  GK++ + +       
Sbjct: 126 NAVLRSVLRESDSISIGELAKSEAEEISFIYNQPLWLVNLWMNEMGKDKTIDLCAWFNEQ 185

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPTGGI-------RLKELPESIVSLPGFAEGVWWV 225
             +   +      IE    +L  +               +      +       +G    
Sbjct: 186 PRLTARINTIKISIEDCLKELQDLGWTVEQDTYIPEVVYINAHQGHLEKAKPVIDGHITF 245

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +   +        +LD CAAPGGK+  +   + +   + + D+   +L+ +  N
Sbjct: 246 MDKASMLVAHVVDPQPGERILDCCAAPGGKSMHMASLMNNTGAIMSCDIYDHKLDLMNHN 305

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
             RL +        D        K+ FD VLVDAPCS  G +++  D+ W +    + + 
Sbjct: 306 AQRLGVSIVSTKLQDGRYLPDNWKEQFDRVLVDAPCSGLGILQKKLDMRWRKTESLLTEL 365

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L +    VK  G +V+S C+++  ++E+V++K L +      + P++      
Sbjct: 366 PPLQLEILEKAAEMVKVNGYLVYSTCTINSGENEDVLEKFLATHKN-FVIDPVSYEGLPP 424

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                  S +G I   P            MDGFF   ++R+
Sbjct: 425 -------STDGMITTYP--------PRDHMDGFFMARMKRI 450


>gi|225865846|ref|YP_002751224.1| ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           03BB102]
 gi|225787241|gb|ACO27458.1| ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           03BB102]
          Length = 444

 Score =  279 bits (713), Expect = 6e-73,   Method: Composition-based stats.
 Identities = 112/461 (24%), Positives = 200/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +     YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWLVQEWTAEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         +LD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLIARALEPDEGDVILDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 MIQFAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYMDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|17228315|ref|NP_484863.1| sun protein [Nostoc sp. PCC 7120]
 gi|17130165|dbj|BAB72777.1| sun protein [Nostoc sp. PCC 7120]
          Length = 449

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 120/461 (26%), Positives = 199/461 (43%), Gaps = 43/461 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            N+R ++   L  V  K       LD          LS  D+ LV  ++  ++R    +D
Sbjct: 2   TNSRQIAFIALRDV-HKGAYTDVALDRALQK---ANLSDIDRRLVTELLYGSVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D +      ++   L+ +L + + Q+ Y   +   A V+  VE AK D         
Sbjct: 58  FIIDQLAKKKSHQQPTELRSILHLGLYQLRYQERIPASAAVNTTVELAK-DNGFAGLTGF 116

Query: 124 VNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAISDACI 173
           VN +LR+  R        +            +   P+W  +      G      + +   
Sbjct: 117 VNGLLRQYIRLAEASPDFLELPENPVERLGILHSFPDWIIKVWWEQLGLTETEKLCEWMN 176

Query: 174 SPLYIDLTVKFDIETWAHKLNA----------VMLPTGGIRLKELPESIVSLPGFAEGVW 223
               +DL V   + + A    A          +      +RL     SI  LPGF++G W
Sbjct: 177 QTPTLDLRVNPLLASVAEVETALKSAGVLARPIPHLPQALRLIGNNGSIQKLPGFSQGWW 236

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQDASA +   L        ++D CAAPGGKT  +   +    KV A D +  RL KL+
Sbjct: 237 IVQDASAQLVGHLLDPQPGEVIIDACAAPGGKTTHIAELMKDEGKVWAGDRTASRLRKLK 296

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKK-LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
            N  RL+L++ +I   D+ +      + D VL+DAPCS  GT+ RH D  W +  + + +
Sbjct: 297 ENAQRLNLHSIEICIGDSRNLPQFYDVADRVLLDAPCSGLGTLHRHADARWRQTPESVQE 356

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            +  Q++LL     FVK GG++V++ C+L   ++EEV+ + +  +       P   +   
Sbjct: 357 LSMLQKELLAHTSKFVKVGGVLVYATCTLHPAENEEVITEFVAGNSDWQIEPPRPDS--- 413

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
               +   +P+GW+++ P         +  MDGFF V LR+
Sbjct: 414 --PYSAYTTPQGWLKVWPH--------NQDMDGFFMVRLRK 444


>gi|319409409|emb|CBI83055.1| SUN-family protein [Bartonella schoenbuchensis R1]
          Length = 447

 Score =  279 bits (713), Expect = 7e-73,   Method: Composition-based stats.
 Identities = 204/445 (45%), Positives = 277/445 (62%), Gaps = 9/445 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V + LL  V+ K  SL+ L D EYG   +  LS RD++L RAI+   LR   +
Sbjct: 7   PGLVVRQVCARLLGVVLDKHKSLSGLTDHEYGHPHYLKLSHRDRLLCRAILMAALRHRGQ 66

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I A L   L   LP +  SLQ LL +S AQILYLD+ D+A +DLAV+ AK D   R F+ 
Sbjct: 67  ITAALSRFLKRPLPLQALSLQHLLHISAAQILYLDIPDHAAIDLAVQMAKIDPRTRRFSG 126

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN+ILR  +RE + L  +   I  +P WF + L + YG ++   I     +   +DLTV
Sbjct: 127 LVNAILRNFAREAVCLRVQEPTIKDVPAWFGQLLVSTYGVDKAHQILAIQNNAPSLDLTV 186

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  V+LP G IRL  L  S+V+LPG+A+G WWVQD +A++P  L G +  
Sbjct: 187 KSDSIGWAKRLGGVVLPNGSIRLGALDGSVVNLPGYAQGAWWVQDFAAALPACLLGDIRG 246

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V+D CA+PGGKTAQL + GA VTA++ S  RLE+L+ N++RLHL A      D  D+ 
Sbjct: 247 KRVVDFCASPGGKTAQLALQGADVTAVESSANRLERLKENMERLHLSA-HYWTGDMRDFY 305

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
            ++LFDAVL+DAPCSSTGTIRRHPD+LWT+ +DDI K A  Q  LLL  I+FVK GG ++
Sbjct: 306 SEQLFDAVLLDAPCSSTGTIRRHPDILWTKSSDDITKLAAVQYDLLLAAIAFVKKGGCII 365

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP----- 417
           FSNCSL +Q+ E++++K+L +    + L P+ +    S  M   LS +G +R TP     
Sbjct: 366 FSNCSLARQEGEDLIKKILSTR-DDIILEPILAEEMGS--MKHLLSSDGTLRTTPADCCY 422

Query: 418 DMLEKIDGVSSGMDGFFAVALRRLI 442
           D  +  D +  GMDGFFA  LR++ 
Sbjct: 423 DNCDVEDPLLFGMDGFFAARLRKVA 447


>gi|206976730|ref|ZP_03237634.1| sun protein [Bacillus cereus H3081.97]
 gi|206745040|gb|EDZ56443.1| sun protein [Bacillus cereus H3081.97]
          Length = 444

 Score =  279 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPIWLVQEWTSEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWA--------HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T            + A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEGAITLLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         VLD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLGNVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYIDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|217961285|ref|YP_002339853.1| sun protein [Bacillus cereus AH187]
 gi|222097310|ref|YP_002531367.1| sun protein [Bacillus cereus Q1]
 gi|217064955|gb|ACJ79205.1| sun protein [Bacillus cereus AH187]
 gi|221241368|gb|ACM14078.1| sun protein [Bacillus cereus Q1]
          Length = 444

 Score =  279 bits (712), Expect = 8e-73,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 201/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPIWLVQEWTSEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWA--------HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T            + A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEGAIALLASEGIEAKRGDLSDDAIQIEKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         VLD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLGNVETKALDARKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYIDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|313893390|ref|ZP_07826962.1| ribosomal RNA small subunit methyltransferase B [Veillonella sp.
           oral taxon 158 str. F0412]
 gi|313442031|gb|EFR60451.1| ribosomal RNA small subunit methyltransferase B [Veillonella sp.
           oral taxon 158 str. F0412]
          Length = 451

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 102/461 (22%), Positives = 186/461 (40%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + R        L           LS  D+     +V   +R    +DA
Sbjct: 11  NIRLLAVKALSDINRNGAYANIKLQEYLQKYH---LSDLDRRFFTELVYGVIRRKNYLDA 67

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       L +    + ++LR+ + QI+Y+D V + A V+ +V+ AK+    R  +  V
Sbjct: 68  IIVHFAKRPLKKLSSMVVEILRLGIYQIIYMDKVPESAAVNESVKLAKK--LTRGLSGFV 125

Query: 125 NSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR V RE   +            I+ I   P W      N  GK++ + +       
Sbjct: 126 NAVLRSVLRECDSISIGELAKSEAEEISFIYNQPLWLVNLWMNEMGKDKTVDLCAWFNEQ 185

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPTGGI-------RLKELPESIVSLPGFAEGVWWV 225
             +   +      I+    +L  +               +      +       EG    
Sbjct: 186 PRLTARINTVKVSIDDCIKELQNLGWTVEQDKDIPEVVYINSHQGHLEKAKPVIEGHITF 245

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +   +        +LD CAAPGGK+  +   + +   + + D+   +L+ +  N
Sbjct: 246 MDKASMLVAHVVDPQPGERILDCCAAPGGKSMHMASLMNNTGAIMSCDIYDHKLDLMNQN 305

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            +RL +        D        K+ FD VLVDAPCS  G +++  D+ W +  D + + 
Sbjct: 306 AERLGVSIVSTKLQDGRYLPDNWKEQFDRVLVDAPCSGLGILQKKLDMRWRKSEDLLNEL 365

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L +    VK  G +V+S C+++  ++E+V++K L +    V    ++   +K 
Sbjct: 366 PPLQLEILEKASEMVKVNGYLVYSTCTINSGENEDVLEKFLATHKNFV----IDPVSYKG 421

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  A     +G I   P            MDGFF   ++RL
Sbjct: 422 LPPA----KDGMISTYP--------PRDHMDGFFMARMKRL 450


>gi|319646043|ref|ZP_08000273.1| YloM protein [Bacillus sp. BT1B_CT2]
 gi|317391793|gb|EFV72590.1| YloM protein [Bacillus sp. BT1B_CT2]
          Length = 444

 Score =  278 bits (711), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 123/456 (26%), Positives = 204/456 (44%), Gaps = 38/456 (8%)

Query: 8   RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVL 67
           R V+   L  + + +     LL      +    LS +D+ L+  +V  TL+    +D +L
Sbjct: 2   REVALDALIKLDQNQAYSNLLLQSAMKAN---DLSDKDRGLLTELVYGTLQNKLALDYML 58

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNS 126
              +     + K  +  LLR+S+ Q+ YL+ + D A +  AVE AKR + ++  +  VN 
Sbjct: 59  KPFIKKP-EKVKDWVIHLLRMSLYQMEYLEKIPDRAALFEAVEIAKR-RGHKGISSFVNG 116

Query: 127 ILRRVSREKIELLQRIAG-------ISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           +LR V RE +     IA         +  PEW      + YG E    I    + P    
Sbjct: 117 VLRSVQREGVPSFADIADPIERLAVETSHPEWLVREWTDAYGFEAAEQICRIHMIPPKQT 176

Query: 180 LTVK---FDIETWAHKLNAVMLPTGGIRLKE-----LPESIVSLPGFAEGVWWVQDASAS 231
           + V     D +T   +LN   +      L +     L  +I S P F EG   +QD S+ 
Sbjct: 177 IRVNRLKNDRDTLLSRLNEAGIEAEEGDLSKDAVKLLKGTIASTPFFKEGEVTIQDESSM 236

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIV---SGAKVTALDVSKRRLEKLRCNLDRLHL 288
           +  +  G     +VLD CAAPGGK+  +        KV +LD+ + +++ ++    R+ L
Sbjct: 237 LVARALGPERGETVLDACAAPGGKSTHIGELLEDTGKVVSLDLHQHKVKLIKEAAGRIGL 296

Query: 289 YAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
              +   +DA         + FD +LVDAPCS  G IRR PD+ +++  +D  + A  Q 
Sbjct: 297 SNIEARALDARKAGEVFEPEQFDRILVDAPCSGFGVIRRKPDLKYSKTPEDSARLAGIQL 356

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
            +L +    +K GG +V+S C++D  ++E+V+   L       E     +   +  + A 
Sbjct: 357 AILNEIAPLLKTGGTLVYSTCTMDPTENEQVMHAFLEEHD---EFEADPTLAERLPEKAA 413

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +G I+I P           G DGFF  ++R+ 
Sbjct: 414 PYVKDGSIQILPHYF--------GTDGFFICSMRKK 441


>gi|297617049|ref|YP_003702208.1| sun protein [Syntrophothermus lipocalidus DSM 12680]
 gi|297144886|gb|ADI01643.1| sun protein [Syntrophothermus lipocalidus DSM 12680]
          Length = 460

 Score =  278 bits (710), Expect = 1e-72,   Method: Composition-based stats.
 Identities = 118/460 (25%), Positives = 199/460 (43%), Gaps = 38/460 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
            R V+ +LL  V  K       +D E               LV  +VN T+R    +D V
Sbjct: 11  PREVALNLLYRVEHKGAYANLAVDRELDRYEDNG---SQHALVTELVNGTVRMRKHLDWV 67

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L+  L   + ++   L+++LR+SV Q+L++D V +YAVV+ AV  A R K +R  + +VN
Sbjct: 68  LNLFLSKPIQKQNPWLREILRMSVYQLLFMDNVPEYAVVNEAVGLAGR-KLDRGLSAVVN 126

Query: 126 SILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
            +LR                  ++ ++     PEW   R    YG +    + +      
Sbjct: 127 GVLRNVIRNRGEIPYPDMYQNPVEYLSVYYSHPEWMVARWVERYGLKGACQLLEHNNVRP 186

Query: 177 YIDLTVK---FDIETWAHKLNAVMLPT-------GGIRLKELPESIVSLPGFAEGVWWVQ 226
            + L       D E     L               G+ ++E  + +  L  + EG ++VQ
Sbjct: 187 RVALRTNLLKVDREELFRSLTDEGCRCTLSCLTPWGVWVEETGKPLRKLHSYREGWFYVQ 246

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D ++ +            V DL A  GGKT+ L   + +   + A+++  +++E L+ N+
Sbjct: 247 DDASMLVSAACAPEAGQVVYDLAAGVGGKTSHLAELMGNQGIIRAVEILPKKVEILKENI 306

Query: 284 DRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
            RL +   DI   DA           D VL+DAPCS  G +RR  D  W +   DI   +
Sbjct: 307 RRLGITIVDIWTGDALGPLAPGWGEGDVVLLDAPCSGLGVLRRRSDARWRKSEKDITVLS 366

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVL-RSSPIPVELVPLNSAYWKS 400
             Q++LL +G   V+PGG++V+S C+L+ +++EEV+   L   +   ++ +     ++  
Sbjct: 367 ELQKRLLKRGAQLVRPGGVLVYSTCTLEPEENEEVIDWFLGEETGFVLDDLSQPLRFFPF 426

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  +  G + + P           G DG F   LRR
Sbjct: 427 SPEDAKAASRGMLVLFP--------PRYGTDGMFIARLRR 458


>gi|308272081|emb|CBX28689.1| hypothetical protein N47_G40130 [uncultured Desulfobacterium sp.]
          Length = 450

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 118/465 (25%), Positives = 201/465 (43%), Gaps = 43/465 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            + R ++   L+ + +K+ +L  LL+          L +R++ L  A+V   LR+  R+D
Sbjct: 2   HDTRSLAIQFLNSLDKKKHTLDSLLEEFQNKYI---LPKREKALFNALVYGVLRWRSRLD 58

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            ++         +    +  +LR+ + QI++L  +   A V+ +VE AK     +  +  
Sbjct: 59  WIIRQFSKQPPEKTNTEILNILRIGLFQIIHLNRIPVSAAVNTSVEIAKHTVGTK-CSGY 117

Query: 124 VNSILRRVSREKIELLQRIAGISI---------IPEWFKERLENFYGKERVLAISDACIS 174
           VN++LRR  RE   L                   PEW  +R  +  GK   + + DA  +
Sbjct: 118 VNAVLRRTVREYKSLCFPDMDKKTEYGISVNKSFPEWMIKRWVSLLGKNSAIDLCDAINN 177

Query: 175 PLYIDLTVKF----------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
              I + V             IE+    +       GG+      E I  +  F +G + 
Sbjct: 178 IPPITVRVNTLKTNRDELISCIESETQDIRPTDCSPGGVSFSRPKELISEMEAFKKGGFQ 237

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           VQD +A +   L        V+D CA  GGKT  +   + +   +TA+D  K +L +L  
Sbjct: 238 VQDEAAQLAAFLMDPQPGEKVMDACAGLGGKTGHIGQLMENKGYITAIDKDKEKLFRLSL 297

Query: 282 NLDRLHLYAEDIIEMDA----FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           +++RL +        D     F       FD +L+DAPCS+ G IRR+PD+ W    D +
Sbjct: 298 DMERLGITNVTTSAGDFGDPVFLKSYSGKFDRILIDAPCSNMGVIRRNPDIKWKLTEDKL 357

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
           +     Q   L      +KP GI+V++ CS + +++EEV+ K L   P       ++  +
Sbjct: 358 LFYQKRQFLFLDNIAMLLKPAGIIVYAVCSTETEENEEVINKFLLKHPDFT----IDDMH 413

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                    ++ +G+IR  P +          MDGFF   L+R+I
Sbjct: 414 CFPKIFEPFVNSDGFIRTYPHL--------HNMDGFFLARLKRII 450


>gi|261405800|ref|YP_003242041.1| sun protein [Paenibacillus sp. Y412MC10]
 gi|261282263|gb|ACX64234.1| sun protein [Paenibacillus sp. Y412MC10]
          Length = 442

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 121/454 (26%), Positives = 205/454 (45%), Gaps = 39/454 (8%)

Query: 12  SHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVL 71
            ++L+ V ++      LL+     S    L++ D  L   ++  T+  L  +D  LD  +
Sbjct: 1   MNVLTQVEQEGAYSNLLLNSALQKS---SLAKSDAGLATELIYGTISRLNTLDYFLDKFV 57

Query: 72  ISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRR 130
              + + +  ++ LLR+S+ QI+YLD + D+AVV  AV  AKR + ++  + +VN +LR 
Sbjct: 58  NKGVRKLQPWVRALLRISLYQIVYLDRIPDHAVVSEAVNLAKR-RGHQGISGMVNGVLRN 116

Query: 131 V--------SREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           +          E +   QRI+ +   P+W  ER  + YG E   AI  A   P  + + V
Sbjct: 117 ILRQKETLAIPEDMTDAQRISLLHSHPQWLVERWISQYGTEATEAICAANNEPPAVSVRV 176

Query: 183 ---KFDIETWAHKLNAVMLPTG------GIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
                  +     +    L            + +   ++     + EG+  +QD S+ + 
Sbjct: 177 NTTMISRDDMLKLMGNHGLDASPSSVSPYGIVVKGAGNMALTDWYREGMISIQDESSMLV 236

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +       + VLD CAAPGGK+A +   +     + A D+   + + +     RL L +
Sbjct: 237 AEAVQPEPGMRVLDCCAAPGGKSAHMGELMNDEGSIVANDIHAHKGKLISDQASRLGLDS 296

Query: 291 EDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
             I+  DA    D      FD +L+DAPCS  G IRR PD+ W +  +DI + A  Q +L
Sbjct: 297 ISIVTGDALDLADRFEPASFDRILLDAPCSGLGVIRRKPDLKWGKSQEDIHEIAALQLRL 356

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L    + ++PGGI+V+S C+++ +++E VV   L              A  +  +   +L
Sbjct: 357 LESVSTLLRPGGILVYSTCTIEPRENEGVVSAFLEGHSEFAIAEDGLGALSRLGE--NSL 414

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVAL-RR 440
           +  G I+I P             DGF+   L RR
Sbjct: 415 ARGGGIQILPQHY--------HSDGFYIARLGRR 440


>gi|158320464|ref|YP_001512971.1| sun protein [Alkaliphilus oremlandii OhILAs]
 gi|158140663|gb|ABW18975.1| sun protein [Alkaliphilus oremlandii OhILAs]
          Length = 445

 Score =  277 bits (709), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 103/461 (22%), Positives = 187/461 (40%), Gaps = 41/461 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  +  +L  +          L+ E  + ++ LL   D+ L+  +V   L     ID
Sbjct: 1   MNPREGALKVLYEINVNEAFSNIALNKELNNESYNLL---DRNLLTELVYGVLENQIYID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            VL       L +       LLR+ + Q+L+LD V  +A V+  V  +K+    +     
Sbjct: 58  HVLSQFSNFQLDKMNPYTLNLLRLGIYQLLFLDRVPSFAAVNETVNLSKKYC--KKTTGF 115

Query: 124 VNSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           +N +LR V R +  +            ++     PEW  +     +    V  +  A   
Sbjct: 116 INGVLRNVQRNRNNIKMPKPEKNRIKYLSIRYSHPEWLVQLFLKHFDVNFVEELLKANNK 175

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWV 225
              + L +      +      L A        ++       +   +I     + +G   +
Sbjct: 176 KPDLYLRINTLKISVADCIQLLEAEGYVVEQSKIVEEAIVVKGIHNIEKTDFYKKGYIQI 235

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD S+ +  +         V+D+C+APGGKT  +   + +  K+ A D+ + +L+ +   
Sbjct: 236 QDISSMLVAKALAPKEGELVMDICSAPGGKTTHIAQLMNNKGKIIARDIHEHKLKLIDRT 295

Query: 283 LDRLHLYAEDI--IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
             RL ++         D  D       D VLVDAPCS  G IRR P++ + ++  DI   
Sbjct: 296 AKRLGIHIIQTEKFSGDHLDESFIHKADKVLVDAPCSGLGIIRRKPEIKYRKEAQDITSI 355

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q K+L     +VK  G +V+S C+++ ++++ +VQK L           L     + 
Sbjct: 356 VELQYKILKTAAQYVKIEGTLVYSTCTINPEENDHIVQKFLEQHQNYT----LVHLNNEY 411

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            D+ +    +  I++ P++        +G DGFF    +R+
Sbjct: 412 QDIILQEPNKATIQLYPNI--------NGTDGFFIAKFKRI 444


>gi|254472533|ref|ZP_05085933.1| SUN protein [Pseudovibrio sp. JE062]
 gi|211958816|gb|EEA94016.1| SUN protein [Pseudovibrio sp. JE062]
          Length = 415

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 171/417 (41%), Positives = 245/417 (58%), Gaps = 6/417 (1%)

Query: 24  SLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQ 83
            L C LDL  G   ++ L   D+ LVRAI+   LR   +I  V+D  L   +P K   + 
Sbjct: 2   PLDCELDLNNGHPGYKRLEPNDRALVRAIIGTALRRRGQIQDVIDRFLDRPIPEKTGRVL 61

Query: 84  QLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELL-QRI 142
            +L V++AQ+ ++ V D+A V LAV  A RD   + +  LVN++LRR +RE   ++ ++ 
Sbjct: 62  DILHVAMAQLFFMSVPDHAAVSLAVTLAGRDGRAKPYKNLVNAVLRRATREGAAIIAEQD 121

Query: 143 AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVMLPTGG 202
           A     PEW   R    YG+E   A+S A ++  Y+DLTV  D E WA KL   +     
Sbjct: 122 AEKLNAPEWMFARWCEVYGEEAARAMSAAHMTEPYLDLTVPADREAWAEKLGGEVQLGYS 181

Query: 203 IRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS 262
           +RL+     I  L GF +G WWVQDA+A++P +L G +    V DLCAAPGGKT QL  +
Sbjct: 182 VRLQP-DGPIEKLEGFDDGKWWVQDAAAAVPARLLGDIKGKVVADLCAAPGGKTMQLAAA 240

Query: 263 GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTI 322
           GA VTA+D+S RRL++L  NL R+ L AE     D  ++ P  LFDA+L+DAPCS+TGTI
Sbjct: 241 GADVTAVDISARRLQRLTQNLKRVGLEAE-TEISDLREFVPIDLFDAILLDAPCSATGTI 299

Query: 323 RRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLR 382
           RRHPDV W +  DD++K A  Q +LL + + ++KPGG +V+  CSL++++ E  +Q++L 
Sbjct: 300 RRHPDVAWLKREDDVLKLADLQYELLEKALGWLKPGGTLVYCTCSLEQEEGELQIQRLLL 359

Query: 383 SSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
             P  V+ VP+ +     +  A A++ +G  R  P         S G+DGFFA  LR
Sbjct: 360 EHP-EVQRVPVTAEELGGV--AEAINSQGDFRAMPGQNLSSGKTSGGLDGFFAARLR 413


>gi|329926565|ref|ZP_08280978.1| ribosomal RNA small subunit methyltransferase B [Paenibacillus sp.
           HGF5]
 gi|328939106|gb|EGG35469.1| ribosomal RNA small subunit methyltransferase B [Paenibacillus sp.
           HGF5]
          Length = 442

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/454 (26%), Positives = 205/454 (45%), Gaps = 39/454 (8%)

Query: 12  SHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVL 71
            ++L+ V ++      LL+     S    L++ D  L   ++  T+  L  +D  LD  +
Sbjct: 1   MNVLTQVEQEGAYSNLLLNSALQKS---SLAKSDAGLATELIYGTISRLNTLDYFLDKFV 57

Query: 72  ISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRR 130
              + + +  ++ LLR+S+ QI+YLD + D+AVV  AV  AKR + ++  + +VN +LR 
Sbjct: 58  NKGVRKLQPWVRALLRISLYQIVYLDRIPDHAVVSEAVNLAKR-RGHQGISGMVNGVLRN 116

Query: 131 V--------SREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           +          E +   QRI+ +   P+W  ER  + YG E   AI  A   P  + + V
Sbjct: 117 ILRQKETLAIPEDMTDAQRISLLHSHPQWLVERWISQYGTEAAEAICAANNEPPAVSVRV 176

Query: 183 ---KFDIETWAHKLNAVMLPTG------GIRLKELPESIVSLPGFAEGVWWVQDASASIP 233
                  +     + +  L            + +   ++     + +G+  +QD S+ + 
Sbjct: 177 NTTMISRDDMLKLMGSHGLDASPSSVSPYGIVVKGAGNMALTDWYRDGMISIQDESSMLV 236

Query: 234 VQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +       + VLD CAAPGGK+A +   +     + A D+   + + +     RL L +
Sbjct: 237 AEAVQPEPGMRVLDCCAAPGGKSAHMGELMKDEGSIVANDIHAHKGKLISDQASRLGLDS 296

Query: 291 EDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
             I+  DA    D      FD +L+DAPCS  G IRR PD+ W +  +DI + A  Q +L
Sbjct: 297 ISIVTGDALDLADRFEPASFDRILLDAPCSGLGVIRRKPDLKWGKSQEDIHEIAALQLRL 356

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L    + ++PGGI+V+S C+++  ++E V+   L              A  +  +   +L
Sbjct: 357 LESVSTLLRPGGILVYSTCTIEPMENEGVISAFLEGHSEFAIAEDGLGALSRLGE--NSL 414

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVAL-RR 440
           S  G I+I P             DGF+   L RR
Sbjct: 415 SRGGGIQILPQHY--------HSDGFYIARLGRR 440


>gi|268593572|ref|ZP_06127793.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rettgeri DSM 1131]
 gi|291310849|gb|EFE51302.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rettgeri DSM 1131]
          Length = 427

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 120/457 (26%), Positives = 219/457 (47%), Gaps = 45/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+    SL+ +L         R ++ +D+ L++ I    LR+L
Sbjct: 1   MKNTYNLRSIAATAIFQVLDNGQSLSTVLPDL-----QRNINDKDKALLQEICFGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+LY  +  +A +   V+ A   K+ +  
Sbjct: 56  PKLEWFISQLMEKPLTGKQRTLHYLIMVGIYQLLYTRIPPHAALAETVDGAVALKKPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR   R++++L +RIA      + P W  +RL+  Y ++    I  +    P+
Sbjct: 115 KGLINGVLRSFQRQQVQLEERIANNTSQYLHPSWLLKRLQTAYPEDWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVWWVQDAS 229
           ++ +         + + L    +                P ++  LPGF +G   VQD S
Sbjct: 175 WLRVNSQHHTAAQYLNLLEQSEITAHLHPSHPNAIRLDEPTAVSRLPGFEDGWSTVQDVS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A    +L    N  S+LDLCAAPGGKT  ++    +  V A+D+ + RL++++ NL RL 
Sbjct: 235 AQGCAELLEPQNGESILDLCAAPGGKTTHILELAPRANVIAVDIDEYRLKRVKENLIRLK 294

Query: 288 LYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
            +A  I         +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q 
Sbjct: 295 QHAVVIQGDGTQPEKWAKDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELAQLQA 354

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L     ++KPGG ++++ CS+  +++ + +Q  L                    D ++
Sbjct: 355 QILEAIWPYLKPGGTLLYATCSIMPEENGKQIQNFLSKHN----------------DASL 398

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
               +  +++ P         ++G DGFF   L + +
Sbjct: 399 NDGTDAGLQVLPS--------TNGGDGFFYARLVKKV 427


>gi|303232029|ref|ZP_07318732.1| ribosomal RNA small subunit methyltransferase B [Veillonella
           atypica ACS-049-V-Sch6]
 gi|302513135|gb|EFL55174.1| ribosomal RNA small subunit methyltransferase B [Veillonella
           atypica ACS-049-V-Sch6]
          Length = 452

 Score =  277 bits (708), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 104/461 (22%), Positives = 189/461 (40%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + RK      +L           LS  D+     +V   +R    +DA
Sbjct: 12  NIRLLAVKALSDINRKGAYANIVLQDYISKY---NLSDLDRRFFTELVYGVVRRRNYLDA 68

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       + +    + ++LR+ V QI+Y+D V + A V+ +V+ AK+    R  +  V
Sbjct: 69  IIVHFAKRPIKKLSSMVVEILRLGVYQIIYMDKVPESAAVNESVKLAKK--LTRGLSGFV 126

Query: 125 NSILRRVSREKI---------ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N+ILR V RE+            ++ I+ I  IP W      + +G+++   +       
Sbjct: 127 NAILRSVIREQDSIGIEDLAANDIEAISFIYNIPLWLINLWISEFGRDKTEDLCAWFNEQ 186

Query: 176 LYIDLTVKF----------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
             +   +             +      +         I +     S+     F +G    
Sbjct: 187 PKLTARINTILIDIPQCLTMLNEQGWAVTQDSNYEDIIYINSHRGSLEKSEAFIKGYITF 246

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +  +L        +LD CAAPGGK+  +   + +   + + D+ + ++E +  N
Sbjct: 247 MDKASMLVARLVNPQPGERILDCCAAPGGKSMYMATLMNNVGSLMSCDIHEHKIELMNSN 306

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            DRL          DA          FD VLVDAPCS  G +++  D+ W +    + + 
Sbjct: 307 ADRLGASIVHTKVQDATKLPDSWNSYFDRVLVDAPCSGLGILQKKLDMRWRKQESILSEL 366

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q  +L +    VK  G +++S C+L+ +++EEVV+  L+       ++P+   +   
Sbjct: 367 PSLQLAILERAAMTVKEKGYLIYSTCTLNYKENEEVVEAFLQKHK-EFSIIPVADDFPLK 425

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                  S  G I   P         +  MDGFF V ++R+
Sbjct: 426 -------SNSGMITTYP--------PTDDMDGFFMVKMQRI 451


>gi|49474771|ref|YP_032813.1| SUN protein (Fmu protein) [Bartonella quintana str. Toulouse]
 gi|49240275|emb|CAF26748.1| SUN protein (FMU protein) [Bartonella quintana str. Toulouse]
          Length = 447

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 195/444 (43%), Positives = 271/444 (61%), Gaps = 9/444 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ K  SL  L D E+G   +  LS RD++L RAI+   LR   +
Sbjct: 7   PGLTVRQVCVRLLGAVLDKHTSLAGLTDNEHGHPQYLGLSHRDRLLCRAILGAALRHRGQ 66

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I A L   L   LP + +SLQ LL +SVAQILYLD+ D+A +DLAV  AK D   R F+ 
Sbjct: 67  ITAALSRFLTRPLPLQAFSLQHLLHISVAQILYLDIPDHAAIDLAVRVAKIDPRMRRFSG 126

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN +LR V+RE + L +++  I  IP WF + L + YGKE+   I         +DLTV
Sbjct: 127 LVNVLLRNVAREAVFLCRKVPTIEEIPGWFGQLLVSTYGKEKADQILAIQSLEPPLDLTV 186

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  ++LP G +RL  L  S+  LPG+A+G WW+QD +A++P  L G +  
Sbjct: 187 KSDSVGWAERLGGIILPNGSVRLSRLNCSVSELPGYADGDWWIQDFAAALPACLLGNIYG 246

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V+DLCA+PGGKTAQL + GA VTA+D+S  RL++L+ N+ RLH       E D  ++ 
Sbjct: 247 KQVVDLCASPGGKTAQLALQGADVTAVDLSAHRLKRLKENMKRLHFS-VRYHEGDVKNFH 305

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           PK+LFDA L+DAPCSSTGTIRRHPD+LWT+   D++K A  Q  LL+  I+ VK GG +V
Sbjct: 306 PKRLFDAALLDAPCSSTGTIRRHPDILWTKSMHDVIKLAALQYDLLVAAIALVKKGGRIV 365

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           FSNCSL +++ E++++K+L +    V L P+ +   +   +A  LS +G +R TP     
Sbjct: 366 FSNCSLAREEGEDLIEKILSTC-NDVVLEPICAE--EMGALAHLLSAKGILRTTPADFCH 422

Query: 423 IDGVSS-----GMDGFFAVALRRL 441
            +  +      GMDGFF    R++
Sbjct: 423 ENFDAEKKMFLGMDGFFTARFRKV 446


>gi|115522058|ref|YP_778969.1| sun protein [Rhodopseudomonas palustris BisA53]
 gi|115516005|gb|ABJ03989.1| sun protein [Rhodopseudomonas palustris BisA53]
          Length = 449

 Score =  277 bits (708), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 170/439 (38%), Positives = 245/439 (55%), Gaps = 5/439 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR +++ +L  V+ KR  L   LD        + LS RD+ L+R +V   LR L  
Sbjct: 13  PGLAARRIAADILDGVLHKRRMLDDQLDGPAAHPGLKTLSDRDRALMRRLVATILRKLGT 72

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +  VL  +L   +P      Q  L +  AQIL+++V D+A VDL+V   + D+    +A 
Sbjct: 73  LGHVLSRLLDRGVPTDAPRAQSALLIGAAQILWMEVPDHAAVDLSVRLVQSDRRAAKYAG 132

Query: 123 LVNSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           LVN++LRR +RE   L+  + G    +P W   R    YG+E    I+ A      +DLT
Sbjct: 133 LVNAVLRRCAREGQPLIAEVQGQPIDLPPWLFARWSAHYGEETARKIALALGEEPSLDLT 192

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK DIE WA +L+  +LPTG +R   L  S+  L G+ +G WWVQDA+A++P +LFG L 
Sbjct: 193 VKSDIEAWAARLHGEILPTGTLR-TALQGSVKMLHGYEDGQWWVQDAAAALPARLFGALQ 251

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              +LDLCAAPGGKTAQL + GA VTA+D S  R+ +L+ NL RL L  E ++       
Sbjct: 252 GQRILDLCAAPGGKTAQLALGGANVTAIDRSPNRVARLKENLARLSLKVETVVADATEWD 311

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
                FD VLVDAPCSSTGTIRRHPD+ W +   DI      Q +LL +  S +KPGG +
Sbjct: 312 GGDTRFDGVLVDAPCSSTGTIRRHPDIAWLKQEADIATLGALQARLLQKASSLLKPGGTL 371

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E      L ++   +  +P+  A  +   +A  ++ +G +R  P  L 
Sbjct: 372 VYCTCSLEPEEGE-QAIAALLAADATLRRLPIEPA--EVAGLAEIVTADGDLRTLPCHLP 428

Query: 422 KIDGVSSGMDGFFAVALRR 440
             D   +G+DGF+A  L +
Sbjct: 429 HPDAKLAGLDGFYAARLVK 447


>gi|163941603|ref|YP_001646487.1| sun protein [Bacillus weihenstephanensis KBAB4]
 gi|163863800|gb|ABY44859.1| sun protein [Bacillus weihenstephanensis KBAB4]
          Length = 444

 Score =  277 bits (707), Expect = 3e-72,   Method: Composition-based stats.
 Identities = 112/461 (24%), Positives = 200/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     +    + ++D  L+  +V  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKN---TIDRKDIGLLTEMVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q+LYLD V + A +  AVE AKR + ++  + 
Sbjct: 59  DYYLQPFLRKKVE---AWVRVLLRLSLYQMLYLDRVPERAAIHEAVEIAKR-RGHKGISG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE           ++R+A  +  P W  +   + YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSLEEIENPVERLAIATSHPMWLVQEWASEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKVTVEEAVALLADEGIEAKRGELSEDAIQIERGNVAHTEAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +        +VLD CAAPGGKT  +        KV +LD+   ++  +     
Sbjct: 235 ESSMLVARALEPNKGDTVLDSCAAPGGKTTHIAERLDGTGKVMSLDLHAHKVRLIEQQAK 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   + + +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLGLENVETMALDARKVQEHFANESFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P       +     + +
Sbjct: 355 TIQLAILEKIAPLLKQGGRLVYSTCTIEKIENEQVIKQFLQEHPEFEWDTTIKDRMPEKL 414

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG +RI P             DGF+   LR+ +
Sbjct: 415 N---PYIDEGQVRILPHYFA--------TDGFYIACLRKKV 444


>gi|152976231|ref|YP_001375748.1| sun protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
 gi|152024983|gb|ABS22753.1| sun protein [Bacillus cytotoxicus NVH 391-98]
          Length = 444

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 113/461 (24%), Positives = 197/461 (42%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S      ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLMQVEKSGAYSNLLLNHLIEKSTIH---KKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L     +    ++ LLR+S+ Q+LYLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLRK---KVDAWVRVLLRLSLYQMLYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSREKIE-------LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE +         ++R+A     P W  +     YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSLDELKDPVERLAIAMSHPTWLVQEWVAAYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHK--------LNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T            + A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAIDLLNQEGVEAKRGDLSDDAIQIEKGNVAHTEAFQKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         +LD CAAPGGKT  +        KV +LD+   ++  ++   +
Sbjct: 235 ESSMLVARAVEPSKGDMILDSCAAPGGKTTHMAERLRGTGKVMSLDLHDHKVRLIKQQAN 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   ++  D  + +
Sbjct: 295 RLGLENVETKALDARKVQEHFQNESFDKILVDAPCSGFGVIRRKPDIKLGKEKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q+ +L +    +K GG +V+S C+++K ++E+VV   L+  P   E     +   +  
Sbjct: 355 TIQQTILDKVAPLLKTGGRLVYSTCTIEKIENEQVVANFLQKHP---EFEWDTTMQERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       +G ++I P             DGF+   LR+ +
Sbjct: 412 EKLRPYINKGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|65321192|ref|ZP_00394151.1| COG0144: tRNA and rRNA cytosine-C5-methylases [Bacillus anthracis
           str. A2012]
          Length = 444

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 112/461 (24%), Positives = 200/461 (43%), Gaps = 40/461 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
             N R ++   L  V +       LL+     S    + ++D  L+  IV  T++    +
Sbjct: 2   RQNVRELALDGLIQVEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTL 58

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D  L   L   +      ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A 
Sbjct: 59  DYYLQPFLKKKVE---AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAG 114

Query: 123 LVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +VN +LR + RE         + ++R+A  +  P W  +     YG E    + +  + P
Sbjct: 115 MVNGVLRSIQREGVPSVDEIKDPVERLAIATSHPVWLVQEWTAEYGLETAEKMCEVNMLP 174

Query: 176 LYIDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQD 227
                 V  D  T    +         A         ++    ++     F +G   +QD
Sbjct: 175 PVPTARVNVDKITVEEAITLLASEGIEAKRGDLSDDAIQIXKGNVAHTDAFKKGFLSIQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLD 284
            S+ +  +         +LD CAAPGGKT  +        +V +LD+   ++  ++   +
Sbjct: 235 ESSMLVARALEPDEGDVILDSCAAPGGKTTHIAERLKGTGQVMSLDLHAHKVRLIKQQAE 294

Query: 285 RLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           RL L   +   +D     ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +
Sbjct: 295 RLXLENVETKALDARKVQEHFANEXFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLS 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q  +L +    +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  
Sbjct: 355 MIQFAILEKXAPLLKQGGRLVYSTCTIEKIENEQVIERFLQEHP---EFEWDTTIKERMP 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +       EG ++I P             DGF+   LR+ +
Sbjct: 412 EKLSPYMDEGQVQILPHYFA--------TDGFYIACLRKKV 444


>gi|238896785|ref|YP_002921530.1| 16S rRNA methyltransferase B [Klebsiella pneumoniae NTUH-K2044]
 gi|238549112|dbj|BAH65463.1| 16S rRNA m5C967 methyltransferase [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 431

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 119/456 (26%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVVEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVEANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   LN   L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLNETGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 VKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L    + +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNATWTHLKPGGTLVYATCSILPEENSQQIAAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGVEEGDGFFYAKLIK 428


>gi|296331149|ref|ZP_06873623.1| RNA-binding Sun protein [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305674305|ref|YP_003865977.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus subtilis
           subsp. spizizenii str. W23]
 gi|296151793|gb|EFG92668.1| RNA-binding Sun protein [Bacillus subtilis subsp. spizizenii ATCC
           6633]
 gi|305412549|gb|ADM37668.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus subtilis
           subsp. spizizenii str. W23]
          Length = 447

 Score =  276 bits (706), Expect = 4e-72,   Method: Composition-based stats.
 Identities = 130/463 (28%), Positives = 211/463 (45%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   + R ++   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKKN-SVRDIALEALIKLEQNQAYSNLLLKSVIKSN---ELSDQDRALLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S+ Q+ YL+ + D A +  AVE AK  + ++ 
Sbjct: 57  IALDYMLKPFINKP-QKVKPWVIQLLRLSLYQMEYLEKIPDRAAIHEAVEIAK-IRGHKG 114

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN +LR + RE         + ++R+A  +  PEW  +   + YG +    I    
Sbjct: 115 IASFVNGVLRSIQREGVPSFDAIEDPVRRLATETSHPEWLVKEWTDAYGFDAAEKICRIH 174

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKE-----LPESIVSLPGFAEGVWW 224
           + P    L V     D      ++ A  +      L E     L  SI     F  G   
Sbjct: 175 LIPPRQTLRVNQMKADRADLLDQMAAEGIEVENGDLAEDAVKLLKGSIAGTHFFQNGEVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +        +VLD CAAPGGK+A +   + +   VT+LD+ K +++ ++ 
Sbjct: 235 IQDESSMLVARALDPKPGETVLDACAAPGGKSAHIGELMENKGSVTSLDLHKHKVKLIKE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             DRL L   D   MDA           FD +LVDAPCS  G IRR PD+ +T+  DD  
Sbjct: 295 AADRLGLTIIDAKTMDARKAGETFENGQFDRILVDAPCSGFGVIRRKPDMKYTKKPDDST 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q  +L +    VK GG +V+S C++D+ ++EEV+   ++  P      P  S   
Sbjct: 355 RLAEIQLSILREIAPLVKKGGTLVYSTCTMDRTENEEVIHAFIQEHPDF---EPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  + A     +G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKARPFVRDGRVQILPHYF--------GTDGFFICSMRKK 446


>gi|28210910|ref|NP_781854.1| 16S rRNA M(5)C 967 methyltransferase [Clostridium tetani E88]
 gi|28203349|gb|AAO35791.1| 16S rRNA M(5)C 967 methyltransferase [Clostridium tetani E88]
          Length = 454

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 113/455 (24%), Positives = 200/455 (43%), Gaps = 41/455 (9%)

Query: 8   RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVL 67
           R V+  +L  V  K       L+          L+++D+  +  +V  T+++   ID +L
Sbjct: 17  RKVAIEVLDAVFLKNAYSNIALNNALNKYK---LNEKDKAFITELVYGTIKYRHTIDTIL 73

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNS 126
           +  +   +      +  +LR+ + Q+ YLD V  +A V+  VE  K   +++   KL+N 
Sbjct: 74  NSYIKKGIKSVDKYVLNILRIGIYQLRYLDKVPSFAAVNECVELGK--VKSKGTGKLING 131

Query: 127 ILRRVSREKIELLQRIA-------GISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           +LR   R K       +            P+W  +     YG+E++  I     S   I 
Sbjct: 132 VLRNYIRNKDPKYYDESNLVEKLSFEYSYPKWMIDLFLKQYGREKIEEILKGLNSIPSIT 191

Query: 180 LTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASA 230
           + V      +    N            L            +I   P F EG+  VQD SA
Sbjct: 192 VRVNNIKSDYESVWNSLEDNNYNIEEGLVCPEAIRIIKGRAIEKNPLFKEGLITVQDESA 251

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLH 287
            +        +N++V+DLC+APGGKT  +   + +  KV A D+ + +L+ ++ N +RL 
Sbjct: 252 MLVAGAMDLEDNMNVMDLCSAPGGKTTHISEIMNNTGKVLAFDIHENKLDLIKQNKERLG 311

Query: 288 LYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           +   D+I  D   Y  K     + +L+DAPCS  G IR+ P++ +T+   D+      QR
Sbjct: 312 VKNIDLILGDGTLYNKKYSEFANRILIDAPCSGLGIIRKKPEIKYTKSAKDLKSIVHIQR 371

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           K+L  G  ++K  GI+++S C+L+K+++ E V+  L+  P       +   +  ++D   
Sbjct: 372 KILENGAKYLKKNGILLYSTCTLNKKENIENVKWFLKEFPNF----KIEKIFLGNLD-NF 426

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                G + I P+           MDGF+    ++
Sbjct: 427 IYDEYGTLTILPNEY---------MDGFYIAKFKK 452


>gi|251788002|ref|YP_003002723.1| 16S rRNA methyltransferase B [Dickeya zeae Ech1591]
 gi|247536623|gb|ACT05244.1| sun protein [Dickeya zeae Ech1591]
          Length = 431

 Score =  276 bits (705), Expect = 6e-72,   Method: Composition-based stats.
 Identities = 130/459 (28%), Positives = 219/459 (47%), Gaps = 44/459 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ +L  V+ +  SL+ LL +   D     +S++D+ L++ I    LR L
Sbjct: 1   MKSTYNLRSIAATVLVQVVEQGQSLSQLLPVFQRD-----ISEKDRGLLQEICFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  L  ++   L  K+  L  LL V + Q+++  +  +A +   V  A   K  +  
Sbjct: 56  PQLDWYLRQLMAKPLTGKQKVLHYLLMVGIYQLIHTRIPPHAALAETVNAAVTLKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ EL QR+         P+W  +RL+  Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELQQRLQNNTARYSHPDWLLQRLKKAYPDQWEQIIDANNQHPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    E +   L    +                P ++  LPGF +G   VQDAS
Sbjct: 175 WLRVNRLHHSREAYLVLLQEKGIEAHPHPFYTDAIRLITPCAVSGLPGFDQGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N+  +LDLCAAPGGKT  ++     A+V A+DV ++RL++++ NL RL 
Sbjct: 235 AQGCIHWLSPKNHEDILDLCAAPGGKTTHILEAAPQARVLAVDVDEQRLKRVKENLQRLR 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A D+   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHA-DVKCGDGRTPEAWCADQCFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELASLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           + +L      +K GG +V++ CS+  +++ + +   L+  P  +                
Sbjct: 354 QAILEAIWPRLKNGGTLVYATCSVLPEENSQQIAAFLQHHPDAIL-------------AD 400

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
              +    I++ P        +    DGFF   L +  Q
Sbjct: 401 TGNTTSPGIQVLP--------MPEDGDGFFYAKLVKSGQ 431


>gi|152972197|ref|YP_001337343.1| 16S rRNA methyltransferase B [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|224493256|sp|A6TEU2|RSMB_KLEP7 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|150957046|gb|ABR79076.1| 16S rRNA m5C967 methyltransferase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
          Length = 431

 Score =  276 bits (704), Expect = 7e-72,   Method: Composition-based stats.
 Identities = 119/456 (26%), Positives = 211/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVVEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPEQWQEIVEANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   LN   L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLNEAGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 VKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNAIWGHLKPGGTLVYATCSILPEENSQQIAAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGVEEGDGFFYAKLIK 428


>gi|262040752|ref|ZP_06013983.1| RNA methyltransferase Sun [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259041896|gb|EEW42936.1| RNA methyltransferase Sun [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 431

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 119/456 (26%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVIEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPEQWQEIVEANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   LN   L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLNEAGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 VKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L    + +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNATWAHLKPGGTLVYATCSILPEENSQQIAAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGVEEGDGFFYAKLIK 428


>gi|210622413|ref|ZP_03293145.1| hypothetical protein CLOHIR_01093 [Clostridium hiranonis DSM 13275]
 gi|210154229|gb|EEA85235.1| hypothetical protein CLOHIR_01093 [Clostridium hiranonis DSM 13275]
          Length = 441

 Score =  275 bits (703), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 108/460 (23%), Positives = 205/460 (44%), Gaps = 43/460 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR  +  +L  +  ++      ++  + +     +S +D+ L   +V   +     +D
Sbjct: 1   MNAREAAFKILCDIEIEKNYSNMAINKIFKNEK---ISDKDKGLATELVYGVIENRKYLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +++ +    + +    ++ +LR+   QIL+LD + D+A V+  V+ A +          
Sbjct: 58  FIINKLSKIKVKKMSSFVKIILRMGTYQILFLDKIEDHAAVNETVKLASKYDG--KSKGF 115

Query: 124 VNSILRRVSREKIELLQRI--------AGISIIPEWFKERLENFYGKERVLAISDACISP 175
           VN+ILR   R+K  +            A      +W  E     +G E    + +A    
Sbjct: 116 VNAILRNEIRQKRTIKYIDIEDPIRRLAVKYSYQQWIVEDWVKNFGIEFAEELLEALNER 175

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQ 226
             + +       D  +   +     +      L       E  + I S   + EG++ VQ
Sbjct: 176 PDLYVRTNTLKIDRNSLLKEFEKEGIKASKAMLPEEAIMVENFKGIESSRLYKEGLFTVQ 235

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ +  ++        VLD+C+APGGK+  +   + +  K+ + DV + +++ ++   
Sbjct: 236 DISSMLVAKVVAPKEGDMVLDMCSAPGGKSTHMAELMKNTGKIVSRDVFEHKIKVIKAAA 295

Query: 284 DRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
            RL +   +  E DA +      + FD VL D PCS  G IRR P++ +     ++V   
Sbjct: 296 KRLGITNIEAEEFDAANLDENSIEKFDCVLTDVPCSGLGIIRRKPEIKYKAKE-ELVDLP 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q K+L     +VK  G +V+S C++   ++ EVV+K L+ +P   ELVP+     + I
Sbjct: 355 KIQSKILENASKYVKINGTLVYSTCTVQDCENIEVVEKFLKENPN-YELVPI-----EGI 408

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ++      +G+I+I P++         GMDGFF   ++R+
Sbjct: 409 NVDPEEQEKGYIKIYPNV--------HGMDGFFIAKMKRV 440


>gi|260887300|ref|ZP_05898563.1| ribosomal RNA small subunit methyltransferase B [Selenomonas
           sputigena ATCC 35185]
 gi|330838946|ref|YP_004413526.1| sun protein [Selenomonas sputigena ATCC 35185]
 gi|260862936|gb|EEX77436.1| ribosomal RNA small subunit methyltransferase B [Selenomonas
           sputigena ATCC 35185]
 gi|329746710|gb|AEC00067.1| sun protein [Selenomonas sputigena ATCC 35185]
          Length = 443

 Score =  275 bits (703), Expect = 9e-72,   Method: Composition-based stats.
 Identities = 111/459 (24%), Positives = 191/459 (41%), Gaps = 43/459 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
            AR  +   L  V  K       L      +    LS+ D+     +     +    +D 
Sbjct: 3   KARETALKALHEVNEKGAYANVALARSLRAAK---LSEVDRRFATELAYGAAKAGGTLDW 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L   L   L +    ++ +LR+ + Q+ +L  V   A  + AVE  KR   +    K V
Sbjct: 60  ILRRYLNRPLSKIPPMVRDILRLGIYQLFFLARVPASAACNTAVEMTKRC-SHAGTVKFV 118

Query: 125 NSILRRVSREKIELLQRIAGIS---------IIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR  +RE  +                    PEW   R    +G E   A+ +   + 
Sbjct: 119 NAVLRTAAREPEKAAFPTGKAHEAENLALSLQHPEWLVRRWIEQFGYEEARALCEFDNAQ 178

Query: 176 LYIDLTVKF---DIETWAHKLNAVML------PTGGIRLKELPESIVSLPGFAEGVWWVQ 226
             + L         +    +L+   +       T    L     S+ +L    +G++ VQ
Sbjct: 179 ATLSLRTNTLKITRDKLLERLSKEGVEAEPSAWTPEGILFLRHGSLDALESLQQGLFQVQ 238

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ +   +        VLD+C+APGGKT  +   +    ++ ALDV + ++ ++  N 
Sbjct: 239 DESSMLVAHVLAPEPGEFVLDVCSAPGGKTTHIAASMGDCGRIVALDVHEHKMRRIAENC 298

Query: 284 DRLHLYAEDIIEMDAFD--YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           +RL + + + + +DA +      +  D VLVDAPCS  G +RR PD  W +  DD+   A
Sbjct: 299 ERLGIKSVEPLLLDAREAGRRFPRQADRVLVDAPCSGLGVLRRKPDARWRKRPDDLAALA 358

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             QR++L      VK GG++V+S C+++++++E VV+  L             S      
Sbjct: 359 RLQREILSSAAEAVKSGGVLVYSTCTIEREENEAVVEDFLARHEEF-------SLENAGE 411

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            + +   PE  +++ P           G DGFF   +RR
Sbjct: 412 LLPLKKRPEQMLQLYPQ--------RDGTDGFFIARMRR 442


>gi|159030883|emb|CAO88564.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 446

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 113/459 (24%), Positives = 198/459 (43%), Gaps = 41/459 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR ++  +L  + R        LD     S+   L   D+ L   IV   +R    +DA
Sbjct: 3   NARQLALLILRDIDRSSAYPDRALDRHLSASSLNCL---DKALTTEIVYGIVRRQRTLDA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +LD +   +  ++   L+++L + + Q+ YL  +   A V+ AVE  K     +  A +V
Sbjct: 60  LLDRLGKKTAAQQPPDLRRILHIGLYQLRYLSQIPPSAAVNTAVELTKISHLGK-LAAVV 118

Query: 125 NSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAISDACIS 174
           N +LR+  R        +            +   P+W  +   + +G      +      
Sbjct: 119 NGMLRQYLRLTANGDDPLILPENTASRLGILHSFPDWLVQLWLDRFGVTETEQLCQWFNR 178

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGG------IRLKELPESIVSLPGFAEGVWWV 225
              +D+ +       E   ++L +  +           RL     +I  L GF  G + +
Sbjct: 179 SPDLDIRINPLKTSREALENELESANITFNHLKLPLACRLTSGLGNIERLEGFRAGNYTL 238

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD SA +   L       +++D CAAPGGKT  +   +    ++ A D +  RL +L  N
Sbjct: 239 QDISAQLVTHLLDPQPGETIIDACAAPGGKTTHIAELMGDRGRILACDQTPSRLRQLEAN 298

Query: 283 LDRLHLYAEDIIEMDAFDYCPKK-LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           + RL L A +I   D+ D      + D VL+DAPCS  GT+ + PD+ W +  +++   A
Sbjct: 299 IKRLDLKAIEIHLGDSRDRPQWCGIADRVLIDAPCSGLGTLHKRPDIRWRQTPENLPVLA 358

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q +LL    ++VKP GI+V++ C+L+  ++E V+++ L + P      P +++     
Sbjct: 359 KRQGELLASAATWVKPKGILVYATCTLNPLENERVIEQFLAAHPDWKMAPPDSNSC---- 414

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +   +  G I + P             DGFF   L +
Sbjct: 415 -FSEYYTETGAIEVLPH--------RHNQDGFFMAKLVK 444


>gi|330002246|ref|ZP_08304257.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp. MS
           92-3]
 gi|328537385|gb|EGF63634.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp. MS
           92-3]
          Length = 431

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 119/456 (26%), Positives = 211/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKNINLRSLAAQAIEQVVEKGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLISKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFAEHENRYLHPKWLLKRLQQAWPEQWQEIVEANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   LN   L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLNETGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLQPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNAIWGHLKPGGTLVYATCSILPEENSQQIAAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGVEEGDGFFYAKLIK 428


>gi|157373174|ref|YP_001471774.1| sun protein [Shewanella sediminis HAW-EB3]
 gi|157315548|gb|ABV34646.1| sun protein [Shewanella sediminis HAW-EB3]
          Length = 426

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 125/448 (27%), Positives = 206/448 (45%), Gaps = 35/448 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L  +         S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALPDQQRHLE----SGKDKALMAELCYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  L QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KLVSDCMSKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++  L      ++   P W  +RL+  Y +     +  +   P        
Sbjct: 116 NGVLRNIQRQEKPLPTDNETLALNTPAWIIKRLKAAYPESWKEIVEQSHQRPPMWLRSNK 175

Query: 182 VKFDIETWAHKLNAVMLP-----TGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
           +    + +   L  V +      +    L E P+ ++ LPGF EG   VQD +A     L
Sbjct: 176 LSQTRDEYLASLAEVEIQASAGKSSDAILLESPKDVLQLPGFEEGTASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA--ED 292
              ++   VLD CAAPGGKT          ++ A+D    RLE+++ NLDRL L A    
Sbjct: 236 LAPIDGELVLDACAAPGGKTCHLLEQAPNIELVAVDFDANRLERVQQNLDRLSLNAKLIH 295

Query: 293 IIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
               D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q K+L    
Sbjct: 296 GDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIEELASLQSKILDHCW 355

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++++ CS+  Q++E+ ++  L  +     LVP++               +  
Sbjct: 356 QWLKPGGTLLYATCSILPQENEQQIRAFLERA-NDATLVPIDEQNHP---------DDIG 405

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +ITP +          MDGF+   L +
Sbjct: 406 WQITPGL--------ENMDGFYYARLVK 425


>gi|295706330|ref|YP_003599405.1| ribosomal RNA small subunit methyltransferase B [Bacillus
           megaterium DSM 319]
 gi|294803989|gb|ADF41055.1| ribosomal RNA small subunit methyltransferase B [Bacillus
           megaterium DSM 319]
          Length = 446

 Score =  275 bits (702), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 116/464 (25%), Positives = 206/464 (44%), Gaps = 40/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R ++  +L  + + +     LL+        R +  +D  L+  IV  T++  
Sbjct: 1   MSK-YNVRDIALDILLAIEKNQAFSNLLLNNSIQK---RGIQGKDAGLLTEIVYGTIQRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L +   + +  ++ LLR+S+ Q++YLD V D A++  AVE AK+ + ++ 
Sbjct: 57  DTLDYGLAPFLKNP-KKLQPWVRVLLRLSLYQMVYLDRVPDRAILHEAVEIAKK-RGHKG 114

Query: 120 FAKLVNSILRRVSR-------EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            A +VN +LR + R       E    ++R+A  +  P W  +R    YG ++   I  A 
Sbjct: 115 IASMVNGVLRNIQRSGTPSLEEIQNPVERLAIETSHPLWLVKRWVEQYGLDKTRGICLAN 174

Query: 173 ISPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIR-----LKELPESIVSLPGFAEGVWW 224
           +      + V             L    +           L+    +      F EG++ 
Sbjct: 175 LMAPKQTIRVNSARFTQNEVKEALEKEGIVVEPGHFVEEALEVQKGNAAHTQAFREGMFT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           VQD S+ +     G      +LD CAAPGGK+      + +  KV +LD+   +++ +  
Sbjct: 235 VQDESSMLVAHALGAEAEELILDSCAAPGGKSTHIAEQLRNSGKVISLDIHDHKVKLIAQ 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             +RLHL   +    D+        K++FD +LVDAPCS  G +RR PD+ +T+   DI 
Sbjct: 295 QAERLHLTNIEPTVQDSRKAGEQFDKEMFDRILVDAPCSGFGVMRRKPDLKYTKTEQDIK 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q+ +L      +K GG +V+S C++D+ ++ +VV   L       +   L +   
Sbjct: 355 QLARIQQDILNAVAPLLKKGGTLVYSTCTIDRDENGDVVAAFLADHADFQKDETLAARMP 414

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           + +   +     G I++ PD            DGF+   L++ +
Sbjct: 415 QKLKQNV---KHGEIQLLPDAQ---------SDGFYIACLQKKV 446


>gi|294138832|ref|YP_003554810.1| ribosomal RNA small subunit methyltransferase B [Shewanella
           violacea DSS12]
 gi|293325301|dbj|BAJ00032.1| ribosomal RNA small subunit methyltransferase B [Shewanella
           violacea DSS12]
          Length = 425

 Score =  274 bits (701), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 121/447 (27%), Positives = 205/447 (45%), Gaps = 34/447 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +   V+ K ISL+  L  +         S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVAFQVLEKGISLSVALPDQQKHLE----SGKDKALLAELSYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KLVSDCMSKPLKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++  L      ++   P W  +RL+  Y +     I  +   P     +  
Sbjct: 116 NGVLRNIQRQEKPLPTDNDTLAFNTPSWIVKRLKAAYPENWQEVIEQSHQRPPMWLRNNK 175

Query: 182 VKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                + +   L      A    +    L E P  +  LPGF +G   VQD +A     L
Sbjct: 176 RSQTRDEYLAALAEIDIPASAGKSSDAILLESPRDVAQLPGFDQGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIV-SGAKVTALDVSKRRLEKLRCNLDRLHLYA--EDI 293
               +   VLD CAAPGGKT  L+  +  ++ A+D  ++RLE+++ NLDRL L A     
Sbjct: 236 LAPKDGELVLDACAAPGGKTCHLLELANIQLVAVDFDEKRLERVQQNLDRLSLDAKLVHG 295

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
              D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q K+L     
Sbjct: 296 DAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQSDIDELAALQSKILDHCWQ 355

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWI 413
           ++KPGG ++++ CS+  Q++E+ ++  L  +     L+P++       D+   ++     
Sbjct: 356 WLKPGGTLLYATCSILPQENEQQIRSFLERA-DDATLIPISE-QPHPDDIGWQIT----- 408

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRR 440
                        +  MDGF+   L +
Sbjct: 409 -----------PGTENMDGFYYARLVK 424


>gi|17986519|ref|NP_539153.1| 16S rRNA m(5)C 967 methyltransferase [Brucella melitensis bv. 1
           str. 16M]
 gi|17982123|gb|AAL51417.1| 16S rRNA m(5)c 967 methyltransferase [Brucella melitensis bv. 1
           str. 16M]
          Length = 424

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 184/429 (42%), Positives = 250/429 (58%), Gaps = 10/429 (2%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           ++ K  SL  L D  +G   +  L  RD+ LVRAI+   L     I+  ++  L   LP 
Sbjct: 1   MIEKNTSLDGLTDNAHGHPQYLALEPRDRALVRAILGSALHNRGSIERAINKRLDRPLPE 60

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRR-VSREKI 136
              +L+ LL V+VAQI YLD+ D++ VDLAVE A  D  NR +A LVN++LRR    ++ 
Sbjct: 61  NAVALKHLLHVAVAQIFYLDLPDHSAVDLAVEAANSDPRNRKYAGLVNALLRRLARNKER 120

Query: 137 ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
            L       + +PEWF + + + YG E+   I         ID TVK D + WA KL  V
Sbjct: 121 ALAHTFEPEANVPEWFAKSITDAYGTEKAATILAMHAYEPPIDFTVKGDAKAWAEKLGGV 180

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
            LP G +RL+ +  ++  LPGFAEG WWVQD +AS+P +L   +    V DLCAAPGGKT
Sbjct: 181 ALPNGSVRLQTVESNLTDLPGFAEGEWWVQDVAASLPARLMDDIKGKRVADLCAAPGGKT 240

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQL++ GA VTALD+S+ RL++L  NL+RL   A+ +   +  D+ P +LFDAVL+DAPC
Sbjct: 241 AQLVLQGADVTALDLSENRLKRLNANLERLGFEAKTV-ATNLMDFKPDELFDAVLLDAPC 299

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+   DI K A  Q KLL    + VKPGG++VFSNCSL   + EE+
Sbjct: 300 SSTGTVRRHPDVPWTKTPQDIAKLAELQGKLLAHAATLVKPGGVIVFSNCSLHPLEGEEM 359

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE----KIDGVSSGMDG 432
            +K     P    L P          +   ++ EG++R TP  L       +   +GMDG
Sbjct: 360 ARKA----PENPLLEPFPITEQDCPGLEGLVTAEGFLRSTPADLPPDRLDGNPHMAGMDG 415

Query: 433 FFAVALRRL 441
           FFA   +R+
Sbjct: 416 FFAARFKRV 424


>gi|260775013|ref|ZP_05883913.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260609103|gb|EEX35262.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 426

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 121/454 (26%), Positives = 205/454 (45%), Gaps = 44/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RDQ L++ I   +LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGQSLSNALP-----AAQQQVKPRDQALLQEICYGSLRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  SIANELMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC-ISPLYID 179
           N++LR   R +       +   AG    P W  + L++ Y ++    I      +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDAHAMSHNAGKYGHPSWLLKLLQDAYPQQWQDIIEANNSKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  +  LPGF +G   VQDA+A +
Sbjct: 175 VNQQHHSRDEYQQLLKNENIDSSIHSEASDALKLAAPCDVTKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA        A++ A+D    RL+++  NL RL L A
Sbjct: 235 SINYLTPKDGELILDCCAAPGGKTAHILERTQDAQIVAIDCDDSRLKRVHDNLQRLQLKA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      D+   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++L
Sbjct: 295 QVICGDARKPKDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRGDDIAALAKLQSEIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q++ E V+  L  +                  +  +  
Sbjct: 355 DAMWQQLKPGGTLVYATCSITPQENSEQVKAFLARTANA--------------QLEGSPV 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                ++ P            MDGF+   L ++ 
Sbjct: 401 DNPGRQVLPG--------EEDMDGFYYAILTKIA 426


>gi|260466787|ref|ZP_05812972.1| Fmu (Sun) domain protein [Mesorhizobium opportunistum WSM2075]
 gi|259029399|gb|EEW30690.1| Fmu (Sun) domain protein [Mesorhizobium opportunistum WSM2075]
          Length = 475

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 197/426 (46%), Positives = 263/426 (61%), Gaps = 5/426 (1%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+  R  L  L D E G   ++ L  RD+ LVRAI+   LR+   I  +L   L   LP 
Sbjct: 54  VIDARTPLDGLTDHENGHPQYKALDPRDRGLVRAILVTALRYRMTITGLLARRLEKPLPP 113

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L V+ AQIL+LD+ D A VDLAV  AK D   + F+ LVN +LR ++R K  
Sbjct: 114 NASALSHILHVAAAQILFLDIPDSAAVDLAVTHAKSDPRTQRFSGLVNGVLRTLARAKDT 173

Query: 138 L-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
                +A     P+WF +RL+  YG ++   I  A      +D TVK D E WA KL  +
Sbjct: 174 ELPAALAATDEAPKWFSDRLKAAYGADKAKQILAAHRHEAPVDFTVKADPELWAEKLGGI 233

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +R++ L   ++ LPGFAEG WWVQDA+AS P +LFG +  L V DLCAAPGGKT
Sbjct: 234 VLPTGTVRVENLAGPVIELPGFAEGAWWVQDAAASFPARLFGDVRGLRVADLCAAPGGKT 293

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQLI++GA+VTA+D SK RL +L  NLDRL L A DI++ D   Y P +LFDAVL+DAPC
Sbjct: 294 AQLILAGARVTAVDTSKNRLARLAQNLDRLGL-AADIVQADLIKYEPAELFDAVLLDAPC 352

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+   D+ K A  Q +LL + ++ V+PGG +VFSNCSLD  + E +
Sbjct: 353 SSTGTVRRHPDVPWTKTAADVEKLADLQGRLLARAVTLVRPGGRIVFSNCSLDPIEGENL 412

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
            +  L+++P  V   PL+      ID    L+ +G +R TP  L+      SG+DGFFA 
Sbjct: 413 HRAFLKATPT-VADDPLHQGEIAGID--SFLTAQGTLRTTPADLDLGAPERSGLDGFFAA 469

Query: 437 ALRRLI 442
            +RR +
Sbjct: 470 RMRRAV 475


>gi|269797911|ref|YP_003311811.1| sun protein [Veillonella parvula DSM 2008]
 gi|269094540|gb|ACZ24531.1| sun protein [Veillonella parvula DSM 2008]
          Length = 451

 Score =  274 bits (701), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 103/461 (22%), Positives = 185/461 (40%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + R        L           LS  D+     +V   +R    +DA
Sbjct: 11  NIRLLAVKALSEINRNGAYANIKLQEYLQKYH---LSDLDRRFFTELVYGVIRRKNYLDA 67

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ F     + +    + ++LR+ + QI+Y+D V + A V+ +V+ AK+    R  +  V
Sbjct: 68  IIVFFAKRPIKKLSSMVLEILRLGIYQIIYMDKVPESAAVNESVKLAKK--LTRGLSGFV 125

Query: 125 NSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR V RE   +            I+ I   P W         GK++ + +       
Sbjct: 126 NAVLRSVLRESDSISIGELAKSEAEEISFIYNQPLWLVNFWIKEMGKDKTVDLCAWFNEQ 185

Query: 176 LYID---LTVKFDIETWAHKLNAVMLPTGGI-------RLKELPESIVSLPGFAEGVWWV 225
             +     TVK  IE    +L  +               +      +       +G    
Sbjct: 186 PRLTSRINTVKVSIEDCLKELEDLDWIVEQDTYIPEVVYIDGHQGHLEKAKPVLDGHITF 245

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +   +        +LD CAAPGGK+  +   + +   + + D+   +LE +  N
Sbjct: 246 MDKASMLVAHVVDPQPGERILDCCAAPGGKSMHMASLMNNTGAIMSCDIYDHKLELINQN 305

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            +RL +        D        K+ FD VLVDAPCS  G +++  D+ W +    +++ 
Sbjct: 306 AERLGVSIISTKLQDGRYLPDNWKEQFDRVLVDAPCSGLGILQKKLDMRWRKTESLLIEL 365

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L +    VK  G +V+S C+++  ++E V+ K L      +    ++   +K 
Sbjct: 366 PPLQLEILEKASKMVKVNGYLVYSTCTMNSGENEAVLNKFLAIHKNFI----IDPVSYKG 421

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              A+    +G I   P            MDGFF   ++RL
Sbjct: 422 APQAI----DGMITTYP--------PRDHMDGFFMARMKRL 450


>gi|288957078|ref|YP_003447419.1| Sun protein [Azospirillum sp. B510]
 gi|288909386|dbj|BAI70875.1| Sun protein [Azospirillum sp. B510]
          Length = 431

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 172/443 (38%), Positives = 249/443 (56%), Gaps = 18/443 (4%)

Query: 1   MK-SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M  + + AR V+  LL  V+RK +      D          L  RD+  VR +V   LR 
Sbjct: 1   MTDTSLAARGVALDLLRDVLRKSVPFDDAFD---AHPELASLQPRDRGFVRLLVATVLRR 57

Query: 60  LPRIDAVLDFVLISS-LPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENR 118
           L +ID ++   L    LP+   ++  +LR+  AQ+++L+   +A VD AVE A       
Sbjct: 58  LGQIDEMIQASLAKPGLPK--AAIHDMLRLGTAQLVFLNTPAHAAVDTAVELAAARNA-A 114

Query: 119 HFAKLVNSILRRVSREKIELL-QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +  L+N++LRR+ RE  E+  ++ AG    P+W      + YG  R   I +A +    
Sbjct: 115 PYKGLINAVLRRIGREGAEMAARQDAGRLNTPDWLWLSWRSAYGTARTRGIVEAHLHEAP 174

Query: 178 IDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           +D+TVK D   WA +L A +LPTG +R      S++ LPGF +G WWVQD +AS+P +LF
Sbjct: 175 LDITVKSDPAGWAERLGASLLPTGSLRRPPG-GSVIELPGFEDGEWWVQDLAASLPAKLF 233

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G L    V DLCAAPGGKTAQL+V GA+VTA+D S RRLE++  NL RL L AE ++  D
Sbjct: 234 GDLAGKRVFDLCAAPGGKTAQLVVQGAQVTAIDRSARRLERVTENLKRLRLEAE-VLAAD 292

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A  + P+   DAVL+DAPCS+TG IRRHPD+L  +  DDI K A  Q +LL + +  V+P
Sbjct: 293 AATWEPEAPADAVLLDAPCSATGAIRRHPDILRVKTPDDIAKLARAQSRLLARSVELVRP 352

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG +++  CS+  ++ E  V ++L      VE  P+ +       ++  ++  G +R  P
Sbjct: 353 GGTLIYCTCSIQPEEGEAQVARLLEQ-DGRVERWPVTADELGG--LSEPINEAGEVRSLP 409

Query: 418 DMLEKIDGVSSGMDGFFAVALRR 440
            ML  +     G+DGFF   LRR
Sbjct: 410 GMLADL----GGIDGFFVARLRR 428


>gi|294500982|ref|YP_003564682.1| ribosomal RNA small subunit methyltransferase B [Bacillus
           megaterium QM B1551]
 gi|294350919|gb|ADE71248.1| ribosomal RNA small subunit methyltransferase B [Bacillus
           megaterium QM B1551]
          Length = 446

 Score =  274 bits (700), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 114/464 (24%), Positives = 205/464 (44%), Gaps = 40/464 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R ++  +L  + + +     LL+        R +  +D  L+  IV  T++  
Sbjct: 1   MSK-YNVRDIALDILLAIEKNQAFSNLLLNNSIQK---RGIQGKDAGLLTEIVYGTIQRR 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L +   + +  ++ LLR+S+ Q++YLD V D A++  AVE AK+ + ++ 
Sbjct: 57  DTLDYGLAPFLKNP-KKLQPWVRVLLRLSLYQMVYLDRVPDRAILHEAVEIAKK-RGHKG 114

Query: 120 FAKLVNSILRRVSR-------EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            A +VN +LR + R       E    ++R+A  +  P W  +R    YG ++   I  A 
Sbjct: 115 IASMVNGVLRNIQRSGTPSLEEIQNPVERLAIETSHPLWLVKRWVEQYGLDKTRGICLAN 174

Query: 173 ISPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIR-----LKELPESIVSLPGFAEGVWW 224
           +      + V             L    +           L+    +      F EG++ 
Sbjct: 175 LMAPKQTIRVNSARFTQNEVKEALEKEGIVVEPGHFVEEALEVQKGNAAHTQAFREGMFT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           VQD S+ +            +LD CAAPGGK+      + +  KV +LD+   +++ +  
Sbjct: 235 VQDESSMLVAHALSAEAEELILDSCAAPGGKSTHIAEQLKNSGKVISLDIHDHKVKLIAQ 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             +RLHL   +    D+        K++FD +LVDAPCS  G +RR PD+ +T+   D+ 
Sbjct: 295 QAERLHLTNIEPTVQDSRKAGEQFDKEMFDRILVDAPCSGFGVMRRKPDLKYTKTEQDVK 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q+ +L      +K GG +V+S C++D+ ++ +VV   L       +   L +   
Sbjct: 355 QLARIQQDILNAVAPLLKKGGTLVYSTCTIDRDENGDVVAAFLTDHADFQKDETLVARMP 414

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           + +   +     G I++ PD            DGF+   L++ +
Sbjct: 415 QKLKQNV---KHGEIQLLPDAQ---------SDGFYIACLQKKV 446


>gi|296447350|ref|ZP_06889277.1| Fmu (Sun) domain protein [Methylosinus trichosporium OB3b]
 gi|296255129|gb|EFH02229.1| Fmu (Sun) domain protein [Methylosinus trichosporium OB3b]
          Length = 467

 Score =  274 bits (699), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 162/438 (36%), Positives = 241/438 (55%), Gaps = 6/438 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR+ ++H+++ V++    L      +        L  RD  L R+I +  +R L  
Sbjct: 34  PGLAARIAAAHVIADVVQGGRRLDERFSPQAVPQRVAGLDARDAALARSIASAAIRRLGT 93

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L  ++   LP++   L+  + V+ AQI +LD  D+A VDLAV  A+ + +   FA 
Sbjct: 94  IRHALAALMDKGLPKQGARLEWPMIVAAAQIFFLDTPDHAAVDLAVRAARLEPKTAPFAG 153

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN +LR + R + E L         P W  +R    YG+ +  A + A +    +D+TV
Sbjct: 154 LVNGVLRNLVRRREEFLDCDPLELDTPSWLAQRWTKTYGEAQARAFARAHMLEPPLDVTV 213

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K + E WA +L+ V++PTG +RL+ L E I  L G+ EG WWVQDA+A++P +L     +
Sbjct: 214 KSEPERWAERLDGVVMPTGSVRLRTL-EPIAGLEGYEEGEWWVQDAAAALPARLLRAEPD 272

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             +LD+CAAPGGKTAQL  + A VTALD S  RL+ L  NL R  L+A DI   DA  + 
Sbjct: 273 ERILDMCAAPGGKTAQLAQARALVTALDRSAERLKLLAANLQRARLHA-DIAVGDATSF- 330

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
             + FDA+LVDAPCS+TGTIRRHPDV W +   D+   A  Q K+L +  + ++PGG +V
Sbjct: 331 QARPFDAILVDAPCSATGTIRRHPDVAWIKKPGDLDALASLQSKMLDRAAALLRPGGRMV 390

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           +  CSL+ ++ E  V   LR  P  +  +P+++           ++ EG +R  P     
Sbjct: 391 YCTCSLEPEEGEAQVAAFLRRQP-DMRRIPIDAEGEGIPH--EFVTAEGDLRSLPSHWPA 447

Query: 423 IDGVSSGMDGFFAVALRR 440
            +    G+DGFFA    R
Sbjct: 448 EEPRLRGVDGFFAARFSR 465


>gi|167554205|ref|ZP_02347946.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
 gi|205321540|gb|EDZ09379.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA29]
          Length = 429

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 120/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  L+   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLINEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|298292785|ref|YP_003694724.1| sun protein [Starkeya novella DSM 506]
 gi|296929296|gb|ADH90105.1| sun protein [Starkeya novella DSM 506]
          Length = 446

 Score =  274 bits (699), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 169/422 (40%), Positives = 232/422 (54%), Gaps = 14/422 (3%)

Query: 19  MRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRK 78
           + K   L   L+    +     L +RD+ L R I    LR    + A++  +L   LP K
Sbjct: 37  LEKGRPLEEALERLTRE-----LDERDRGLARMIAATALRKFGTLRALIGSLLERGLPEK 91

Query: 79  KYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIEL 138
              ++ LL    AQIL++DV D+A VD +V  A     +  F  LVN++LRRV+RE   +
Sbjct: 92  AGRVETLLVTGAAQILFMDVPDHAAVDTSVALAAESPASAGFKGLVNAVLRRVAREGKAM 151

Query: 139 LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAVML 198
           L  +A     P+W  +     YG +  LAI+ A  S   +DLT K D   WA KL   +L
Sbjct: 152 LPDVADQ---PQWMVDGWTAAYGGKDALAIAHALASEAPLDLTAKDDAAGWAEKLGGKLL 208

Query: 199 PTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ 258
            TG IRL E   ++ +LPGF EG WWVQDA+A++P +L       ++ DLCAAPGGKTAQ
Sbjct: 209 STGSIRLVEA-GNVTALPGFEEGAWWVQDAAAALPARLLHAKAGETIADLCAAPGGKTAQ 267

Query: 259 LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSS 318
           L  +GA VTALD S +RL++L+ NL RL L AE +             FD VL+DAPCS+
Sbjct: 268 LAATGAAVTALDRSGQRLKRLKQNLARLGLDAEIVEA--DAAAWKGGPFDGVLIDAPCSA 325

Query: 319 TGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQ 378
           TGTIRRHPDV WT+   DI      Q ++L      VKPGG++V+S CSL+ ++ E+ V+
Sbjct: 326 TGTIRRHPDVAWTKAPADIASLGALQARILANAADLVKPGGVLVYSTCSLEPEEGEKQVE 385

Query: 379 KVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVAL 438
            +L + P  V       A  +    A  ++  G +R  P  L   D   +G+DGFFA  L
Sbjct: 386 ALLAARPDFVRD---PVAPGECGVAAEWINAAGELRTLPTHLPDADPRFAGIDGFFAARL 442

Query: 439 RR 440
           RR
Sbjct: 443 RR 444


>gi|118581643|ref|YP_902893.1| sun protein [Pelobacter propionicus DSM 2379]
 gi|118504353|gb|ABL00836.1| sun protein [Pelobacter propionicus DSM 2379]
          Length = 452

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 127/462 (27%), Positives = 197/462 (42%), Gaps = 41/462 (8%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
              N R  +  +L  + R+      L+D E        L+  D+ L   +V   LR    
Sbjct: 7   KRSNPRQSACSVLLRIQREGCYADQLMDRELESG---GLTGPDRGLFAELVFGALRRQGT 63

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +D +L  +L   L R +     LLRV + Q++YLD + + A V+ +V  AK+       +
Sbjct: 64  LDHILSSLLTQPLSRLEPQALILLRVGLYQLVYLDRIPESAAVNESVNLAKKTL--PRAS 121

Query: 122 KLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            LVN++LR   R   ++             A     P W   +  +  G E   A+++A 
Sbjct: 122 GLVNAVLRNYLRRGDDIPFPDPLAMPAESIAARHSHPLWLVRQWIDQLGVEEAEALAEAS 181

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVW 223
                + L         +    K +   +     R      L E    I SLPGF EG++
Sbjct: 182 SRQAPLALRANTLAISRDDLLVKFSTNGIQATPCRFSPHGILVEGRHQITSLPGFHEGLF 241

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQD ++ +   L        +LD CAAPGGK   L   +    ++ A+DVS  +L  ++
Sbjct: 242 AVQDEASQMAGLLLDPRPGERILDACAAPGGKATHLAQLMNDRGELLAMDVSGVKLPLIQ 301

Query: 281 CNLDRLHLYAEDIIEMD--AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
            +  RL +        D       P   FD VL+DAPCS  G IRR+P+  W    +D+ 
Sbjct: 302 ESAHRLGISIIRTRRADLLNSAAFPVDSFDRVLLDAPCSGLGVIRRNPEAKWRLRPEDLT 361

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  QR++    +  +KPGG +V+S CS  ++++E V+   L      V L  LN  Y 
Sbjct: 362 RLAETQRRMFANAVRMLKPGGRLVYSTCSTSREENEAVLHAFLSR-QDGVILEDLNQVYP 420

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +   + EG +R  P           GMDGFFA  L +
Sbjct: 421 C---WSELFTREGMLRSWPHC--------HGMDGFFAARLIK 451


>gi|168234465|ref|ZP_02659523.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
 gi|194470953|ref|ZP_03076937.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|194457317|gb|EDX46156.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CVM29188]
 gi|205331616|gb|EDZ18380.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Kentucky str. CDC 191]
          Length = 429

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|298492855|ref|YP_003723032.1| sun protein ['Nostoc azollae' 0708]
 gi|298234773|gb|ADI65909.1| sun protein ['Nostoc azollae' 0708]
          Length = 446

 Score =  273 bits (698), Expect = 3e-71,   Method: Composition-based stats.
 Identities = 119/461 (25%), Positives = 199/461 (43%), Gaps = 46/461 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            N R ++   L  V  K       LD          L   D+ L+  +V  ++R    +D
Sbjct: 2   TNPRQLAFIALKEV-HKGAYADVALDRVLQKFK---LPDNDRRLMTELVYGSVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D +      ++   L+ +L +   Q+ Y + +   A V+  VE AK +         
Sbjct: 58  TLIDKLATKKAHQQPPELRTILHLGFYQLRYQEKIPVSAAVNTTVELAKEN-GFSSLTGF 116

Query: 124 VNSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
           VN +LR+  R               ++R+  +   P+W  E      G +    +     
Sbjct: 117 VNGLLRQYLRLIESSSEPLKLPENPVERLGILHSFPDWIIEVWLEQLGLKETERLCAWMN 176

Query: 174 SPLYIDLTVKFDIETWAHKLNA----------VMLPTGGIRLKELPESIVSLPGFAEGVW 223
               IDL V     +     +A          +     G+RL      I +LPGF EG W
Sbjct: 177 KTPTIDLRVNILRSSLEKVESAFKSAGVLVRPIPYLPQGLRLISSTGPIKNLPGFREGWW 236

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQD+SA +   L        V+D+CAAPGGKT  +   +    K+ A D +  RL +L+
Sbjct: 237 TVQDSSAQLVSHLLDPKPGNVVIDVCAAPGGKTTHIGELMGDKGKIWACDQTASRLRRLK 296

Query: 281 CNLDRLHLYAEDIIEMDAFD-YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
            N+ RLHL + +I   D+ +      + D VL+DAPCS  GT+ RH D  W +    + +
Sbjct: 297 ENVQRLHLESIEICTGDSRNLTQFNNIADCVLLDAPCSGLGTMHRHADARWRQTPSSVQE 356

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            +  Q++L+    +F+K GG++V++ C+L   ++EEV+ + L  +P      P +     
Sbjct: 357 LSQLQKELISHTANFIKVGGVLVYATCTLHPMENEEVISQFLAVNPHWQIESPGSDLV-- 414

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  ++  GW+++ P   +        MDGFF V LR+
Sbjct: 415 ------DIASPGWLKVWPHQRD--------MDGFFMVRLRK 441


>gi|194443414|ref|YP_002042660.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|224493264|sp|B4SUR0|RSMB_SALNS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194402077|gb|ACF62299.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Newport str. SL254]
          Length = 429

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|163751682|ref|ZP_02158901.1| sun protein [Shewanella benthica KT99]
 gi|161328421|gb|EDP99577.1| sun protein [Shewanella benthica KT99]
          Length = 425

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/447 (26%), Positives = 200/447 (44%), Gaps = 34/447 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +   V+ K  SL+  L  +         S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAARVAFQVLEKGTSLSVALPDQQQHLE----SGKDKALLAELSYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KLVSDCMSKPLKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++  L      ++   P W  +RL+  Y +     I  +   P     +  
Sbjct: 116 NGVLRNIQRQEKPLPTDNDTLAFNTPAWIVKRLKAAYPENWQEVIEQSHQRPPMWLRNNK 175

Query: 182 VKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                + +   L      A    +    L E P  +  LPGF +G   VQD +A     L
Sbjct: 176 QSQTRDEYLAALAEIDIPASAGKSSDAILLESPRDVAQLPGFEQGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIV-SGAKVTALDVSKRRLEKLRCNLDRLHLYA--EDI 293
               +   +LD CAAPGGKT  L+  +  ++ A+D  ++RLE+++ NLDRL L A     
Sbjct: 236 LAPKDGELILDACAAPGGKTCHLLELANIELVAVDFDEKRLERVQQNLDRLSLKAKLVHG 295

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
              D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q K+L     
Sbjct: 296 DAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQTDIDELASLQSKILDHCWQ 355

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWI 413
           ++KPGG ++++ CS+  Q++E+ ++  L  +                I            
Sbjct: 356 WLKPGGTLLYATCSILPQENEQQIRSFLARADDATLFPISEQPNPDDIGW---------- 405

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRR 440
           +ITP         +  MDGF+   L +
Sbjct: 406 QITPG--------TENMDGFYYARLVK 424


>gi|212639615|ref|YP_002316135.1| rRNA cytosine-C5-methylase [Anoxybacillus flavithermus WK1]
 gi|212561095|gb|ACJ34150.1| rRNA cytosine-C5-methylase [Anoxybacillus flavithermus WK1]
          Length = 446

 Score =  273 bits (698), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 119/460 (25%), Positives = 200/460 (43%), Gaps = 40/460 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R V+  +L  + RKR      L      +    LS +D  L+  +V  T++    +D 
Sbjct: 3   NVRNVALDVLIDIERKRAYSNLSLHHVIETN---ELSAQDVALLTELVYGTIQRRDTLDY 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
            L   +  ++      ++ LLR+S+ Q++YLD + D AV+  AVE AKR + +R  A LV
Sbjct: 60  YLQPFIKGNIE---PWVRLLLRMSLYQMIYLDRIPDRAVLFEAVEIAKR-RGHRGIASLV 115

Query: 125 NSILR-------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N ILR       R   +  +  +R+A  +  P W   R    +G +    + +    P  
Sbjct: 116 NGILRSVQRQGLRSLDDIKDESERLAIATSHPLWLVRRWIEQFGFDETKRMCEVNNFPPE 175

Query: 178 IDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
               V     T    +         A+      I  K    +      F EG+  +QD S
Sbjct: 176 QTARVNVMRATVEEVIDRLKEEGIEAIPSSVVPIGTKITKGNAAKTSVFREGLITIQDES 235

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           + +            VLD CAAPGGKT      + +  +V ALD+   +++ +     RL
Sbjct: 236 SMLVAYALSPNETDVVLDCCAAPGGKTTHIAERMNNRGRVVALDIHDHKVKLIEQQAKRL 295

Query: 287 HLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L   +  ++D+         + FD +LVDAPCS  G IRR P++ + ++  DI + A  
Sbjct: 296 GLSNIEAKQLDSRQAHTQFAAETFDRILVDAPCSGLGVIRRKPEIKYAKNEKDITQLANV 355

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q  +L      +K GG +V+S C++D++++E+V+ + L   P       L S    S+  
Sbjct: 356 QLNILRAVAPLLKRGGTLVYSTCTVDREENEQVIAQFLAEHPEYDRDETLASRLPSSV-- 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
             +    G +++ P  +          DGFF   L++  +
Sbjct: 414 -ASYVDRGMLQLLPHHVYS--------DGFFIATLKKKGE 444


>gi|89098704|ref|ZP_01171586.1| sun protein [Bacillus sp. NRRL B-14911]
 gi|89086666|gb|EAR65785.1| sun protein [Bacillus sp. NRRL B-14911]
          Length = 448

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 121/465 (26%), Positives = 214/465 (46%), Gaps = 39/465 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +  N R  +  LL  + + +     LL+     +    +S +D  L+  +V  TL+  
Sbjct: 1   MANK-NVREAAVELLEAIEKNQSYSNLLLNSSIKKN---DISSKDVGLLTELVYGTLQRK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  ++  L +   + +  ++QLLR++  Q++YLD + D A +  AVE AKR K ++ 
Sbjct: 57  MTLDYQMEPFLKNP-KKLESWVRQLLRITFYQMIYLDKIPDRAAIYEAVEIAKR-KGHKG 114

Query: 120 FAKLVNSILR-------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            + +VN +LR       R      + ++R+A  +  P W  +R  +  G ER   + +  
Sbjct: 115 ISGMVNGVLRSLQRQGARSLDSIKDSVERLAMETSHPLWLVKRWVDQLGFERAKEMCELN 174

Query: 173 ISPLYID---LTVKFDIETWAHKLNAVMLPTGGIRLKE-----LPESIVSLPGFAEGVWW 224
           ++          +K  ++     L           +          ++     F EG   
Sbjct: 175 LTAPMQTGRVNLMKVSMDECMAMLEEEGYLVEASPVIPEAVKSKKGNLAHSRAFKEGYLS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV---SGAKVTALDVSKRRLEKLRC 281
           +QD S+ +     G   +  VLD CAAPGGKT  +     +  +V +LD+ + +++ +  
Sbjct: 235 IQDESSMLAAYALGAEKDNHVLDACAAPGGKTTHIAEKLGNTGQVISLDLHEHKVKLIAD 294

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKK---LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           N  RL L   +   MD+           FD +L+DAPCS  G +RR PD+ +T+  +DI+
Sbjct: 295 NARRLGLSNIETKAMDSRTVQEHFNAGSFDRILLDAPCSGLGVMRRKPDMKYTKKEEDIM 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
                Q KLL      +K GG +V+S C++D++++E  V++ L S P   E    +S   
Sbjct: 355 HLQKVQLKLLEAVAPLLKDGGTLVYSTCTVDREENENAVRQFLDSHP---EFSGDHSLAE 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
           +  D   AL+ +  ++I P  L        G DGF+  +LR+ +Q
Sbjct: 412 RLPDAVKALAKDFELQILPQDL--------GSDGFYIASLRKKVQ 448


>gi|282850140|ref|ZP_06259519.1| ribosomal RNA small subunit methyltransferase B [Veillonella
           parvula ATCC 17745]
 gi|294793653|ref|ZP_06758790.1| ribosomal RNA small subunit methyltransferase B [Veillonella sp.
           3_1_44]
 gi|282579633|gb|EFB85037.1| ribosomal RNA small subunit methyltransferase B [Veillonella
           parvula ATCC 17745]
 gi|294455223|gb|EFG23595.1| ribosomal RNA small subunit methyltransferase B [Veillonella sp.
           3_1_44]
          Length = 451

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 101/461 (21%), Positives = 182/461 (39%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + R        L           LS  D+     +V   +R    +DA
Sbjct: 11  NIRLLAVKALSEINRNGAYANIKLQEYLQKYH---LSDLDRRFFTELVYGVIRRKNYLDA 67

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       L +    + ++LR+ + QI+Y+D V + A V+ +V+ AK+    R  +  V
Sbjct: 68  IIVHFAKRPLKKLSSMVVEILRLGIYQIIYMDKVPESAAVNESVKLAKK--LTRGLSGFV 125

Query: 125 NSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR V RE   +            I+ I   P W         GK++ + +       
Sbjct: 126 NAVLRSVLRESDSISIGELAKSEAEEISFIYNQPLWLVNLWIKEMGKDKTVDLCSWFNEQ 185

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPTGGI-------RLKELPESIVSLPGFAEGVWWV 225
             +   +      IE    +L  +               +      +       EG    
Sbjct: 186 PRLTARINTVKVSIEDCLKELEDLDWIVEQDTYIPEVVYIDGHQGHLEKAKPVLEGHITF 245

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +   +        +LD CAAPGGK+  +   + +   + + D+   +LE +  N
Sbjct: 246 MDKASMLVAHVVDPQPGELILDCCAAPGGKSMHMASLMNNTGAIMSCDIYDHKLELINQN 305

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            +RL +        D        K+ FD VLVDAPCS  G +++  D+ W +    +++ 
Sbjct: 306 AERLGVSIISTKLQDGRYLPDNWKEQFDRVLVDAPCSGLGILQKKLDMRWRKTESLLIEL 365

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L +    VK  G +V+S C+++  ++E V+ K L      +    ++   +K 
Sbjct: 366 PPLQLEILEKASEMVKVNGYLVYSTCTMNSGENEAVLNKFLAIHKNFI----IDPVSYKG 421

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              A+    +G I   P            MDGFF   ++RL
Sbjct: 422 APQAI----DGMITTYP--------PRDHMDGFFMARMKRL 450


>gi|282895327|ref|ZP_06303529.1| Fmu, rRNA SAM-dependent methyltransferase [Raphidiopsis brookii D9]
 gi|281199633|gb|EFA74493.1| Fmu, rRNA SAM-dependent methyltransferase [Raphidiopsis brookii D9]
          Length = 465

 Score =  273 bits (697), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 120/465 (25%), Positives = 198/465 (42%), Gaps = 47/465 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ ++ R ++   L  V  +       +D          LS  D+ L+  +V  ++R  
Sbjct: 20  MKT-LSTRQIAFTALREV-HRGAYADIAIDRTLQKFK---LSDHDRRLMTELVYGSVRRQ 74

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRH 119
             +DA++D +      ++   L+ +L + + Q+ Y   +   A V+  V+ AK +     
Sbjct: 75  RSLDAIIDQIADKKSQQQPRDLRCILHLGLYQLRYQQKIPVSAAVNTTVQLAKEN-GFPG 133

Query: 120 FAKLVNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAIS 169
               VN  LR+  R   +    +            +   P W  E   +  G+E    + 
Sbjct: 134 LTGFVNGFLRQYIRLLEKTSDPLILPENLVERLGILYSFPNWVIEVWLSQLGQEETEKLC 193

Query: 170 DACISPLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLPGFA 219
                   IDL V     +              ++ +     G+RL      I +LPGF 
Sbjct: 194 QWMNQTPTIDLRVNILRASLEMVESVFKKAGILVDRIPHLPQGLRLVNPAGPIQNLPGFT 253

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRL 276
           EG W +QDA+A +   L        ++D+CAAPGGKT  +   +    K+ A D +  RL
Sbjct: 254 EGWWCIQDAAAQLVGHLLDPKPGEVIIDVCAAPGGKTTHIAELMGDNGKIYACDRTPSRL 313

Query: 277 EKLRCNLDRLHLYAEDIIEMD-AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            KL  N  RL L + +I   D         + D VL+DAPCS  GT+ RH D  W +D  
Sbjct: 314 RKLSENAQRLRLQSIEIFPGDSRNFTQFHHVADRVLLDAPCSGLGTMHRHADARWRQDPS 373

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            +   A  Q++L+     FVKPGG++V++ C+L  Q++E+++++ L  +P      P   
Sbjct: 374 SVGDLAHIQKELISHTAKFVKPGGVLVYATCTLHPQENEDLIREFLHINPQWEMEKPNFD 433

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                      +S  GW+++ P            MDGFF V LR+
Sbjct: 434 FL--------DVSSPGWLKLWPHQQL--------MDGFFLVRLRK 462


>gi|322615051|gb|EFY11975.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322617338|gb|EFY14239.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322625560|gb|EFY22385.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322626402|gb|EFY23211.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322632086|gb|EFY28839.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322635035|gb|EFY31758.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322643264|gb|EFY39831.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646652|gb|EFY43159.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322649998|gb|EFY46417.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322652715|gb|EFY49055.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322659528|gb|EFY55772.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322665530|gb|EFY61717.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322670424|gb|EFY66563.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670497|gb|EFY66631.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322675073|gb|EFY71156.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681610|gb|EFY77639.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685954|gb|EFY81943.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|323195824|gb|EFZ80997.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323196420|gb|EFZ81571.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323202705|gb|EFZ87744.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323207310|gb|EFZ92260.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211254|gb|EFZ96099.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323216037|gb|EGA00768.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223472|gb|EGA07800.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323226798|gb|EGA10988.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323231840|gb|EGA15950.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233207|gb|EGA17302.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323237274|gb|EGA21339.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323245509|gb|EGA29508.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323249015|gb|EGA32937.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323250638|gb|EGA34519.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323256867|gb|EGA40581.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323263016|gb|EGA46563.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323266016|gb|EGA49511.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272773|gb|EGA56176.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
          Length = 429

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 122/457 (26%), Positives = 210/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     + S A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVASEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDATLSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|212632964|ref|YP_002309489.1| Fmu, rRNA SAM-dependent methyltransferase [Shewanella piezotolerans
           WP3]
 gi|212554448|gb|ACJ26902.1| Fmu, rRNA SAM-dependent methyltransferase [Shewanella piezotolerans
           WP3]
          Length = 428

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 125/449 (27%), Positives = 199/449 (44%), Gaps = 37/449 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L  +         S +D+ L+  +    +R LP++D
Sbjct: 3   MNLRALAAKVVFQVLEKGISLSVALPDQQKHLD----SGKDKALLAELCYGVMRHLPQLD 58

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   +   L  K+  + QLL +   QI +  +  +A +    E A R  +     K+V
Sbjct: 59  KQVSDCMSKPLKGKQRIVHQLLLIGCYQIYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 117

Query: 125 NSILRRVSREKIELLQRIAGI-SIIPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++  L      +    P W  +RL+  Y +     I  +   P     +  
Sbjct: 118 NGVLRTIQRQEKPLSTDNDTLAYNTPAWIIKRLKEAYPENWQQVIEQSHQRPPMWLRNNQ 177

Query: 182 VKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                ET+   L      A    +    L   P  ++ LPGF  G   VQD +A     L
Sbjct: 178 QSQSRETYLQALAGLDIEAEAGNSPDSILLSSPRDVMQLPGFETGAASVQDGAAQWAATL 237

Query: 237 FGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
                +  VLD CAAPGGKT     +    K+ A+D   +RLE+++ NLDRL L AE I 
Sbjct: 238 LAPQGDELVLDACAAPGGKTCHLLELAPDIKLVAVDFDAKRLERVQQNLDRLSLEAELIH 297

Query: 295 --EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
               D   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q K+     
Sbjct: 298 GDAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDIEELAALQSKIFDHCW 357

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++++ CS+  Q++ + V   L  +     L+P+                   
Sbjct: 358 KWLKPGGTLLYATCSILPQENRDQVSAFLART-ADATLMPIEE----------------- 399

Query: 413 IRITPDML-EKIDGVSSGMDGFFAVALRR 440
            +  P     +I      MDGF+   L +
Sbjct: 400 -QTNPQDTGWQIVPGQDNMDGFYYARLVK 427


>gi|114706034|ref|ZP_01438937.1| hypothetical protein FP2506_16249 [Fulvimarina pelagi HTCC2506]
 gi|114538880|gb|EAU42001.1| hypothetical protein FP2506_16249 [Fulvimarina pelagi HTCC2506]
          Length = 473

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 193/441 (43%), Positives = 254/441 (57%), Gaps = 9/441 (2%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR V++ LL  V+ ++ SL  L D ++G   FR L  RDQ LV+AI+   LRF  
Sbjct: 40  KPGLKARQVAAKLLGAVIEQQTSLDGLTDPDHGHPHFRQLEARDQGLVKAILLTALRFRG 99

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +   +   L   LP    +L  LL V+ AQI +LDV D A VDLAV  A+ D   R F 
Sbjct: 100 TLTQEIAARLDRPLPSNATALNHLLHVAAAQIRFLDVPDSAAVDLAVTAAEADPRTRRFK 159

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            +VN++LRR++RE              P W  ERL   YG+ R  AI+ A   P  IDLT
Sbjct: 160 GVVNAVLRRMTRELGGAEVTTEPAIDCPNWLLERLIAAYGEPRAKAIAAAHRMPAPIDLT 219

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLK-ELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           VK D E WA +L   ++    IRL      SI SL GFAEG WWVQDASA++PV+LFG L
Sbjct: 220 VKTDPEAWAERLGGQVVSGPSIRLDATTQGSIASLDGFAEGKWWVQDASAALPVRLFGDL 279

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
              +  DLCAAPGGKTAQL++S A VTA + SK R ++L  NL RL  +  + +     +
Sbjct: 280 TGKTAADLCAAPGGKTAQLVLSDATVTACEASKSRAKRLVANLTRL-AHDAETLIGPFQE 338

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
               + FDAVL+DAPCSSTGT+RRHPDV  T+  DD+ + A  QRKLL    + V PGG 
Sbjct: 339 TLGDRTFDAVLLDAPCSSTGTLRRHPDVGHTKSLDDVRRLAEVQRKLLDAAANHVAPGGT 398

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           +VFSNCS+D  + EE+V+  L          P+        D A  ++ +G +R TP+ML
Sbjct: 399 LVFSNCSIDPIEGEELVKAFLAERKDFTRR-PIEPTELPGFDKA--VTSDGDLRTTPEML 455

Query: 421 EKIDGVSSGMDGFFAVALRRL 441
             I     G+DGF+A  L+R+
Sbjct: 456 SAI----GGIDGFYASRLQRV 472


>gi|83309246|ref|YP_419510.1| tRNA and rRNA cytosine-C5-methylase [Magnetospirillum magneticum
           AMB-1]
 gi|82944087|dbj|BAE48951.1| tRNA and rRNA cytosine-C5-methylase [Magnetospirillum magneticum
           AMB-1]
          Length = 431

 Score =  273 bits (697), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 169/444 (38%), Positives = 250/444 (56%), Gaps = 17/444 (3%)

Query: 1   MK--SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLR 58
           MK  S  + R ++  LLS V+ K   L  +LD    DS    L  RD+  VR ++  TLR
Sbjct: 1   MKRASSTSPRAIAVDLLSMVLDKGRLLDDVLD----DSRLSRLEDRDRGFVRMLLGTTLR 56

Query: 59  FLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENR 118
            L +ID +++  L   +       +  LR+ + Q+L+LDVA +A +   V+  K  K   
Sbjct: 57  RLGQIDTLIEHCLDKPMRAGAAGAEHALRLGICQLLFLDVAPHAAISTTVDLVKGSKL-A 115

Query: 119 HFAKLVNSILRRVSRE-KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            FAKL+N++LRR+ RE +     + AG+   PEW        YG++   AI+ A +    
Sbjct: 116 GFAKLLNAVLRRLDREGRDLAAAQDAGLLNTPEWLWRSWVKAYGEDGAHAIAAAHLIEAP 175

Query: 178 IDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           +D+TV  D   WA +L A +LPTG +R +    S+ +LPGF +G WW+QDA+A++P +L 
Sbjct: 176 VDITVAADSALWAERLEASVLPTGSLR-RAAGGSVAALPGFDDGAWWIQDAAAALPARLL 234

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G +   +V DLCAAPGGK  QL V+GA +TALD S +RL +   NL RL L A  ++E D
Sbjct: 235 GDVRGKAVADLCAAPGGKALQLAVAGADLTALDRSAKRLVRFTANLKRLGLKA-KVVEAD 293

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
           A  + P   FDA+L+DAPCS+TGT+RRHPDV   ++  +++K A  Q +LL   I  +KP
Sbjct: 294 AGAWTPPAPFDAILLDAPCSATGTLRRHPDVARHKNPAEVMKLAGVQARLLQAAIPMLKP 353

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG +V+  CSL+ ++  E +  +L     P+  VP+         +A  ++PEG +R  P
Sbjct: 354 GGTLVYCTCSLEAEEGPEQIAALLA-GGAPLRRVPIRPEEVGG--LAELITPEGDLRTLP 410

Query: 418 DMLEKIDGVSSGMDGFFAVALRRL 441
             L        GMD FFA  L ++
Sbjct: 411 CHLAS----QGGMDAFFAARLEKV 430


>gi|23016809|ref|ZP_00056561.1| COG0144: tRNA and rRNA cytosine-C5-methylases [Magnetospirillum
           magnetotacticum MS-1]
          Length = 432

 Score =  272 bits (696), Expect = 5e-71,   Method: Composition-based stats.
 Identities = 165/437 (37%), Positives = 254/437 (58%), Gaps = 15/437 (3%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++  LLS V+ K   L  +LD    DS    L +RD+  VR ++  TLR L +IDA
Sbjct: 9   NPRAIAVDLLSMVLDKARLLDDVLD----DSRLSKLEERDRGFVRMLLGTTLRRLGQIDA 64

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +++  +   +       +  LR+ + Q+L+LDVA +A +   V+  K  K    FAKL+N
Sbjct: 65  LIEHCVEKPMRAGAAGAEHALRLGICQLLFLDVAPHAAISTTVDLVKGSKL-AGFAKLLN 123

Query: 126 SILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF 184
           ++LRR+ RE  E + ++ AG+   PEW        YG++   AI+ A +    +D+TV  
Sbjct: 124 AVLRRLDREGRELVTEQDAGLLNTPEWLWRSWVRAYGEDGARAIAQAHLIEAPVDITVAA 183

Query: 185 DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLS 244
           D   WA +L A +L TG +R +    SI +LPGF E  WW+QDA+A++P +L G +   +
Sbjct: 184 DPALWAERLEASILATGSLR-RAGGGSIAALPGFNEAAWWIQDAAAALPARLLGDVRGKA 242

Query: 245 VLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPK 304
           V DLCAAPGGK  QL V+GA++TALD S +RL +   NL RL L A  ++E DA  + P 
Sbjct: 243 VADLCAAPGGKALQLAVAGAELTALDRSAKRLVRFTDNLKRLGLKA-KVVEADAGAWSPP 301

Query: 305 KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFS 364
             FDA+L+DAPCS+TGT+RRHPDV   ++  +++K A  Q +LL   +  +KPGG +V+ 
Sbjct: 302 APFDAILLDAPCSATGTLRRHPDVARHKNPAEVMKLAGVQARLLRAALPMLKPGGTLVYC 361

Query: 365 NCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKID 424
            CSL+ ++  E +  +L     P++ VP+ +   +   +A  ++ +G +R  P  L ++ 
Sbjct: 362 TCSLEPEEGPEQIAALLAE-GAPLKRVPIRAE--EVGGLAQLITADGDLRTLPCHLAEL- 417

Query: 425 GVSSGMDGFFAVALRRL 441
               GMD FFA  L ++
Sbjct: 418 ---GGMDAFFAARLEKM 431


>gi|161616434|ref|YP_001590399.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|197262016|ref|ZP_03162090.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
 gi|224493265|sp|A9N8B3|RSMB_SALPB RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|161365798|gb|ABX69566.1| hypothetical protein SPAB_04249 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|197240271|gb|EDY22891.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Saintpaul str. SARA23]
          Length = 429

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVVAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|319407809|emb|CBI81460.1| SUN-family protein [Bartonella sp. 1-1C]
          Length = 456

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 196/444 (44%), Positives = 263/444 (59%), Gaps = 9/444 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ KR SL  L D EYG   +  LS RD++L RAI+   LR   +
Sbjct: 16  PGLAVRQVCVRLLGAVLDKRTSLAGLTDNEYGHPQYLKLSYRDRLLCRAILGAALRHRSQ 75

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L+  LP + +SL  LL +S+ QILYLD+ D+A +DLAV  AK D   R F+ 
Sbjct: 76  ITVALSRFLVRPLPAQAFSLHHLLHISITQILYLDIPDHAAIDLAVRVAKIDPRMRRFSG 135

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN+ILR  +RE   L  +   I  IP WF + L + YG E+   I         +DLTV
Sbjct: 136 LVNAILRNFAREAPILRMQTPTIKAIPMWFGQLLVSTYGAEKADQILAIQSITPPLDLTV 195

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  ++LP G +RL     SI  LPG+AEG WWVQD +A++P +L G +  
Sbjct: 196 KSDSAGWAKRLGGIVLPNGSVRLISSAYSIADLPGYAEGAWWVQDVAAALPARLLGNVYG 255

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL + GA V ALD+S  RL++LR N+DRL+         D  ++ 
Sbjct: 256 KKVADLCASPGGKTAQLALQGADVMALDISANRLKRLRENMDRLNFS-VHYWLGDLREFH 314

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P +LFDAVL+D PCSSTGTIRRHPD+LWT+  DD+ K A  Q  LLL  I+ VK  G VV
Sbjct: 315 PDQLFDAVLLDTPCSSTGTIRRHPDILWTKTMDDVTKLAEVQYGLLLAAIALVKKNGRVV 374

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           FSNCSL +++ E++V+K+L +    + L P+ +   +   MA  +S EG++R  P     
Sbjct: 375 FSNCSLAREEGEDLVKKILATR-DDIVLEPILAE--EMGAMAHLISMEGFLRTIPSDCCY 431

Query: 423 IDGVSS-----GMDGFFAVALRRL 441
            +  +      GMDGFFA   R++
Sbjct: 432 ENFNAEEKLFLGMDGFFAARFRKV 455


>gi|319406332|emb|CBI79969.1| SUN-family protein [Bartonella sp. AR 15-3]
          Length = 455

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 193/444 (43%), Positives = 266/444 (59%), Gaps = 9/444 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ KR SL  L D EYG   +  LS RD++L RAI+   LR   +
Sbjct: 15  PGLIVRQVCVRLLGAVLDKRTSLAGLTDNEYGHPQYLKLSYRDRLLCRAILGAALRHRSQ 74

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L+  LP + +SL  LL +S+ QILYLD+ D+A +DLAV  AK D   R F+ 
Sbjct: 75  ITVALSHFLVQPLPAQAFSLHHLLHISITQILYLDIPDHAAIDLAVRVAKIDSRLRRFSG 134

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN+ILR  +RE   L  +   I  IP WF++ L + YG E+   I         +DLTV
Sbjct: 135 LVNAILRNCAREAAILRVQTPTIEAIPTWFRQLLVSTYGVEKADQILAIQSIIPPLDLTV 194

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  ++LP G +RL     S+  LPG+AEG WWVQD +A++P++L G +++
Sbjct: 195 KSDSAGWAKRLGGIVLPNGSVRLVSSAYSVADLPGYAEGAWWVQDVAAALPIRLLGNIHD 254

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL + GA VTA+D+S  RL++LR N++RL+         D   + 
Sbjct: 255 KKVADLCASPGGKTAQLALQGADVTAIDISANRLKRLRENINRLNFS-VHYWHGDLRQFH 313

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P +LFDAVL+D PCSSTGTIRRHPD+LWT+  +D+ K A  Q  LLL  I+ VK  G +V
Sbjct: 314 PDQLFDAVLLDTPCSSTGTIRRHPDILWTKTMEDVTKLAEMQYDLLLAAIALVKKNGRIV 373

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           FSNCSL K++ E++V+K+L +    + L P+ +   +   MA  +S EG +R  P     
Sbjct: 374 FSNCSLAKEEGEDLVKKILSTRH-DIVLEPILAE--EMGAMAHLVSMEGCLRTIPSDCCD 430

Query: 423 IDGVSS-----GMDGFFAVALRRL 441
            +  +      GMDGFFA   R++
Sbjct: 431 GNFNTEEKLFLGMDGFFAARFRKV 454


>gi|290512100|ref|ZP_06551468.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp.
           1_1_55]
 gi|289775890|gb|EFD83890.1| ribosomal RNA small subunit methyltransferase B [Klebsiella sp.
           1_1_55]
          Length = 431

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 117/456 (25%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNKINLRSLAAQAIEQVVEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLVEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVDANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLKEAGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLLPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNATWEHLKPGGTLVYATCSILPEENSQQISAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGPEEGDGFFYAKLIK 428


>gi|288933298|ref|YP_003437357.1| sun protein [Klebsiella variicola At-22]
 gi|288888027|gb|ADC56345.1| sun protein [Klebsiella variicola At-22]
          Length = 431

 Score =  272 bits (696), Expect = 6e-71,   Method: Composition-based stats.
 Identities = 117/456 (25%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNKINLRSLAAQAIEQVIEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLVEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVDANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLKEAGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLLPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNATWEHLKPGGTLVYATCSILPEENSQQISAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGPEEGDGFFYAKLIK 428


>gi|238913877|ref|ZP_04657714.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
          Length = 429

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVVAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|258592639|emb|CBE68948.1| Sun protein [NC10 bacterium 'Dutch sediment']
          Length = 467

 Score =  272 bits (696), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 129/464 (27%), Positives = 206/464 (44%), Gaps = 43/464 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M+AR ++  +L+ V  ++   + LLD +   +    LSQ+D+ L   +    LR+  R+D
Sbjct: 16  MHARRLAFEILTQVEEQQAYASLLLDAKLKQAR---LSQQDRALATELTYGVLRWQGRLD 72

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENR---HF 120
            +L  V      R   +L++LLR+   QIL+L  V  YA V+  V  A+    ++     
Sbjct: 73  YLLAAVTDRPWDRVDPALRRLLRLGAYQILFLTRVPAYAAVNETVALAQDVMRSQLKPVA 132

Query: 121 AKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDA 171
              VN+ILRR+      +             A     P W   R     G E   A+  A
Sbjct: 133 KAFVNAILRRLLERHATIRFPDPSGDPVGALAARWSHPSWLVARWLKRLGPEETEALLKA 192

Query: 172 CISPLYIDLTVK---FDIETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFAEG 221
                 + + V       E    +L  +          +G   L +  E++   P FA+G
Sbjct: 193 NNDTSALSVMVNLVKRQPEEVQERLTRIAGSVTPGRFVSGAFHLNDGAEALRD-PAFADG 251

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKRRLEK 278
            ++  D +A++PV +        VLD C+  GGKT      +    +V ALD S R   +
Sbjct: 252 WYFPMDEAAALPVLMLNPQPGDVVLDACSGGGGKTALLLGRLGGQGRVIALDPSARAHRR 311

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           LR    RL L     ++ DA        +  D +LVDAPCS  GT+RRHP+  W +    
Sbjct: 312 LREARTRLSLDRVFPVQADARQAAQLFTRQVDRILVDAPCSGLGTLRRHPERRWQQQEAG 371

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +   A  Q +LL      ++PGG +V+S CSL+ ++++ VV+  LR  P   E V  +++
Sbjct: 372 LAALARLQLELLHGVAPVLRPGGFLVYSTCSLEPEETDVVVETFLRDFP---EFVAADTS 428

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                 +A  +  +G +R  P           G+DGF+A+ LRR
Sbjct: 429 GGLPATVAGLIDSKGALRTWPH--------RHGLDGFYAIRLRR 464


>gi|16766697|ref|NP_462312.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|167995183|ref|ZP_02576273.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|46396986|sp|Q8ZLM5|RSMB_SALTY RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|16421964|gb|AAL22271.1| putative rRNA methylase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|205327090|gb|EDZ13854.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar 4,[5],12:i:- str.
           CVM23701]
 gi|261248565|emb|CBG26403.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267995617|gb|ACY90502.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301159951|emb|CBW19470.1| 16S rRNA methyltransferase [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312914431|dbj|BAJ38405.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|321226460|gb|EFX51510.1| Ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Typhimurium str.
           TN061786]
 gi|323131766|gb|ADX19196.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|332990260|gb|AEF09243.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 429

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|323493837|ref|ZP_08098955.1| 16S rRNA methyltransferase B [Vibrio brasiliensis LMG 20546]
 gi|323311971|gb|EGA65117.1| 16S rRNA methyltransferase B [Vibrio brasiliensis LMG 20546]
          Length = 426

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 123/452 (27%), Positives = 206/452 (45%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSNALP-----AAQQTIKPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  SIANELMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC-ISPLYID 179
           N++LR   R +       +   AG    P W  + L+  Y ++    +      +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDAMAVSHNAGKYGHPGWLLKLLQESYPQQWQEIVEANNSKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    +        E       P  +  LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHSRDEYLELLKNENIDNTIHSEAEDAVKLAAPCDVTKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA       G++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLTPQDGELILDCCAAPGGKTAHILERTQGSEVVAIDCDDTRLKRVHDNLQRLNLKA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  D+   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++L
Sbjct: 295 KVICGDARNPQDWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQREIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q+++E V+  L  +                  +  +  
Sbjct: 355 DAMWQQLKPGGTLVYATCSITPQENKEQVKAFLARTSDA--------------KLQGSDV 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 401 DNPGRQILPG--------EEDMDGFYYAILTK 424


>gi|198244494|ref|YP_002217372.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|224493260|sp|B5FJI4|RSMB_SALDC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|197939010|gb|ACH76343.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|326625153|gb|EGE31498.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Dublin str. 3246]
          Length = 429

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 210/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLC+APGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCSAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DIV+ A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIVELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|283835706|ref|ZP_06355447.1| hypothetical protein CIT292_10098 [Citrobacter youngae ATCC 29220]
 gi|291068385|gb|EFE06494.1| ribosomal RNA small subunit methyltransferase B [Citrobacter
           youngae ATCC 29220]
          Length = 429

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 119/457 (26%), Positives = 216/457 (47%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKHLNLRSMAAQAVEQVVEKGQSLSNVLPAM-----QQKVADKDKALLQELCFGALRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V   Q+L+  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWMIQQLMERPMTGKQRTVHYLIMVGFYQLLHTRIPPHAALAETVEGAVVIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGK-ERVLAISDACISPL 176
             L+N +LR+  R + ELL   A      + P W  +R++  Y +    +  ++    P+
Sbjct: 115 KGLINGVLRQFQRRQEELLTEFAQSDLRFLHPSWLVKRIKAAYPQQWEAILEANNQRPPM 174

Query: 177 YIDLTVKFDIETWAHKLNAVMLPTGGIRLKEL-------PESIVSLPGFAEGVWWVQDAS 229
           ++ +           +L A    TG              P  +++LPGF +G   VQDAS
Sbjct: 175 WLRVNRNHHTRDAWLELLAEAGLTGFPHPDYPDAVRLETPAPVLALPGFEQGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A   V      N   +LDLCAAPGGKT  ++    +  V A+DV ++RL ++  NL RL 
Sbjct: 235 AQGCVSYLQPQNGEQILDLCAAPGGKTTHILEVAPQANVMAVDVDEKRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS++G IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPQQWCGEQQFDRILLDAPCSASGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L    + +KPGG +V++ CS+  +++++ +   L  +P  V              ++
Sbjct: 354 AEILNATWTHLKPGGTLVYATCSILPEENQQQIAAFLARTPDAV--------------LS 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE           +    +   DGFF   L + 
Sbjct: 400 ETGTPE-------QPGRQNLPDAEDGDGFFYAKLIKK 429


>gi|217977604|ref|YP_002361751.1| sun protein [Methylocella silvestris BL2]
 gi|217502980|gb|ACK50389.1| sun protein [Methylocella silvestris BL2]
          Length = 448

 Score =  272 bits (695), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 166/439 (37%), Positives = 241/439 (54%), Gaps = 7/439 (1%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ ARL ++ +L+ ++ K  SL          S  + L  RD  L R+IV   LR L  
Sbjct: 14  PGLPARLAAAAILNDIVGKAHSLEDCFSPGAIPSRLQGLDPRDVALTRSIVTAALRRLGT 73

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L   LPR    L+  L  + AQIL+LDV D+A VDLAV   + + ++  FA 
Sbjct: 74  IRKTLGEFLDKGLPRPVAHLEWTLIAAAAQILFLDVPDHAAVDLAVRATRLENKSAPFAG 133

Query: 123 LVNSILRRVSREKIELLQRIA-GISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
           ++N++LR ++R + ++L+         P W   R    YG++    I+ A      +DLT
Sbjct: 134 VINAVLRNIARGRDKILEDSDPFDHDTPPWLAARWRKTYGEDLARKIARANRDEPTLDLT 193

Query: 182 VKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           VK D   WA +L  ++LPTG +RL      I  LPGFAEG WWVQDA+A++P +L     
Sbjct: 194 VKSDPALWAERLGGLVLPTGSVRLLTHA-PIAELPGFAEGEWWVQDAAAALPARLIAPAP 252

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V D CAAPGGK AQL  +GAKVTA+D S  RL++L  N  RL L+A+ ++       
Sbjct: 253 GARVADFCAAPGGKAAQLAAAGAKVTAIDRSAERLKRLAANFSRLDLHADVVVA--DIVG 310

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDA+L+DAPC +TGTIRRHPD+ W +   DI   A  Q ++L + +  V+PGG++
Sbjct: 311 LKAQPFDAILIDAPCLATGTIRRHPDIAWIKKPTDIASLAQVQARMLDKAVELVRPGGVI 370

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E  +  +LR +P  +       +  +  D+   ++ EG +R  P  L 
Sbjct: 371 VYCTCSLEPEEGELQIAALLRRNPDMLR---SKISPHEVGDVEGVINNEGELRTLPCHLP 427

Query: 422 KIDGVSSGMDGFFAVALRR 440
             D   SG+DGFFA  L R
Sbjct: 428 ADDPRLSGLDGFFAARLIR 446


>gi|62181914|ref|YP_218331.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|168264711|ref|ZP_02686684.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|224585203|ref|YP_002639002.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|75480382|sp|Q57J62|RSMB_SALCH RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766862|sp|C0PZV1|RSMB_SALPC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|62129547|gb|AAX67250.1| putative rRNA methylase [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|205346881|gb|EDZ33512.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Hadar str. RI_05P066]
 gi|224469731|gb|ACN47561.1| sun protein [Salmonella enterica subsp. enterica serovar Paratyphi
           C strain RKS4594]
 gi|322716400|gb|EFZ07971.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
          Length = 429

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|206577662|ref|YP_002236309.1| ribosomal RNA small subunit methyltransferase B [Klebsiella
           pneumoniae 342]
 gi|224493255|sp|B5XNC2|RSMB_KLEP3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|206566720|gb|ACI08496.1| ribosomal RNA small subunit methyltransferase B [Klebsiella
           pneumoniae 342]
          Length = 431

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 117/456 (25%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+ +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNKINLRSLAAQAIEQVIEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHFLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++              + P+W  +RL+  + ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLVEFAEHENRYLHPKWLLKRLQQAWPQQWQEIVDANNQRPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    L                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRNHHSRDEWLALLKEAGLEGFTHPDYPDAVRLATPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRYLLPENGERILDLCAAPGGKTTHILEVAPQAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAE-VKQGDGRFPEQWCGNEQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + +   L  +P   EL    +         
Sbjct: 354 AEILNSTWEHLKPGGTLVYATCSILPEENSQQISAFLARTP-DAELHATGTPASPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------QQNLPGPEEGDGFFYAKLIK 428


>gi|212709010|ref|ZP_03317138.1| hypothetical protein PROVALCAL_00042 [Providencia alcalifaciens DSM
           30120]
 gi|212688376|gb|EEB47904.1| hypothetical protein PROVALCAL_00042 [Providencia alcalifaciens DSM
           30120]
          Length = 428

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 123/458 (26%), Positives = 207/458 (45%), Gaps = 45/458 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+    SL+ +L         R ++ +D+ L++ I    LR+L
Sbjct: 1   MKNKYNLRSIAATAISQVLDNGQSLSTVLPDL-----QRNINDKDKALLQEICFGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKEN--R 118
           P+++  +  ++   L  K+ +L  L+ V + Q+LY  +  +A +   V+ A   K    +
Sbjct: 56  PKLEWFISQLMEKPLTGKQRTLHYLIMVGIYQLLYTRIPAHAALAETVDGAVALKRPQLK 115

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
                V     R   +  E         + P W  +R++  Y  E    I DA      +
Sbjct: 116 GLINGVLRSFLRQQVQLEERNTNNNSQYLHPSWLLKRIQTAYP-ETWQNIVDANNQRPPM 174

Query: 179 DLTV---KFDIETWAHKLNAVMLPTGGIRLKELP------ESIVSLPGFAEGVWWVQDAS 229
            L V       E +   L    +                  S+  LPGF +G   VQD S
Sbjct: 175 WLRVNSQHHTAEQYLALLEQADITAYLHPSHPSAIRLEEATSVTRLPGFEDGWSTVQDVS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A    +L   +N  ++LDLCAAPGGKT  ++     A V A+D+   RL++++ NL RL 
Sbjct: 235 AQGCAELLSPINGENILDLCAAPGGKTTHILELAPKAHVLAVDIDDARLKRVKENLQRLK 294

Query: 288 LYAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
            +A  I        ++   +LFD +L+DAPCS+TG IRRHPD+ W R   DI + +  Q 
Sbjct: 295 QHATVIQGDGTKPEEWAKDQLFDRILLDAPCSATGVIRRHPDIKWLRRDSDIQELSQLQA 354

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L    S++KPGG +V++ CS+  +++ + ++  L                   +D  +
Sbjct: 355 QILEAVWSYLKPGGTLVYATCSIMPEENSQQIKHFLSKH----------------VDARI 398

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
               E  ++I P         ++G DGFF   L +  Q
Sbjct: 399 NDGTELGLQILPS--------ATGGDGFFYARLLKQAQ 428


>gi|168239759|ref|ZP_02664817.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
 gi|194736151|ref|YP_002116352.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|224493267|sp|B4TXB2|RSMB_SALSV RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194711653|gb|ACF90874.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           CVM19633]
 gi|197287575|gb|EDY26967.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Schwarzengrund str.
           SL480]
          Length = 429

 Score =  272 bits (695), Expect = 8e-71,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 210/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIDANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT+    +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTSHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|311277757|ref|YP_003939988.1| sun protein [Enterobacter cloacae SCF1]
 gi|308746952|gb|ADO46704.1| sun protein [Enterobacter cloacae SCF1]
          Length = 429

 Score =  272 bits (695), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 117/456 (25%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKHQNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDRALLQELSFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D ++  ++   +  K+ ++  L+ V + Q+L+  +  +A +   VE A   K  +  
Sbjct: 56  PQLDWLITQLMSRPMTGKQRTVHYLIMVGLYQLLHTRIPAHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P+W  +R+   Y ++    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEALLAEFATSDSRFLHPDWLVKRIRKAYPQQWQAVLEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    L                P S+ +LPGF  G   VQDAS
Sbjct: 175 WLRVNRTHHTRDAWLTLLETSGLKGYTHPRYPDAVRLETPTSVQALPGFDAGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A   ++     N  ++LDLCAAPGGKT  ++    +  V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMRFLMPENGETILDLCAAPGGKTTHILEVAPEANVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE + + D      +C  + FD +L+DAPCS+TG IRRH D+ W R   DI + A  Q
Sbjct: 295 MKAE-VKQGDGRYPSQWCDGRQFDRILLDAPCSATGVIRRHSDIKWLRRDRDIAELALLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ E +   L+ +   V                
Sbjct: 354 AQILDAVWPHLKPGGTLVYATCSILPEENAEQIAAFLKRTGDAVL-------------SE 400

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +  ++  P         +   DGFF   L +
Sbjct: 401 TGTPEQPGLQNLP--------AADEGDGFFYAKLIK 428


>gi|168245235|ref|ZP_02670167.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
 gi|168468035|ref|ZP_02701872.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|194447684|ref|YP_002047433.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|200388990|ref|ZP_03215602.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|224493263|sp|B4TJX9|RSMB_SALHS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|194405988|gb|ACF66207.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL476]
 gi|195628892|gb|EDX48302.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Newport str. SL317]
 gi|199606088|gb|EDZ04633.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Virchow str. SL491]
 gi|205336021|gb|EDZ22785.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Heidelberg str. SL486]
          Length = 429

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|303228540|ref|ZP_07315368.1| ribosomal RNA small subunit methyltransferase B [Veillonella
           atypica ACS-134-V-Col7a]
 gi|302516787|gb|EFL58701.1| ribosomal RNA small subunit methyltransferase B [Veillonella
           atypica ACS-134-V-Col7a]
          Length = 452

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 103/461 (22%), Positives = 188/461 (40%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + RK      +L           LS  D+     +V   +R    +D 
Sbjct: 12  NIRLLAVKALSDINRKGAYANIVLQDYILKY---NLSDLDRRFFTELVYGVVRRRNYLDV 68

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       + +    + ++LR+ V QI+Y+D V + A V+ +V+ AK+    R  +  V
Sbjct: 69  IIVHFANRPIKKLSSMVVEILRLGVYQIIYMDKVPESAAVNESVKLAKK--LTRGLSGFV 126

Query: 125 NSILRRVSREKI---------ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N+ILR V RE+            ++ I+ I  IP W      + +G+++   +       
Sbjct: 127 NAILRSVIREQDSIGIEDLAANDIEAISFIYNIPLWLINLWISEFGRDKTEDLCAWFNEQ 186

Query: 176 LYIDLTVKF----------DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWV 225
             +   +             +      +         I +     S+     F +G    
Sbjct: 187 PKLTARINTILIDIPQCLTMLNEQGWAVTQDSNYEDIIYINSHRGSLEKSEAFIKGYITF 246

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +  +L        +LD CAAPGGK+  +   + +   + + D+ + ++E +  N
Sbjct: 247 MDKASMLVARLVNPQPGERILDCCAAPGGKSMYIAALMDNVGSLMSCDIHEHKIELMNSN 306

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            DRL          DA          FD VLVDAPCS  G +++  D+ W +    + + 
Sbjct: 307 ADRLGASIVHTKVQDATKLPDSWNSYFDRVLVDAPCSGLGILQKKLDMRWRKQESILSEL 366

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q  +L +    VK  G +++S C+L+ +++EEVV+  L+       ++P+   +   
Sbjct: 367 PSLQLAILERAAMTVKEKGYLIYSTCTLNYKENEEVVEAFLQKHK-EFSIIPVADDFPLK 425

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                  S  G I   P         +  MDGFF V ++R+
Sbjct: 426 -------SNSGMITTYP--------PTDDMDGFFMVKMQRI 451


>gi|261346903|ref|ZP_05974547.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rustigianii DSM 4541]
 gi|282564970|gb|EFB70505.1| ribosomal RNA small subunit methyltransferase B [Providencia
           rustigianii DSM 4541]
          Length = 428

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 117/457 (25%), Positives = 208/457 (45%), Gaps = 43/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ K  SL+ +L         R ++++D+ L++ +    LR+L
Sbjct: 1   MKNKYNLRSIAATAIGQVLDKGQSLSTVLPEL-----QRNINEKDKALLQEMCFGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKEN--R 118
           P+++  +  ++   L  K+  L  L+ V + Q+LY  +  +A +   V+ A   K    +
Sbjct: 56  PKLEWFISQLMEKPLTGKQRILHYLIMVGIYQLLYTRIPAHAALAETVDGAVALKRPQLK 115

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPLY 177
                V     R   +  E         + P W  +RL+  Y  +    +  +    P++
Sbjct: 116 GLINGVLRSFLRQQVQLEERNHNNNSQYLHPSWLLKRLQIAYPDQWQDIVDANNQRPPMW 175

Query: 178 IDLTVKFDI-ETWAHKLNAVMLPTGGIRLKELPE------SIVSLPGFAEGVWWVQDASA 230
           + +  + +  + +   L    +                  S+  LPGF EG   VQD SA
Sbjct: 176 LRVNPQHNTTDQYLTLLEQAGITAHLHPTHPNAVRLEDATSVNRLPGFDEGWSTVQDVSA 235

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLHL 288
               +L   ++  S+LDLCAAPGGKT  ++     A V A+D+   RL++++ NL RL  
Sbjct: 236 QGCAELLSPVDGDSILDLCAAPGGKTTHILELAPKAHVLAVDIDDSRLKRVKENLQRLKQ 295

Query: 289 YAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
            A  I        ++   + FD +L+DAPCS+TG IRRHPD+ W R   DI + +  Q +
Sbjct: 296 QAIVIQGDGTKPEEWAHGQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELSQLQFQ 355

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA 406
           +L     ++KPGG +V++ CS+  +++   +Q+ L                   +D ++ 
Sbjct: 356 ILEAIWPYLKPGGTLVYATCSIIPEENSLQIQRFLTKH----------------VDASIT 399

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
              E  ++I P         ++G DGFF   L +  Q
Sbjct: 400 DGTEFGLQILPS--------TTGGDGFFYARLLKQAQ 428


>gi|219669868|ref|YP_002460303.1| sun protein [Desulfitobacterium hafniense DCB-2]
 gi|219540128|gb|ACL21867.1| sun protein [Desulfitobacterium hafniense DCB-2]
          Length = 453

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 109/460 (23%), Positives = 190/460 (41%), Gaps = 39/460 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           +R ++  +L  +  ++     ++     D +      R++ L   +VN TL+    +D  
Sbjct: 6   SRALAVQILRRIEEEKAYANLVMQKALHDLS----DPRERQLATLLVNGTLKHRLTLDYA 61

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L   L   L +  + ++ +LR+S  QILYL  +     ++  VE  K+ +    +  LVN
Sbjct: 62  LRRHLRKPLSQLPHEVRWILRISALQILYLSRIPAAVAINEGVELTKKQQG--KYTSLVN 119

Query: 126 SILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           S+LRRV     ++L            +     PEW  +R    YG     A+  A   P 
Sbjct: 120 SVLRRVLETGWDMLWPSKEKEPVRFLSLRYSHPEWMVKRWLKRYGMADTEALCQANNEPA 179

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWWVQD 227
            + +              +L    +            + E   S+  LP F EG + VQD
Sbjct: 180 PVWIRTNTLKISRADLQARLEGEGVKVTIGERVPESLVIEDFGSLDKLPSFQEGHFTVQD 239

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLD 284
            S+ +   +        VLD C APGGKT      + +  ++ A D+   +++ +     
Sbjct: 240 ESSQLIAHVLNPQAGQKVLDACGAPGGKTTHLAQRMENQGEILAFDIHPHKVKLIEDLAA 299

Query: 285 RLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL +        DA +           VLVDAPCS  G +RR  D+ W ++ D+I     
Sbjct: 300 RLGITIIRAQAGDARELAGVKDASCHKVLVDAPCSGLGVLRRRADMRWHKEEDEIKTLPA 359

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELV-PLNSAYWKSI 401
            Q  +L +    V  GG +V+S C+++ +++ EVV+    + P  + +       Y  + 
Sbjct: 360 LQLAILERAAQCVAAGGELVYSTCTIEPEENFEVVKAFRANHPEFITVDFSGELPYSLAS 419

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +     + +G+++I P           GMDGFF    RR+
Sbjct: 420 EQDRKQAAKGFLQILPH--------KQGMDGFFLAKFRRV 451


>gi|242237890|ref|YP_002986071.1| 16S rRNA methyltransferase B [Dickeya dadantii Ech703]
 gi|242129947|gb|ACS84249.1| sun protein [Dickeya dadantii Ech703]
          Length = 431

 Score =  272 bits (694), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 127/457 (27%), Positives = 216/457 (47%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ +++ V+    SL+  L     D     ++++D+ L++ +    LR L
Sbjct: 1   MKSKYNLRSIAAAVIAQVLDHGQSLSQSLPAVQRD-----IAEKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  +  ++   L  K+  L  LL V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  PQLDWCIGQLMAKPLTGKQRVLHYLLMVGLYQLLYTRIPPHATLAETVEGATALKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +    +R   E ++ +Q+ + +   PEW   RL+  Y +     I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELVQKMQKTSALHAHPEWLLTRLKKAYPETWQDIIDANNQHPPM 174

Query: 177 YIDLTVKFD-IETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  + +  + +   L    +P       +       P  + SLPGF +G   VQDAS
Sbjct: 175 WLRVNRQHNERDGYIALLQEQGIPASKHPDYQDAIKLDTPSPVTSLPGFEQGWITVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          NN  +LDLCAAPGGKT     I   A+V A+DV + RL +++ NL RL 
Sbjct: 235 AQGCAYWLDPQNNEDILDLCAAPGGKTTHILEIAPKARVLAVDVDEHRLARVKENLQRLR 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
            +A D+ + D     ++C    FD +L+DAPCS+TG IRRHPD+ W R   DIV+ A  Q
Sbjct: 295 QHA-DVRQGDGRVPEEWCGDSQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIVELANLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           R++L      +K GG +V++ CS+  +++++ +   L+     V     +          
Sbjct: 354 REILDAIWPRLKIGGTLVYATCSILPEENQQQIISFLQRHADAVLRETGSPEKP------ 407

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                   ++  P   +         DGFF   L ++
Sbjct: 408 -------GVQKLPSPQDG--------DGFFYAKLIKI 429


>gi|126649674|ref|ZP_01721910.1| 16S rRNA m(5)C 967 methyltransferase [Bacillus sp. B14905]
 gi|126593393|gb|EAZ87338.1| 16S rRNA m(5)C 967 methyltransferase [Bacillus sp. B14905]
          Length = 453

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 124/460 (26%), Positives = 200/460 (43%), Gaps = 42/460 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R  +  +L  V + +     LL+          +  +D+ L+  +   TL+    +D 
Sbjct: 12  NVRDAALSILLAVDKNQAYSNLLLNETIKRHK---IEAKDRALLTELTYGTLQHKMTLDY 68

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
            L+  +  S+    + ++ LLR+S+ Q+ YL  +  +A V+ AVE AKR + +R  A  V
Sbjct: 69  YLEPFIRGSI---DHWVRWLLRISLYQMQYLTRIPAHAAVNEAVEIAKR-RGHRGIASTV 124

Query: 125 NSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N ILR V R+           ++R+A  +  P W  +R  + YG E    +      P  
Sbjct: 125 NGILRSVLRQGVPAITDIENPIERLAIETSHPIWLVQRFVDNYGLEVATGMLHENNVPPM 184

Query: 178 IDLTVKFDI---ETWAHKLNAVMLPTGG-----IRLKELPESIVSLPGFAEGVWWVQDAS 229
             + V       E    +L A  L           L            F EG   +QD S
Sbjct: 185 QTVRVNTTKVTVEQAIAELEAEGLTAKQSEVIPECLHLTNGQPARTHAFKEGHITIQDES 244

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           + IP  +      + VLD+CAAPGGKT     ++ +   + A D+   +L+ +  N +RL
Sbjct: 245 SMIPANVLNPSPGMRVLDMCAAPGGKTTHLAEIMKNEGSILATDLHPHKLDLIDHNTERL 304

Query: 287 HLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L   +   +D            +DAVLVDAPCS  G +RR PD+ +T+  +D+      
Sbjct: 305 GLDIIETAPIDGRKAPEFLQAESYDAVLVDAPCSGLGVMRRKPDIKYTKREEDLENLQTI 364

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q  LL      +K  G +V+S C++DKQ++E  V+  L + P  +E + L S   K  + 
Sbjct: 365 QLALLDAATKVLKIEGKLVYSTCTVDKQENEGTVKAFLATHP-EMEAIQLESLPTKLAEK 423

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                  G +++ P           G DGFF  A R+  +
Sbjct: 424 Q----ANGMLQVFPQDF--------GSDGFFVAAFRKKGE 451


>gi|319649620|ref|ZP_08003776.1| sun protein [Bacillus sp. 2_A_57_CT2]
 gi|317398782|gb|EFV79464.1| sun protein [Bacillus sp. 2_A_57_CT2]
          Length = 451

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 120/467 (25%), Positives = 214/467 (45%), Gaps = 40/467 (8%)

Query: 1   MKS--GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLR 58
           MK     N R  +  LL  + + +     LL+     +    + Q+D  L+  +   TL+
Sbjct: 1   MKKLKKKNVRETALELLEAIEKNQSYSNLLLNNAIKKN---EIDQKDIGLLTELTYGTLQ 57

Query: 59  FLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKEN 117
               +D  L   L  +  + +  + QLLR+++ Q+++LD + D A +  AVE AKR   +
Sbjct: 58  RRMTLDFYLQPFLAGN-KKIESWVNQLLRLTLYQMVFLDKIPDRAAIFEAVEIAKRW-GH 115

Query: 118 RHFAKLVNSILRRVSR-------EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
           +  + +VN +LR V R       +  + ++R++  +  P W  +R  +  G E    + +
Sbjct: 116 KGISGMVNGVLRNVQRKGLPDLEQIEDSVERLSIETSHPAWLVKRWADQLGFEETKKMCE 175

Query: 171 ACISPLYIDLTVK---FDIETWAHKLNAVMLPTGGIR-----LKELPESIVSLPGFAEGV 222
             ++       V       E     L          +     +K L  ++ +   F +G+
Sbjct: 176 INLTAPLQTARVNEVKASREECLSLLKEEGFEVEPSQFIPVAIKCLRGNLANSRVFKDGL 235

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKL 279
             +QD S+ +     G   N  +LD CAAPGGKT      + +  +V +LD+ + +++ +
Sbjct: 236 ITIQDESSMLAAYALGGNPNEKILDACAAPGGKTTHIAEKMQNTGQVISLDLHEHKVKLI 295

Query: 280 RCNLDRLHLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
             N DRL L       +D     ++  K+ FD +LVDAPCS  G +RR PD+ +T+  DD
Sbjct: 296 NDNADRLGLSNIKTNALDSRKVQEHYEKESFDRILVDAPCSGLGVMRRKPDMKYTKKEDD 355

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +      QR LL      +K GGI+V+S C++DK++++ VVQ  L+++      + +   
Sbjct: 356 LYHLHKIQRNLLDAVSPLLKKGGILVYSTCTVDKEENQHVVQSFLKNNAEFEGDISVRER 415

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
             K+I           ++I P  +        G DGF+   LR+ +Q
Sbjct: 416 MPKAI---APFIDNFELQILPQDI--------GSDGFYIACLRKKVQ 451


>gi|226313315|ref|YP_002773209.1| ribosomal RNA small subunit methyltransferase [Brevibacillus brevis
           NBRC 100599]
 gi|226096263|dbj|BAH44705.1| probable ribosomal RNA small subunit methyltransferase
           [Brevibacillus brevis NBRC 100599]
          Length = 448

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 117/461 (25%), Positives = 199/461 (43%), Gaps = 39/461 (8%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G  AR ++  +L+ V   +      L           LS  D  LV  +V  T++   
Sbjct: 3   KKG--ARDIALDVLNRVEEHKSYSNLELRNVLDR---ENLSAADAGLVTELVYGTIQRKM 57

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHF 120
            +D VL   + +   + +  ++ LLR+S+ QI +LD + + A V  AVE AK+ + ++  
Sbjct: 58  TLDHVLSHFVGN--KKVQTWVRNLLRLSLYQIHFLDRIPERAAVHQAVEIAKK-RGHQGI 114

Query: 121 AKLVNSILRRVSREKIELLQRI--------AGISIIPEWFKERLENFYGKERVLAISDAC 172
           A +VN +LR V R+     ++         A     PEW   +  N YG+E  +AI +A 
Sbjct: 115 ASMVNGVLRNVLRQPDVWERQPKGSRALQIAVAYSHPEWLVRQWLNVYGEETTIAICEAN 174

Query: 173 ISPLY--IDLTVKFDIET------WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
               +  I +      +           L           +      +     F EG + 
Sbjct: 175 NRTPHSAIRVNAWKTTKDQVLDKLAEEGLEGQASSVSPHAILMEGGHVAGSRLFKEGYFT 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +          + VLD CAAPGGKT     ++ +  ++ A DV   + + +  
Sbjct: 235 IQDESSMLVAPALAAQPGMRVLDACAAPGGKTTHIAEMMENRGEIIASDVHPHKRDLIAN 294

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
              RL +     I  DA D   K    FD +L+DAPC+  G IRR PD+ W +  +D+  
Sbjct: 295 AAKRLGITIIQPIVSDALDLPEKALGTFDRILLDAPCTGFGVIRRKPDLKWNKTPEDVRA 354

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  Q +LL      +  GG++V+S C+++  +++E+V++ +   P  V    L     +
Sbjct: 355 IAQLQYELLKTLAPLLAEGGVMVYSTCTIEPAENQEIVRRFVEEHPDFVFDDTLAQDLPE 414

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           ++   +  +    ++I P   E         DGFF   L+R
Sbjct: 415 AVRGHVDETGA-CVQILPHHFES--------DGFFIARLKR 446


>gi|294791792|ref|ZP_06756940.1| ribosomal RNA small subunit methyltransferase B [Veillonella sp.
           6_1_27]
 gi|294457022|gb|EFG25384.1| ribosomal RNA small subunit methyltransferase B [Veillonella sp.
           6_1_27]
          Length = 451

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 102/461 (22%), Positives = 182/461 (39%), Gaps = 46/461 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N RL++   LS + R        L           LS  D+     +V   +R    +DA
Sbjct: 11  NIRLLAVKALSEINRNGAYANIKLQEYLQKYH---LSDLDRRFFTELVYGVIRRKNYLDA 67

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       L +    + ++LR+ + QI+Y+D V + A V+ +V+ AK+    R  +  V
Sbjct: 68  IIVHFAKRPLKKLSSMVVEILRLGIYQIIYMDKVPESAAVNESVKLAKK--LTRGLSGFV 125

Query: 125 NSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N++LR V RE   +            I+ I   P W         GK++ + +       
Sbjct: 126 NAVLRSVLRESDSISIGELAKSEAEEISFIYNQPLWLVNLWIKEMGKDKTVDLCSWFNEQ 185

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPTGGI-------RLKELPESIVSLPGFAEGVWWV 225
             +   +      IE    +L  +               +      +       EG    
Sbjct: 186 PRLTARINTVKVSIEDCLKELEDLDWIVEQDTYIPEVVYIDGHQGHLEKAKPVLEGHITF 245

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
            D ++ +   +        +LD CAAPGGK+  +   + +   + + D+   +LE +  N
Sbjct: 246 MDKASMLVAHVVDPQPGERILDCCAAPGGKSMHMASLMNNTGAIMSCDIYDHKLELINQN 305

Query: 283 LDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            +RL +        D        K+ FD VLVDAPCS  G +++  D+ W +    ++K 
Sbjct: 306 AERLGVSIISTKLQDGRYLPDNWKEQFDRVLVDAPCSGLGILQKKLDMRWRKTESLLIKL 365

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L +    VK  G +V+S C+++  ++E V+ K L      +    ++   +K 
Sbjct: 366 PLLQLEILEKASEMVKVNGYLVYSTCTMNSGENEAVLNKFLAIHKNFI----IDPVSYKG 421

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              A+    +G I   P            MDGFF   ++RL
Sbjct: 422 APQAI----DGMITTYP--------PRDHMDGFFMARMKRL 450


>gi|56415328|ref|YP_152403.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|197364258|ref|YP_002143895.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|81360778|sp|Q5PIT6|RSMB_SALPA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493266|sp|B5BGV5|RSMB_SALPK RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|56129585|gb|AAV79091.1| sun protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. ATCC 9150]
 gi|197095735|emb|CAR61305.1| sun protein [Salmonella enterica subsp. enterica serovar Paratyphi
           A str. AKU_12601]
          Length = 429

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDTVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|39998462|ref|NP_954413.1| Sun protein [Geobacter sulfurreducens PCA]
 gi|39985409|gb|AAR36763.1| Sun protein [Geobacter sulfurreducens PCA]
 gi|298507406|gb|ADI86129.1| 16S rRNA (5-methyl-C967)-methyltransferase [Geobacter
           sulfurreducens KN400]
          Length = 448

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 122/464 (26%), Positives = 197/464 (42%), Gaps = 41/464 (8%)

Query: 1   MKSGMN-ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M       R  +  +L  + R+R     L+D E    A   L   D+ L+  +V   LR 
Sbjct: 1   MNQSTADPRRSAFDILVRIERERTFAEPLIDRELSGGA---LKGPDRGLLTELVYGVLRR 57

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENR 118
              +D ++D    +   + + S+  LLR+ + QI +LD +   A V+  V  A+   ++ 
Sbjct: 58  TATLDYLVDLFCATRAAKLERSVLILLRLGLYQIFFLDRIPVSAAVNETVTLARE--KSP 115

Query: 119 HFAKLVNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS 169
             + LVN++LRR               +    +A     P W  E      G E   A++
Sbjct: 116 RASGLVNAVLRRSDRERSSIAWPDRVRDPAGYLALRHSHPRWIVEGWIAQLGFEEAEALA 175

Query: 170 DACISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAE 220
           +   +P  + L V       E +   L          R            ++ +LPGF E
Sbjct: 176 EVMAAPPPLTLRVNTLRTSREAYLELLREAGTEAEPTRHSPHGIRILSRTAVPALPGFGE 235

Query: 221 GVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLE 277
           G+  VQD S+ +   L    +   VLD CA+PGGK      ++    +V A DVS+++L 
Sbjct: 236 GLVIVQDESSQLASLLLEPRSGERVLDACASPGGKATHLAQIMADKGEVIAWDVSEKKLS 295

Query: 278 KLRCNLDRLHLYAEDIIEMDAFDYCPKK-LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
            +  N  RL +        DA +       FD +LVDAPCS+ G +RR P+  W +  DD
Sbjct: 296 PIAENARRLGIGIIRPAMADARNPEQNAAPFDRILVDAPCSALGVLRRTPEGKWWKTPDD 355

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           + + A  Q ++L    S +KPGG +++S CS    ++E +++  L      +    L   
Sbjct: 356 VARLAQSQCRILAGAASLLKPGGTLLYSTCSTTTDENESIIEDFLSRRADFM----LEDL 411

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +    ++  ++  G  R  P           GMDGFFA  LRR
Sbjct: 412 NYLFPGLSECITDRGMFRSWPH--------RHGMDGFFAARLRR 447


>gi|332799419|ref|YP_004460918.1| sun protein [Tepidanaerobacter sp. Re1]
 gi|332697154|gb|AEE91611.1| sun protein [Tepidanaerobacter sp. Re1]
          Length = 448

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 113/460 (24%), Positives = 197/460 (42%), Gaps = 40/460 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R ++  +L  + ++      LL+          +S +D+ LV  +VN  ++ L RID 
Sbjct: 3   NPRELAICMLIKI-QEGSYGNLLLNQHLTS----DMSLKDRALVTELVNGVVQNLLRIDY 57

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++       L +    ++  +RV + Q  +LD V D+A V+ +V   K+ +  +  A   
Sbjct: 58  IISQFSKIDLSKISPFVKNAIRVGIYQTFFLDRVPDFAAVNESVSLVKKYEG-KRAANFT 116

Query: 125 NSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N+ILR             + I + + ++     P W  +R    + K     +  A    
Sbjct: 117 NAILRNVLRKRDKIVYPNKNINIEKYLSIYYSFPSWLIQRWIELFDKNFTEELCMALNER 176

Query: 176 LYIDLTVKF---DIETWAHKLNAVML------PTGGIRLKELPESIVSLPGFAEGVWWVQ 226
               + V     D E    +L+A          T           I  L  F +G++  Q
Sbjct: 177 PKPCIRVNTLVADREELEKQLSAEGARVAPGLFTEETLYILDSPPIAQLESFNKGLFAPQ 236

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ I     G  +N  VLD+ AAPGGKTA +   + +  ++ A D+   R+  +  N 
Sbjct: 237 DESSIIASLAAGVKSNDKVLDVAAAPGGKTAHMAAIMQNKGEIIAWDIHPHRVRLIEQNC 296

Query: 284 DRLHLYAE--DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
            RL       ++      D    + FD V++DAPCS  G IRR PD+ W++  +DI    
Sbjct: 297 RRLKATIVVPEVRNAKIPDKNMFRKFDKVIIDAPCSGLGVIRRKPDIKWSKKPEDITALK 356

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q+++L     +VKPGG +++S CS++ +++E+ V + L  +   +        Y    
Sbjct: 357 SEQKEILEVCSKYVKPGGFLIYSTCSIEPEENEKNVDEFLAKNDSFI--YDDLRPYLPEK 414

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                    G+I + P++         G DGFF   L+R+
Sbjct: 415 LHNSLKQSYGYITLYPNI--------HGTDGFFIARLKRI 446


>gi|291484126|dbj|BAI85201.1| hypothetical protein BSNT_02587 [Bacillus subtilis subsp. natto
           BEST195]
          Length = 447

 Score =  271 bits (693), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 126/463 (27%), Positives = 206/463 (44%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   + R ++   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKK-TSVRDIALEALIKLEQNQAYSNLLLKSVIKSN---ELSDQDRGLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S+ Q+ YL+ + D A +  AVE AK  + ++ 
Sbjct: 57  IALDYMLKPFINKP-QKVKPWVIQLLRLSLYQMEYLEKIPDRAAIHEAVEIAK-IRGHKG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN +LR + RE +     I       A  +  PEW  +   + YG E    I    
Sbjct: 115 IASFVNGVLRSIQREGVPSFDAIEDPVRRLATETSHPEWLVKEWADAYGFEAAEKICRIH 174

Query: 173 ISPLYIDLTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P    L V       A  L+                  +K L  +I     F  G   
Sbjct: 175 LIPPKQTLRVNQMKADRAELLDQMAAEGIEVEKGDLAEDAVKLLKGTIAGTHFFQNGEVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +      + +VLD CAAPGGK+A +   + +   VT+LD+ K +++ ++ 
Sbjct: 235 IQDESSMLVARALDPKPDETVLDACAAPGGKSAHIAELMQNKGSVTSLDLHKHKVKLIKE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             DRL L       MDA         + FD +LVDAPCS  G IRR PD+ +T+  DD  
Sbjct: 295 AADRLGLTIIHAETMDARKAGETFENEQFDRILVDAPCSGFGVIRRKPDMKYTKKPDDSA 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q  +L +    VK GG +V+S C++D+ +++EV+   ++  P      P  S   
Sbjct: 355 RLAEIQLSILREIAPLVKKGGTLVYSTCTMDRTENDEVIHAFIQEHPDF---EPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  +       +G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKVRPFVRDGRLQILPHYF--------GTDGFFICSMRKK 446


>gi|331082369|ref|ZP_08331495.1| ribosomal RNA small subunit methyltransferase B [Lachnospiraceae
           bacterium 6_1_63FAA]
 gi|330400855|gb|EGG80456.1| ribosomal RNA small subunit methyltransferase B [Lachnospiraceae
           bacterium 6_1_63FAA]
          Length = 454

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 104/466 (22%), Positives = 214/466 (45%), Gaps = 38/466 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M + +N R +   +L  + ++      ++        ++ L ++++  +  +   TL + 
Sbjct: 1   MVNKVNLRELVLGILLEINKEGQHSHLVIRSTLE--KYQYLEKQERAFLTRVCEGTLEYK 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
            R+D +LD      + + K  ++++LR SV Q+LY+D V D AV D AV+ A++ K   +
Sbjct: 59  LRLDYILDQYSSVPVEKMKPVIREILRSSVYQLLYMDNVPDSAVCDEAVKLARK-KGFYN 117

Query: 120 FAKLVNSILRR--------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
               VN +LR+           EK + ++ ++ +  +P+W  E+    YG E+   + +A
Sbjct: 118 LTGFVNGVLRKVARDYSSIHFPEKNQPIEYLSVLYSMPKWLVEKFLAEYGFEKTEKMLEA 177

Query: 172 CISPLYIDLTVKFDIETWAHKLNAV---------MLPTGGIRLKELPESIVSLPGFAEGV 222
            +      + ++  +      L+++                   +  + + +L  F  G 
Sbjct: 178 FLKEKPTTIRIRQHLVDKDAVLDSLKRQNVTVEPAPYAENAYYIKNYDYLPALEAFRMGN 237

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKL 279
             VQD S+ +  ++        V+DLCAAPGGKT  +        ++ A D+S+ + + +
Sbjct: 238 IQVQDVSSMLVGEVADPKEGDYVIDLCAAPGGKTLCIADKLKGTGRIDARDISRTKTDLI 297

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           R N  R +     + E DA     +  +  D ++ D PCS  G I +  D+ +      I
Sbjct: 298 RENAIRQNFLNVVVSEKDATQLDSESFEKADILIADVPCSGLGVIGKKTDIKYNITQTGI 357

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            +    QRK+L Q  ++VKPGG +++S C+++++++ E V+  + + P  +E +      
Sbjct: 358 AELVNLQRKILEQASTYVKPGGTLIYSTCTINREENIENVRWFVENYPYELESID----D 413

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
           +   ++    + EG++++ P +           DGFF   L+R  +
Sbjct: 414 YLCEELRSDTTKEGYLQLLPGV--------HDCDGFFIARLKRKTE 451


>gi|170724406|ref|YP_001758432.1| sun protein [Shewanella woodyi ATCC 51908]
 gi|169809753|gb|ACA84337.1| sun protein [Shewanella woodyi ATCC 51908]
          Length = 425

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 119/447 (26%), Positives = 203/447 (45%), Gaps = 34/447 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L  +         S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALPEQQKHCE----SGKDKALLAELSYGVMRQLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  L QLL V   Q+ +  +  +A +    E A R  +     K++
Sbjct: 57  KLISDCMAKPLKGKQRILHQLLLVGCYQLYFTRIPSHAAISETAE-ACRQLKFDGLVKVI 115

Query: 125 NSILRRVSREKIELLQRIAGI-SIIPEWFKERLENFYGKERVLAISDACISP-LYIDLTV 182
           N++LR + R++  L      +    P W  + L+  Y       I ++   P +++   V
Sbjct: 116 NAVLRNIQRQEKPLPTDNDTLTYNTPAWIIKSLKQAYPDSWQTVIENSHQRPPMWLRNNV 175

Query: 183 KFDIET------WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
           +              +++A    +    L E P+ ++ LPGF +G   VQD +A     L
Sbjct: 176 RSQTRDEYLALLAEAEISASAGQSSDAILLESPKDVMQLPGFEQGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQL-IVSGAKVTALDVSKRRLEKLRCNLDRLHLYA--EDI 293
               +   +LD CAAPGGKT  +   +  ++ A+D    RLE+++ NLDRL L A     
Sbjct: 236 LAPADGELILDACAAPGGKTCHILERADTELVAVDFDANRLERVQQNLDRLSLNAKLVHG 295

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
              D   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q K+L     
Sbjct: 296 DAADIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIEELAQLQSKILDHCWK 355

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWI 413
           ++KPGG ++++ CS+  Q++ + +   L  +     +          I            
Sbjct: 356 WLKPGGTLLYATCSILPQENAQQISAFLERTHDATLIAISQQPNPDDIGW---------- 405

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRR 440
           +ITP         +  MDGF+   L +
Sbjct: 406 QITPG--------TENMDGFYYARLVK 424


>gi|260771086|ref|ZP_05880014.1| ribosomal RNA small subunit methyltransferase B [Vibrio furnissii
           CIP 102972]
 gi|260613975|gb|EEX39166.1| ribosomal RNA small subunit methyltransferase B [Vibrio furnissii
           CIP 102972]
          Length = 426

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 124/454 (27%), Positives = 206/454 (45%), Gaps = 44/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ +L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAAQVLFQVVDKGQSLSMALP-----AAQQNIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ S L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIANALMDSPLKGKQRVFHHLILVGIYQLSFMRIPPHAAVGETVEGAQDLKGPR-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGK-ERVLAISDACISPLYID 179
           N++LR   R +     E +   AG    P W  + L+N Y +    +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQDALDTEAMSHNAGKYGHPSWLLKLLQNAYPQQWEAIVEANNSKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +     + + +   LN   + +              P  +  LPGFA+G   VQDA+A +
Sbjct: 175 VNHQHHERDAYQALLNHENIDSSVHSQAHDALKLAAPCDVTQLPGFAQGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA       G  V A+D    RL+++  NL RL+L A
Sbjct: 235 ALHYLQPQDGELILDCCAAPGGKTAHILERTHGCDVVAIDCDDTRLKRVHDNLKRLNLSA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                       +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++L
Sbjct: 295 KVVCGDARYPEQWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALAELQREIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q++   V+  L  +                  +  +  
Sbjct: 355 DAMWQQLKPGGTLVYATCSITPQENVLQVKDFLARTSNA--------------QLVGSEL 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                +I P            MDGF+   L +  
Sbjct: 401 DNPGRQILPG--------EEDMDGFYYAVLTKQA 426


>gi|13473485|ref|NP_105052.1| hypothetical protein mlr4098 [Mesorhizobium loti MAFF303099]
 gi|14024234|dbj|BAB50838.1| mlr4098 [Mesorhizobium loti MAFF303099]
          Length = 462

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 194/424 (45%), Positives = 261/424 (61%), Gaps = 5/424 (1%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+  R  L  L D E G   ++ L  RD+ LVRAI+   LRF   I  +L   L   LP 
Sbjct: 41  VIDARTPLDGLTDHENGHPQYKALDLRDRGLVRAILVTALRFRMTITGLLARRLEKPLPP 100

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L V+ AQIL+LD+ D A VDLAV  AK D   + F+ LVN +LR ++R K  
Sbjct: 101 NATALSHILHVAAAQILFLDIPDSAAVDLAVTHAKSDPRTQRFSGLVNGVLRTLARAKET 160

Query: 138 L-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
                +A     P+WF +RL+  YG+++   I  A      +D +V+ D E WA KL  +
Sbjct: 161 ELPAALAATDEAPKWFSDRLKAAYGEDKAKQILAAHRYEAPVDFSVRADPELWAEKLGGI 220

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +R++ L  ++  LPGFAEG WWVQDA+AS+P +LFG +  L V DLCAAPGGKT
Sbjct: 221 VLPTGTVRVENLAGAVTDLPGFAEGAWWVQDAAASLPARLFGDVGGLRVADLCAAPGGKT 280

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQLI++GAKVTA+D SK RL +L  NLDRL L AE + + D   Y P +LFDAVL+DAPC
Sbjct: 281 AQLILAGAKVTAVDTSKNRLARLAQNLDRLGLSAEIV-QADLLKYEPAELFDAVLLDAPC 339

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+   D+ K A  QR+LL + ++ V+PGG +VFSNCSLD  + EE+
Sbjct: 340 SSTGTVRRHPDVPWTKTAADVEKLADLQRRLLARAVTLVRPGGRIVFSNCSLDPLEGEEL 399

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
               L+ +P    +V       +   +   L+ +G +R TP  L+      SG+DGFFA 
Sbjct: 400 HLAFLKETP---VVVDDPLRQGEIAGIDPFLTAQGTLRTTPADLDLGAPERSGLDGFFAA 456

Query: 437 ALRR 440
            +RR
Sbjct: 457 RMRR 460


>gi|321315340|ref|YP_004207627.1| 16S rRNA methyltransferase B [Bacillus subtilis BSn5]
 gi|320021614|gb|ADV96600.1| 16S rRNA methyltransferase B [Bacillus subtilis BSn5]
          Length = 447

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 126/463 (27%), Positives = 206/463 (44%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   + R ++   L  + + +     LL      +    LS +D+ L+  +V  TL+  
Sbjct: 1   MKK-TSVRDIALEALIKLEQNQAYSNLLLKSVIKSN---ELSDQDRGLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S+ Q+ YL+ + D A +  AVE AK  + ++ 
Sbjct: 57  IALDYMLKPFINKP-QKVKPWVIQLLRLSLYQMEYLEKIPDRAAIHEAVEIAK-IRGHKG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN +LR + RE +     I       A  +  PEW  +   + YG E    I    
Sbjct: 115 IASFVNGVLRSIQREGVPSFDAIEDPVRRLATETSHPEWLVKEWADAYGFEAAEKICRIH 174

Query: 173 ISPLYIDLTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P    L V       A  L+                  +K L  +I     F  G   
Sbjct: 175 LIPPKQTLRVNQMKADRAELLDQMAAEGIEVEKGDLAEDAVKLLKGTIAGTHFFQNGEVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +      + +VLD CAAPGGK+A +   + +   VT+LD+ K +++ ++ 
Sbjct: 235 IQDESSMLVARALDPKPDETVLDACAAPGGKSAHIAELMKNKGSVTSLDLHKHKVKLIKE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             DRL L       MDA         + FD +LVDAPCS  G IRR PD+ +T+  DD  
Sbjct: 295 AADRLGLTIIHAETMDARKAGETFENEQFDRILVDAPCSGFGVIRRKPDMKYTKKPDDSA 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q  +L +    VK GG +V+S C++D+ +++EV+   ++  P      P  S   
Sbjct: 355 RLAEIQLSILREIAPLVKKGGTLVYSTCTMDRTENDEVIHAFIQEHPDF---EPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  +       +G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKVRPFVRDGRLQILPHYF--------GTDGFFICSMRKK 446


>gi|119773183|ref|YP_925923.1| sun protein [Shewanella amazonensis SB2B]
 gi|119765683|gb|ABL98253.1| sun protein [Shewanella amazonensis SB2B]
          Length = 427

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 119/447 (26%), Positives = 199/447 (44%), Gaps = 34/447 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ + +SL+  L  +       L   +D+ L+  I    +R LP++D
Sbjct: 1   MNIRALAAKAIFDVLERGVSLSVALPTQ----QLWLRDGKDKALLAEICYGVMRSLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            ++   +   L  K+  + QLL V   Q+ +  V  +A +    E  +         K+V
Sbjct: 57  KLVSGYMQKPLKGKQRVVHQLLLVGAYQLYFTRVPAHAAISETAEGCRA-LGFESLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAG-ISIIPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R+   L +         P W   RL++ Y +     I  +   P     +  
Sbjct: 116 NGVLRNIQRQVPPLDESNDTLKYNFPAWIIRRLKDAYPETWENIIEASHQRPPMWLRNNR 175

Query: 182 VKFDIETWAHKLN-----AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                + +   L+     AV  P       E    +  LP FA+G   VQD +A     L
Sbjct: 176 RHQSRDAYLQALSDAEVSAVAGPGEDAICLEFATDVARLPHFADGASSVQDGAAQWAASL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQLIV-SGAKVTALDVSKRRLEKLRCNLDRLHLYA--EDI 293
               +   VLD CAAPGGK+  L+  +  ++ A+D  ++RLE++  NL+RL L A     
Sbjct: 236 LAPRDGELVLDACAAPGGKSCHLLELADIELVAVDFDQKRLERVSQNLERLKLDARVIHG 295

Query: 294 IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGIS 353
              D   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q+++L     
Sbjct: 296 DAGDIGSWWQGGKFDRILLDAPCSATGVIRRHPDIKWLRQNNDIAELAKLQQQILDNCWQ 355

Query: 354 FVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWI 413
           ++KPGG ++++ CS+  +++ E ++  L  +P        N A    I            
Sbjct: 356 WLKPGGTLLYATCSILPEENREQIKAFLERTPDATLETLPNQANNNDIGW---------- 405

Query: 414 RITPDMLEKIDGVSSGMDGFFAVALRR 440
           +I P            MDGF+   L++
Sbjct: 406 QILPG--------QDDMDGFYYARLKK 424


>gi|253580147|ref|ZP_04857414.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251848666|gb|EES76629.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 450

 Score =  271 bits (692), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 108/465 (23%), Positives = 201/465 (43%), Gaps = 39/465 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M +G+N R +   +L  +  +       +      S ++ L ++++  +  +   TL + 
Sbjct: 1   MTNGINTRELILQILLEIEEEGKHSHIAIRNAL--SKYQFLPRQERAFITRVCEGTLEYR 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID ++D     S+ + K  ++++LR +V QI ++D V D AV + AV+ A+R K    
Sbjct: 59  ILIDYIIDSYSKVSVDKMKPVIREILRSAVYQIRFMDSVPDSAVCNEAVKLAQR-KGFYS 117

Query: 120 FAKLVNSILRRVSREKIE---------LLQRIAGISIIPEWFKERLENFYGKERVLAISD 170
               VN +LR ++RE             ++ ++    +PE    R    YG+E+   I  
Sbjct: 118 LKPFVNGVLRTIAREWKNLKLPSREENPVRYLSVRYSMPETLVNRWLEDYGEEKTEKILT 177

Query: 171 ACISPLYIDL----TVKFDIETWAHKLNAVMLPTGGIRLKELPE-----SIVSLPGFAEG 221
             ++   I +          E +   ++  +       L    E      I++L  F +G
Sbjct: 178 DFLTEKPITVRCRTHKYPQKEIYESLVDQGVEVKPAPYLPYAYEISNYNHILALDAFIQG 237

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEK 278
              VQD S+ +  ++        V+D+CAAPGGK+      +     V A D+S+ +++ 
Sbjct: 238 KIQVQDVSSMLVAEIADPQKGDYVIDMCAAPGGKSLHVADKMGDYGTVDARDISQYKVDM 297

Query: 279 LRCNLDRLHLYAEDIIEMD--AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +  N+ R          MD   FD   +   D VL D PCS  G I + P++ +      
Sbjct: 298 IEENIHRTDCINVQAHVMDATVFDVDSELKADVVLADVPCSGYGVIGKKPEIKYRVTAQK 357

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
             +    QR +L     +VKPGG++VFS C++ K+++EE +   + + P  +E +     
Sbjct: 358 QEEIVILQRTILDNAAEYVKPGGVLVFSTCTIAKEENEENMLWFMNNHPFKLESIDPYLP 417

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                ++    +  G++++ P +           DGFF    RR 
Sbjct: 418 E----ELHSETTALGYLQLLPGV--------HKTDGFFIAKFRRK 450


>gi|282901368|ref|ZP_06309293.1| Fmu, rRNA SAM-dependent methyltransferase [Cylindrospermopsis
           raciborskii CS-505]
 gi|281193647|gb|EFA68619.1| Fmu, rRNA SAM-dependent methyltransferase [Cylindrospermopsis
           raciborskii CS-505]
          Length = 446

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 122/465 (26%), Positives = 201/465 (43%), Gaps = 47/465 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M + ++ R ++   L  V  +       +D          LS  D+ L+  +V  ++R  
Sbjct: 1   MNT-LSTRQIAFTALREV-HRGAYADIAIDRTLHKFK---LSDHDRRLMTELVYGSVRRQ 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRH 119
             +DA++D +     P++   L+ +L + + Q+ Y   +   A V+  V+ AK +     
Sbjct: 56  RSLDAIIDQIADKKSPQQPRDLRCILHLGLYQLRYQQKIPVSAAVNTTVQLAKEN-GFPG 114

Query: 120 FAKLVNSILRRVSREKIELLQRIA----------GISIIPEWFKERLENFYGKERVLAIS 169
               VN  LR+  R   +    +            +   P W  E   +  G+E    + 
Sbjct: 115 LTGFVNGFLRQYIRLLEKTSDPLILPENLVERLGILYSFPNWVIEVWLSQLGQEETEKLC 174

Query: 170 DACISPLYIDLTVKFDIETWAH----------KLNAVMLPTGGIRLKELPESIVSLPGFA 219
                   IDL V     +              L+ +     G+RL      I +LPGF 
Sbjct: 175 QWMNQTPTIDLRVNILRASVEMVESVFKKSGILLHRIPHLPQGLRLVGPAGPIQNLPGFT 234

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRL 276
           EG W +QDA+A +   L        ++D+CAAPGGKT  +   +    K+ A D +  RL
Sbjct: 235 EGWWCIQDAAAQLVGHLLDPRPGEVIIDVCAAPGGKTTHIAELMGDNGKIYACDRTPSRL 294

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFDYCPKKL-FDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            KL  N  RL L + +I   D+ ++       D VL+DAPCS  GT+ RH D  W ++  
Sbjct: 295 RKLSENAQRLRLQSIEIFPGDSRNFTKFHHLADRVLLDAPCSGLGTMHRHADARWRQNLS 354

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
            +   A  QR+L+    +FVKPGG++V++ C+L  Q++EE++++ L  +P      P   
Sbjct: 355 SVGDLAHIQRELISHTANFVKPGGVLVYATCTLHPQENEELIREFLHVNPQWEMEKPNLD 414

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                      +S  GW+++ P            MDGFF V LR+
Sbjct: 415 FL--------DVSSPGWLKLWPH--------QQNMDGFFLVRLRK 443


>gi|197249972|ref|YP_002148329.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|224493258|sp|B5F7R5|RSMB_SALA4 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|197213675|gb|ACH51072.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Agona str. SL483]
          Length = 429

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 120/457 (26%), Positives = 208/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      + PGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLNPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|319404848|emb|CBI78449.1| SUN-family protein [Bartonella rochalimae ATCC BAA-1498]
          Length = 456

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 194/445 (43%), Positives = 260/445 (58%), Gaps = 11/445 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ KR SL  L D EYG   +  LS RD++L RAI+   LR   +
Sbjct: 16  PGLAVRQVCVRLLGAVLDKRTSLAGLTDNEYGHPQYLKLSYRDRLLCRAILGAALRHRSQ 75

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L+  LP + +SL  LL +S+ QILYLD+ D+A +DLAV  AK D     F+ 
Sbjct: 76  ITVALSRFLVRPLPAQAFSLHHLLHISITQILYLDIPDHAAIDLAVRVAKIDPRMPRFSG 135

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN+ILR  +RE   L  +   I  IP WF + L + YG E+   I         +DLTV
Sbjct: 136 LVNAILRNFAREAPILRMQTPTIKAIPMWFGQLLVSTYGAEKADQILAIQSITPPLDLTV 195

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  ++LP G +RL     S+  LPG+AEG WWVQD +A++P +L G +  
Sbjct: 196 KSDSAGWAKRLGGIVLPNGSVRLISSAYSVADLPGYAEGAWWVQDVAAALPARLLGNVCG 255

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL + GA VTALD+S  RL++LR N+DRL+         D   + 
Sbjct: 256 KKVADLCASPGGKTAQLALQGADVTALDISANRLKRLRENMDRLNFS-VHYWLGDLRQFH 314

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P +LFDAVL+D PCSSTGTIRRHPD+LWT+  DD+ K A  Q  LLL  I  VK  G +V
Sbjct: 315 PDQLFDAVLLDTPCSSTGTIRRHPDILWTKTMDDVTKLAEVQYDLLLAAIDLVKKNGCIV 374

Query: 363 FSNCSLDKQDSEEVVQKVLR-SSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           FSNCSL +++ E++V+K+L       + L P+ +   +   MA  +S EG++R  P    
Sbjct: 375 FSNCSLAREEGEDLVKKILAIRH--DIVLEPILAE--EMGAMAHLISMEGFLRTIPSDCC 430

Query: 422 KIDGVSS-----GMDGFFAVALRRL 441
             +  +      GMDGFFA   R++
Sbjct: 431 YENFNTEEKLFLGMDGFFAARFRKV 455


>gi|161506038|ref|YP_001573150.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|224493259|sp|A9MN78|RSMB_SALAR RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|160867385|gb|ABX24008.1| hypothetical protein SARI_04219 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 429

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 124/457 (27%), Positives = 210/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V      N   +LDLCAAPGGKT  ++     A V A+DV ++RL ++  NL RL 
Sbjct: 235 AQKCVAFLAPQNGEHILDLCAAPGGKTTHILEAAPEADVLAVDVDEQRLSRIYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCDEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAKLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++   +   L+ +P                ++ 
Sbjct: 354 AEILDTVWPRLKPGGTLVYATCSVLPEENSAQINAFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            A   EG                   DGFF   L + 
Sbjct: 414 GA--EEG-------------------DGFFYAKLIKK 429


>gi|299535921|ref|ZP_07049241.1| ribosomal RNA small subunit methyltransferase B [Lysinibacillus
           fusiformis ZC1]
 gi|298728673|gb|EFI69228.1| ribosomal RNA small subunit methyltransferase B [Lysinibacillus
           fusiformis ZC1]
          Length = 453

 Score =  271 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 126/460 (27%), Positives = 200/460 (43%), Gaps = 42/460 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R  +  +L  V + +     LL+          +  +D+ L+  I   TL++   +D 
Sbjct: 12  NVRDAALSILLAVDKNQAYSNLLLNETIKRHK---IEAKDRALLTEITYGTLQYKMTLDY 68

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
            L+  + SS+    + ++ LLR+S+ QI YL  +  +A V+ AVE AKR + +R  A +V
Sbjct: 69  YLEPFIRSSI---DHWVRWLLRISLYQIHYLTRIPPHAAVNEAVEIAKR-RGHRGIASMV 124

Query: 125 NSILRRVSREKIELLQRIAG-------ISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N ILR V R  +     IA         +  P W  +R  + YG E    +      P  
Sbjct: 125 NGILRSVLRSGVPSTDDIADPIERLSIETSHPMWLVQRFVDNYGLEVATEMLHENNRPPV 184

Query: 178 IDLTVKFDIETW--------AHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
             + V     T         A  L A+        L            F EG+  +QD S
Sbjct: 185 QTVRVNTTKATVKQAIAELEAEGLTAIQSDVIPECLYITNGQPARTKAFKEGMITIQDES 244

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           + IP  +      + VLD+CAAPGGKT  +   + +   + A D+   +L+ +  N +RL
Sbjct: 245 SMIPANVLNPSPGMRVLDMCAAPGGKTTHIAEIMQNEGSILATDLHPHKLDLIDHNTERL 304

Query: 287 HLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L   +   +D            FDA+LVDAPCS  G +RR PD+ +T+  +D+      
Sbjct: 305 GLDIVETAPIDGRKAPEFLQAASFDAILVDAPCSGLGVMRRKPDIKYTKREEDLESLQKI 364

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q  LL      +K  G +V+S C++D Q++E  V+  L + P  +E + L S   K  + 
Sbjct: 365 QLALLDAATKVLKTDGKLVYSTCTVDIQENEGTVKAFLTAHP-EMEAIQLESLPTKLAEK 423

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                  G +++ P           G DGFF  A R+  +
Sbjct: 424 Q----ANGMLQVFPQDF--------GSDGFFVAAFRKKGE 451


>gi|291527116|emb|CBK92702.1| ribosomal RNA small subunit methyltransferase RsmB [Eubacterium
           rectale M104/1]
          Length = 469

 Score =  271 bits (691), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 103/453 (22%), Positives = 197/453 (43%), Gaps = 40/453 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
            ++ R ++  +L  +  +      +L        ++ LS++D+  +  +V+ T+ ++ ++
Sbjct: 38  SVDTRELALEMLIEINERGAFSHIVLRSVL--DKYQYLSKQDRAFMTRLVDGTIEYMLQL 95

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D ++D    + + + K  ++ LLR+SV QI Y+D V D AV + AV+ AKR K  +  + 
Sbjct: 96  DYIIDSFSKTKVRKMKPFIRNLLRMSVYQIKYMDAVPDSAVCNEAVKLAKRHKFAQ-LSG 154

Query: 123 LVNSILRRVSREKIELLQRI-AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            VN +LR ++R    +     +    +P+W  +R    YG+++   I  A  S   I + 
Sbjct: 155 FVNGVLRNIARNIDSVQFDTLSIRYSMPQWIVDRFVAEYGEKKAEEIFKAFHSKSTISIR 214

Query: 182 VKFDI---ETWAHKLNAVMLPT------GGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                   +     L A  +            +    + +  L  F +G+++VQD S+ +
Sbjct: 215 TNLTRCTPDELRAMLEAEGVIVTPVDELNYAFVISGFDYLNGLQSFRDGLFYVQDISSML 274

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
             Q         V+D+CAAPGGK+  +         V A D++  ++  +  N+DR  L 
Sbjct: 275 VAQTAAPKKGDYVIDVCAAPGGKSTHIAELLKGSGHVLARDLTDTKVGMIEENIDRHGLN 334

Query: 290 AEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
                  DA        +  D ++ D PCS  G + R  D+ +    + + + A  QR++
Sbjct: 335 NMSAEVWDATVPDADSAEKADILICDLPCSGLGVLGRKKDIRYKMTPESVDELAALQRQI 394

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L    ++VKP G++V+S C++D+ ++E+ V+  +   P     +                
Sbjct: 395 LDTVHTYVKPNGVLVYSTCTIDEAENEDNVRWFIEKHPEFELDMSFAEGT---------- 444

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              G  +I P           G DGFF     +
Sbjct: 445 ---GMKQILPG--------EHGSDGFFIARFIK 466


>gi|169827064|ref|YP_001697222.1| ribosomal RNA small subunit methyltransferase B [Lysinibacillus
           sphaericus C3-41]
 gi|168991552|gb|ACA39092.1| Ribosomal RNA small subunit methyltransferase B [Lysinibacillus
           sphaericus C3-41]
          Length = 453

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 121/460 (26%), Positives = 195/460 (42%), Gaps = 42/460 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R  +  +L  V + +     LL+          +  +D+ L+  +   TL+    +D 
Sbjct: 12  NVRDAALSILLAVDKNQAYSNLLLNETIKRHK---IEAKDRALLTELTYGTLQHKMTLDY 68

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
            L+  +  S+    + ++ LLR+S+ Q+ YL  +  +A V+ AVE AKR + +R  A  V
Sbjct: 69  YLEPFIRGSI---DHWVRWLLRISLYQMQYLTRIPAHAAVNEAVEIAKR-RGHRGIASTV 124

Query: 125 NSILRR-------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N ILR           +    ++R+A  +  P W  +R  N YG E    +      P  
Sbjct: 125 NGILRSVLRQGVPSINDIENPIERLAIETSHPIWLVQRFVNNYGLEVATGMLHENNVPPI 184

Query: 178 IDLTVKFDIETWAHK--------LNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
             + V     T            L A         L            F EG   +QD S
Sbjct: 185 QTVRVNTTKVTVEQAMAELEEEGLTAKQSDVIPECLHVTNGQPARTNAFKEGHITIQDES 244

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           + IP  +      + VLD+CAAPGGKT     ++ +   + A D+   +L+ +  N +RL
Sbjct: 245 SMIPANVLKPSPGMRVLDMCAAPGGKTTHLAEIMKNEGSILATDLHPHKLDLIDHNTERL 304

Query: 287 HLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L   +   +D            +DA+LVDAPCS  G +RR PD+ +T+  +D+      
Sbjct: 305 GLDIIETAPIDGRKAPEFLQAESYDAILVDAPCSGLGVMRRKPDIKYTKREEDLENLQTI 364

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q  LL      +K  G +V+S C++DKQ++E  V   L + P  +E + L S   K  + 
Sbjct: 365 QLALLDAATKVLKIKGKLVYSTCTVDKQENEGTVNAFLAAHP-EMEAIQLESLPTKLAEK 423

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                  G +++ P           G DGFF  A R+  +
Sbjct: 424 Q----ANGMLQVFPQDF--------GSDGFFVAAFRKKGE 451


>gi|156932266|ref|YP_001436182.1| 16S rRNA methyltransferase B [Cronobacter sakazakii ATCC BAA-894]
 gi|224493253|sp|A7MPE7|RSMB_ENTS8 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|156530520|gb|ABU75346.1| hypothetical protein ESA_00037 [Cronobacter sakazakii ATCC BAA-894]
          Length = 429

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 120/457 (26%), Positives = 210/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L           +S +D+ L++ +    LR L
Sbjct: 1   MKKSINLRSLAAQAIEQVVEKGQSLSTVLP-----PLQHKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  + F
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTIHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRMQ-F 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKER-VLAISDACISPL 176
             L+N +LR+  R++ E            + P W   R +  + +E   +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFSGQDARWLHPMWLLNRFQTAWPREWQAVVEANNERPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGF +G   VQDAS
Sbjct: 175 WLRVNRQHHSRDEWLKLLEENGMTGHIHPRYPDAVRLDAPAPVSALPGFEQGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V+L    N  ++LDLCAAPGGKT  ++     A V A+DV  +R+ ++  NL RL 
Sbjct: 235 AQGCVELLAPQNGETILDLCAAPGGKTTHILEAAPQASVMAVDVDAQRISRVYENLKRLK 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A D+   D      +C +  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKA-DVKVGDGRFPSTWCGETQFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG ++++ CS+  +++ E ++  L  +P                   
Sbjct: 354 SEILDAIWPHLKPGGTLLYATCSVLPEENSEQIRAFLSRTPDAQLD-------------G 400

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    I+  P   E         DGFF   L + 
Sbjct: 401 TGSTQTPGIQNLPGATEG--------DGFFYAKLIKK 429


>gi|317121758|ref|YP_004101761.1| sun protein [Thermaerobacter marianensis DSM 12885]
 gi|315591738|gb|ADU51034.1| sun protein [Thermaerobacter marianensis DSM 12885]
          Length = 511

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 103/443 (23%), Positives = 167/443 (37%), Gaps = 38/443 (8%)

Query: 24  SLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQ 83
            +   L      +A   L  R++ L   +     R    +D  L         R    ++
Sbjct: 81  YVDHALARILDRAA---LPARERALATELAYGVARRQGTLDWALSRFSRKPPARLDPPVR 137

Query: 84  QLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELLQ-- 140
             LR+   Q+ YLD +  +A VD +V   +R     + A  VN++LR  +R      +  
Sbjct: 138 AALRLGAYQLWYLDRIPAHAAVDESVNLVRRH-GPAYAAGFVNAVLRAAARHGFPQGEVP 196

Query: 141 --------RIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET---- 188
                    +A +   P W  ER     G E    + +A      +   V          
Sbjct: 197 PRERDLAGHLALVHAHPRWLVERWLGRLGPEEAERLLEANNRVPPLSARVNRLRADPRAL 256

Query: 189 -----WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
                                          L  F EG    QD S+ + V +       
Sbjct: 257 AAALAARGVAVEAGRFLPEALRLGHGVHPAELDAFQEGALTWQDESSMLAVHVLDPRPGD 316

Query: 244 SVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
            V+D+ AAPGGK+      +    +V A D    RLEK+     RL L   + + +D   
Sbjct: 317 LVVDVAAAPGGKSTHIAERMGDRGRVVACDADPGRLEKVGEAARRLGLGCIEPLALDGRK 376

Query: 301 YCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
              +     D VL D PCS  G + R PD+ W +  DD+   A  Q +LL    + +KPG
Sbjct: 377 LPERLAGQADRVLADVPCSGLGVLARRPDLRWRKTPDDLAALAELQGELLRAAAACLKPG 436

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G++V+S C+ + +++++VV+  L  +        L      ++      + +GWI++ P 
Sbjct: 437 GVLVYSTCTTEPEENQQVVEGFLAQAGGAFTADDLRPWLPAALRDEPG-TAQGWIQLWPH 495

Query: 419 MLEKIDGVSSGMDGFFAVALRRL 441
                     G+DGFF   LRR+
Sbjct: 496 --------RHGVDGFFIARLRRV 510


>gi|291526150|emb|CBK91737.1| ribosomal RNA small subunit methyltransferase RsmB [Eubacterium
           rectale DSM 17629]
          Length = 469

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 101/453 (22%), Positives = 196/453 (43%), Gaps = 40/453 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
            ++ R ++  +L  +  +      +L        ++ LS++D+  +  +V+ T+ ++ ++
Sbjct: 38  SVDTRELALEMLIEINERGAFSHIVLRSVL--DKYQYLSKQDRAFMTRLVDGTIEYMLQL 95

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D ++D    + + + K  ++ LLR+SV QI Y+D V D AV + AV+ AKR K  +  + 
Sbjct: 96  DYIIDSFSKTKVRKMKPFIRNLLRMSVYQIKYMDAVPDSAVCNEAVKLAKRHKFAQ-LSG 154

Query: 123 LVNSILRRVSREKIELLQRI-AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            VN +LR ++R    +     +    +P+W  +R    YG+++   I  A  +   I + 
Sbjct: 155 FVNGVLRNIARNIDSVQFDTLSIRYSMPQWIVDRFVAAYGEKKAEEIFKAFHNKSTISIR 214

Query: 182 VKFDI---ETWAHKLNAVMLPT------GGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                   +     L A  +            +    + +  L  F +G+++VQD S+ +
Sbjct: 215 TNLTRCTPDELRATLEAEGVTVTAVDELNYAFVISGFDYLNGLQSFRDGLFYVQDISSML 274

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
             Q         V+D+CAAPGGK+  +         V A D++  +++ +  N+DR  L 
Sbjct: 275 VAQTAAPKKGDYVIDVCAAPGGKSTHIAELLRGSGHVFARDLTDNKVDMIEENIDRHGLN 334

Query: 290 AEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
                  DA  +        D ++ D PCS  G + R  D+ +    + + +    QR++
Sbjct: 335 NMSAEVWDATVFDADSAGKADILICDLPCSGLGVLGRKKDIRYKMTPESVDELVVLQRQI 394

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L    ++VKP G++V+S C++D+ ++E+ V+  +   P                      
Sbjct: 395 LDTVHTYVKPNGVLVYSTCTIDEAENEDNVRWFIEKHPEFELDKSFAEGT---------- 444

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              G  +I P           G DGFF     +
Sbjct: 445 ---GMKQILPG--------EHGSDGFFIARFIK 466


>gi|166367976|ref|YP_001660249.1| rRNA SAM-dependent methyltransferase [Microcystis aeruginosa
           NIES-843]
 gi|166090349|dbj|BAG05057.1| rRNA SAM-dependent methyltransferase [Microcystis aeruginosa
           NIES-843]
          Length = 450

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 114/459 (24%), Positives = 197/459 (42%), Gaps = 41/459 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR ++  +L  + R        LD     S+   L   D  L   IV   +R    +DA
Sbjct: 3   NARQLALLILRDIDRSSAYPDRALDRHLSASSLNCL---DTALTTEIVYGIIRRQRTLDA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +LD +   +  ++   L+++L + + Q+ YL  +   A V+ AVE  K     +  A +V
Sbjct: 60  LLDRLGKKTAAQQPPDLRRILHIGLYQLRYLSQIPPSAAVNTAVELTKISHLGK-LAAVV 118

Query: 125 NSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           N +LR+  R                 R+  +   P+W  +   + +       +      
Sbjct: 119 NGMLRQYLRLTANGDDPLLLPENTASRLGILHSFPDWLVQLWLDRFSVTETEQLCQWFNR 178

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGG------IRLKELPESIVSLPGFAEGVWWV 225
              +D+ +       E   ++L +  +           RL     +I  L GF  G + +
Sbjct: 179 SPDLDIRINPLKTSREALENELESANITFHHLKLPLACRLTSGLGNIERLEGFRAGNYTL 238

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD SA +   L       +++D CAAPGGKT  +   +    ++ A D +  RL +L  N
Sbjct: 239 QDISAQLVTYLLDPQPGETIIDACAAPGGKTTHIAELMGDRGRILACDQTASRLRQLEAN 298

Query: 283 LDRLHLYAEDIIEMDAFDYCPKK-LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           + RL L A +I   D+ D      + D VL+DAPCS  GT+ + PD+ W +  +++   A
Sbjct: 299 IKRLDLKAIEIHLGDSRDRPQWHGIADRVLIDAPCSGLGTLHKRPDIRWRQTPENLPVLA 358

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q +LL    ++VKP GI+V++ C+LD  ++E V+++ L + P      P +++     
Sbjct: 359 KRQGELLASAATWVKPKGILVYATCTLDPLENERVIEQFLAAHPDWKMATPDSNSCV--- 415

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +   +  G I + P             DGFF   L +
Sbjct: 416 --SEYYTETGAIEVLPH--------RHNQDGFFMAKLVK 444


>gi|238924695|ref|YP_002938211.1| sun protein [Eubacterium rectale ATCC 33656]
 gi|238876370|gb|ACR76077.1| sun protein [Eubacterium rectale ATCC 33656]
          Length = 469

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 101/453 (22%), Positives = 195/453 (43%), Gaps = 40/453 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
            ++ R ++  +L  +  +      +L        ++ LS++D+  +  +V+ T+ ++ ++
Sbjct: 38  SVDTRELALEMLIEINERGAFSHIVLRSVL--DKYQYLSKQDRAFMTRLVDGTIEYMLQL 95

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D ++D    + + + K  ++ LLR+SV QI Y+D V D AV + AV+ AKR K  +  + 
Sbjct: 96  DYIIDSFSKTKVRKMKPFIRNLLRMSVYQIKYMDAVPDSAVCNEAVKLAKRHKFAQ-LSG 154

Query: 123 LVNSILRRVSREKIELLQRI-AGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            VN +LR ++R    +     +    +P+W  +R    YG+++   I  A  +   I + 
Sbjct: 155 FVNGVLRNIARNIDSVQFDTLSIRYSMPQWIVDRFVAAYGEKKAEEIFKAFHNKSTISIR 214

Query: 182 VKFDI---ETWAHKLNAVMLPT------GGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
                   +     L A  +            +    + +  L  F +G+++VQD S+ +
Sbjct: 215 TNLTRCTPDELRATLEAEGVTVTAVDELNYAFVISGFDYLNGLQSFRDGLFYVQDISSML 274

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
             Q         V+D+CAAPGGK+  +         V A D++  +++ +  N+DR  L 
Sbjct: 275 VAQTAAPKKGDYVIDVCAAPGGKSTHIAELLQGSGHVFARDLTDNKVDMIEENIDRHGLN 334

Query: 290 AEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
                  DA  +        D ++ D PCS  G + R  D+ +      + +    QR++
Sbjct: 335 NMSAEVWDATVFDADSAGKADILICDLPCSGLGVLGRKKDIRYKMTPGSVDELVVLQRQI 394

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L    ++VKP G++V+S C++D+ ++E+ V+  +   P                      
Sbjct: 395 LDTVHTYVKPNGVLVYSTCTIDEAENEDNVRWFIEKHPEFELDKSFAEGT---------- 444

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              G  +I P           G DGFF     +
Sbjct: 445 ---GMKQILPG--------EHGSDGFFIARFIK 466


>gi|331088259|ref|ZP_08337178.1| ribosomal RNA small subunit methyltransferase B [Lachnospiraceae
           bacterium 3_1_46FAA]
 gi|330408503|gb|EGG87969.1| ribosomal RNA small subunit methyltransferase B [Lachnospiraceae
           bacterium 3_1_46FAA]
          Length = 456

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 106/468 (22%), Positives = 193/468 (41%), Gaps = 41/468 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R + + +L  V         +L      + ++ L +R++  +  +   TL  +
Sbjct: 1   MAKAINEREIVAAILMEVTENGRYSHIVLREVL--TKYQYLEKRERAFITRVTEGTLEHM 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID +LD      + + K  ++ +LR +V QI Y+D + D+AV   +V+ A + K    
Sbjct: 59  TEIDYILDCFSKVKVKKMKPLIRAILRSAVYQIKYMDSIPDHAVCSESVKLAVK-KGFSG 117

Query: 120 FAKLVNSILR------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
               VN +LR             + ++R++     PEW     +  Y    +  +     
Sbjct: 118 LRGYVNGVLRSVVKGIDEVEYPSDPIKRLSVRYSCPEWIIRLWKETYDLSLIETMLKDFQ 177

Query: 174 SPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWW 224
           +     +         E    +L    +            L    + + SL  F EG++ 
Sbjct: 178 TEKPTTIRCCRSRITTEQLKKRLEEEHVLVENHPYLKDALLISKYDYLESLETFREGLFV 237

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGK---------TAQLIVSGAKVTALDVSKRR 275
           VQD S+ +  +L        V+DLCAAPGGK                   V A D+++ +
Sbjct: 238 VQDISSMLVGELAHVQAGAQVIDLCAAPGGKALDVAERILMEGQAGCSGHVEARDLTEYK 297

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
           +  +  N++R+ L     +  DA  Y  K     D V+ D PCS  G + +  D+ +   
Sbjct: 298 VSLIEENIERMGLCNVTAVCQDASVYDEKSAGKADIVIADLPCSGLGVLGKKTDLKYKAS 357

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
            + IV     QRK+L    S+VKPGG +++S C+++ +++ E V   L+  P   E    
Sbjct: 358 PEGIVSLVKLQRKILSCAASYVKPGGELLYSTCTVNPKENIENVHWFLKEFP---EFYAD 414

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +      +++  +++  G I++ P +           DGFF   LR+ 
Sbjct: 415 DIREDLCLELRESVTENGCIQLLPGV--------HKSDGFFIARLRKK 454


>gi|170769473|ref|ZP_02903926.1| ribosomal RNA small subunit methyltransferase B [Escherichia
           albertii TW07627]
 gi|170121530|gb|EDS90461.1| ribosomal RNA small subunit methyltransferase B [Escherichia
           albertii TW07627]
          Length = 429

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 113/457 (24%), Positives = 211/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMTRPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERV-LAISDACISPL 176
             L+N +LR+  R++ E            + P W  +RL+  Y ++   +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIVEANNQRPPM 174

Query: 177 YIDLTVKFD-IETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +    +  ++W   L    +               +P  + +LPGF EG   VQDAS
Sbjct: 175 WLRVNRTHNSRDSWLALLEKAGMKGFLHANYPDAVRLEIPAPVHALPGFDEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVMAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRSPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +K GG +V++ CS+  +++ + ++  L+ +   +                
Sbjct: 354 SEILDAIWPHLKSGGTLVYATCSILPEENSQQIKAFLQRTEDAMLCETGTPEQPG----- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                           ++    +   DGFF   L + 
Sbjct: 409 ----------------KQNLPDAEEGDGFFYAKLIKK 429


>gi|315178589|gb|ADT85503.1| cytosine-C5-methylase [Vibrio furnissii NCTC 11218]
          Length = 426

 Score =  270 bits (690), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 124/454 (27%), Positives = 206/454 (45%), Gaps = 44/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ +L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAAQVLFQVVDKGQSLSMALP-----AAQQNIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++ + ++ S L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIANALMDSPLKGKQRVFHHLILVGIYQLSFMRIPPHAAVGETVEGAQDLKGPR-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGK-ERVLAISDACISPLYID 179
           N++LR   R +     E +   AG    P W  + L+N Y +    +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQDALDAEAMSHNAGKYGHPSWLLKLLQNAYPQQWEAIVEANNSKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +     + + +   LN   + +              P  +  LPGFA+G   VQDA+A +
Sbjct: 175 VNHQHHERDAYQALLNHENIDSSVHSQARDALKLAAPCDVTQLPGFAQGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA       G  V A+D    RL+++  NL RL+L A
Sbjct: 235 ALHYLQPQDGELILDCCAAPGGKTAHILERTHGCDVVAIDCDDTRLKRVHDNLKRLNLSA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                       +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  QR++L
Sbjct: 295 KVVCGDARYPEQWWQGGQFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALAELQREIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q++   V+  L  +                  +  +  
Sbjct: 355 DAMWQQLKPGGTLVYATCSITPQENVLQVKDFLARTSNA--------------QLVGSEL 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                +I P            MDGF+   L +  
Sbjct: 401 DNPGRQILPG--------EEDMDGFYYAVLTKQA 426


>gi|317129258|ref|YP_004095540.1| sun protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474206|gb|ADU30809.1| sun protein [Bacillus cellulosilyticus DSM 2522]
          Length = 449

 Score =  270 bits (689), Expect = 3e-70,   Method: Composition-based stats.
 Identities = 114/458 (24%), Positives = 208/458 (45%), Gaps = 36/458 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK G N R  +  +L  + +++     LL+     S    L+Q+D  L+  +V  T+++ 
Sbjct: 1   MKQG-NVRDTAVEVLLKIEKQQAYSHLLLNETIKKS---NLNQKDVPLLTELVYGTIQYQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L       L + +  +  LLR+++ Q++YLD + D A V  AV+ AK+ + ++ 
Sbjct: 57  KLLDFYLKPFSKRPLEKLEPWVLVLLRLTLYQMVYLDRIPDRAAVHEAVQIAKK-RGHQG 115

Query: 120 FAKLVNSILRRVSREK-------IELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            + +VN ILR + R +        + ++R+A  +  PEW  +R  + YG ++   ++ A 
Sbjct: 116 ISGMVNGILRSIQRNELPQLDTVKDPVERLALKTSHPEWLIKRWIDQYGIDKTEEMALAN 175

Query: 173 ISPLYIDLTVK---FDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           ++     + V      +E     L      A         +     S+++   F +G   
Sbjct: 176 LTHPTHSVRVNELNASVEEVIAALKNEGIEAEQSKNIPESVLIYKGSVINTKPFVDGWIT 235

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           VQD  + +         N  VLD CAAPGGK+      + +  ++ +LD+ K ++  +  
Sbjct: 236 VQDEGSMLVAHALSPKENERVLDACAAPGGKSTHIAEKMKNSGQIVSLDIHKHKVGLIEK 295

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
           N  RL+L   +  ++DA        +  FD +LVDAPCS  G I+R PD+ W+++  DI 
Sbjct: 296 NAKRLNLSIINTEQLDARQVSGQFEEHSFDRILVDAPCSGLGVIQRKPDLKWSKNEGDIN 355

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q ++L      +K GG +V+S C++DK+++ EV+ + ++      +         
Sbjct: 356 RLAQIQTEILEAVWPLLKKGGTLVYSTCTVDKEENNEVITQFVQK-KENAQFDDQLMDRL 414

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
                       G I++ P             DGFF  
Sbjct: 415 PKAFHDCKGKGNGMIQLFPG--------EQSTDGFFIS 444


>gi|253991652|ref|YP_003043008.1| 16S rRNA methyltransferase B [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253783102|emb|CAQ86267.1| ribosomal RNA small subunit methyltransferase B [Photorhabdus
           asymbiotica]
          Length = 429

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 114/454 (25%), Positives = 209/454 (46%), Gaps = 40/454 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  ++ V+ +  SL+ +L         + ++ +D+ L++      LR L
Sbjct: 1   MKNTYNLRSIAAKAITQVLDQGQSLSTVLPKL-----QQNITDKDKSLLQEFSFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVE--QAKRDKENR 118
           P+++ ++  ++   L  K+ ++  LL V + Q+ Y  +  +A +   V      +  + +
Sbjct: 56  PQLEWIIIQLMAKPLKGKQRTIHYLLMVGIYQLAYTRIPAHAALAETVNGVVTLKYPQLK 115

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPLY 177
                V    +R   + IE  Q  +   + PEW   R++  Y +E    I+ +    P++
Sbjct: 116 GLINGVLRQFQRQQLQLIEHSQSHSSYHLHPEWLSTRIQKAYPQEWQQLINVNNQKPPMW 175

Query: 178 IDLT-VKFDIETWAHKLNAVMLPTG------GIRLKELPESIVSLPGFAEGVWWVQDASA 230
           + +  +    + +   L+   +                P  +  LPGF +G   VQD SA
Sbjct: 176 LRVNRIYHSRDEYLTLLHKAGIDAEPAIELPFAIRVISPCPVAILPGFDKGWVTVQDVSA 235

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHL 288
               +L   +N   +LDLCAAPGGKT     I   ++V A+D+  +RL+++  NL RL+ 
Sbjct: 236 QGCAELLQPINGEKILDLCAAPGGKTTHLLEIAPESQVLAVDIDGQRLKRVEENLRRLNC 295

Query: 289 YA-EDIIEMDAFDYC-PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
           +A   I +    +Y    + FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q +
Sbjct: 296 HATVKIGDGRYPEYWAENQQFDRILLDAPCSATGVIRRHPDIKWLRREEDIAQLVQLQSE 355

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA 406
           ++     ++K GG +V++ CS+   ++ + +   L+  P          A     D   A
Sbjct: 356 IIDAIWPYLKKGGTLVYATCSILPDENSQQINAFLKRHPD---------AELSGPDTREA 406

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  +I P++         G DGFF   L +
Sbjct: 407 PGK----QIIPELT--------GGDGFFYARLIK 428


>gi|16762874|ref|NP_458491.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|29144361|ref|NP_807703.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|213425783|ref|ZP_03358533.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
 gi|213859535|ref|ZP_03385239.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|289806045|ref|ZP_06536674.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Typhi str. AG3]
 gi|46396982|sp|Q8Z1X1|RSMB_SALTI RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|25303750|pir||AH1009 sun protein [imported] - Salmonella enterica subsp. enterica
           serovar Typhi (strain CT18)
 gi|16505181|emb|CAD09177.1| sun protein [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29139999|gb|AAO71563.1| sun protein [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
          Length = 429

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVSIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQRIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKAFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|304320686|ref|YP_003854329.1| tRNA and rRNA cytosine-C5-methylase-like protein [Parvularcula
           bermudensis HTCC2503]
 gi|303299588|gb|ADM09187.1| tRNA and rRNA cytosine-C5-methylase-like protein [Parvularcula
           bermudensis HTCC2503]
          Length = 455

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 143/439 (32%), Positives = 224/439 (51%), Gaps = 12/439 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+ AR  +  +L  + R+  +L   +       AF  L   D+   R ++   LR    
Sbjct: 26  PGLPARRAALDILLAI-RRGQALDMAMAE---SEAFEDLEGADRGFARTLIMAVLRRQNT 81

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +D      L   L   + ++  LLR++ AQIL L V  +A     V+ AK  +++  FAK
Sbjct: 82  LDEAYGTFLDRPLKSTQGTVITLLRLAAAQILLLGVPPHAATATTVDLAKERRDSAGFAK 141

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           L+N++ RR+  +   L++     + +P W   RLE  YG +    ++ A +    +DLT 
Sbjct: 142 LLNALCRRMVEKGPSLIEDYPPRTDVPGWLWRRLERHYGAKTARRLAAAFVQEPALDLTP 201

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKE-LPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           K   E           P G + L+      I  LPG+ EG WW+QD +A++P+ L G L 
Sbjct: 202 KDPKERERLATALEAHPLGPVSLRRTAGGRIEDLPGYTEGDWWIQDLAAALPISLLGDLT 261

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
              V DLCAAPGGKTAQL  +GA VTA+D+S +RL +L  NL RL L A D    D   +
Sbjct: 262 GQRVYDLCAAPGGKTAQLAAAGAHVTAVDISAKRLRRLEDNLARLGLRA-DTFVGDVLGF 320

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
            P +  D V++DAPC++TGT+RRHPD+LW++  +D+ + +  Q ++L      V+PGG +
Sbjct: 321 SPDEPADLVVLDAPCTATGTVRRHPDLLWSKKEEDVAELSALQDQMLHHAARLVRPGGRL 380

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           +F  CSL  ++ E+  +  L          PL+    + +   +  + +G +R  PD++ 
Sbjct: 381 MFITCSLLAEEGEDRSRAFLSRH-SQFTAEPLSDDEKERLG-PLNAAKDGHLRTRPDLIA 438

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  GMDGF+A    R
Sbjct: 439 DA----GGMDGFYAARFTR 453


>gi|317501927|ref|ZP_07960111.1| sun protein [Lachnospiraceae bacterium 8_1_57FAA]
 gi|316896607|gb|EFV18694.1| sun protein [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 456

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 108/468 (23%), Positives = 192/468 (41%), Gaps = 41/468 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R + + +L  V         +L      + ++ L +R++  +  +   TL  +
Sbjct: 1   MAKAINEREIVAAILMEVTENGRYSHIVLREVL--TKYQYLEKRERAFITRVTEGTLEHM 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID +LD      + + K  ++ +LR +V QI Y+D + D+AV   +V+ A + K    
Sbjct: 59  TEIDYILDCFSKVKVKKMKPLIRAILRSAVYQIKYMDSIPDHAVCSESVKLAVK-KGFSG 117

Query: 120 FAKLVNSILRRVSREKIELLQRIAG------ISIIPEWFKERLENFYGKERVLAISDACI 173
               VN +LR V +E  E+                PEW     +  Y    +  +     
Sbjct: 118 LRGYVNGVLRSVVKEIDEVEYPSDPIKRLSVRYSCPEWIIRLWKETYDLSLIETMLKDFQ 177

Query: 174 SPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWW 224
           +     +         E    +L    +            L    + + SL  F EG++ 
Sbjct: 178 TEKPTTIRRCRSRITMEQLKKRLEEEHVLVENHPYLKDALLISKYDYLESLETFREGLFV 237

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGK---------TAQLIVSGAKVTALDVSKRR 275
           VQD S+ +  +L        V+DLCAAPGGK                   V A D+++ +
Sbjct: 238 VQDISSMLVGELAHVQAGAQVIDLCAAPGGKALDVAERILMEGQAGCSGHVEARDLTEYK 297

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
           +  +  N++R+ L     +  DA  Y  K     D V+ D PCS  G + +  D+ +   
Sbjct: 298 VSLIEENIERMGLCNVTAVCQDASVYDEKSAGKADIVIADLPCSGLGVLGKKTDLKYKAS 357

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
            + IV     QRK+L    S+VKPGG +++S C+++ +++ E V   L+  P   E    
Sbjct: 358 PEGIVSLVKLQRKILSCAASYVKPGGELLYSTCTVNPKENIENVHWFLKEFP---EFYAD 414

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +      +++  +++  G I++ P +           DGFF   LR+ 
Sbjct: 415 DIREDLCLELRESVTENGCIQLLPGV--------HKSDGFFIARLRKK 454


>gi|153815686|ref|ZP_01968354.1| hypothetical protein RUMTOR_01922 [Ruminococcus torques ATCC 27756]
 gi|145846927|gb|EDK23845.1| hypothetical protein RUMTOR_01922 [Ruminococcus torques ATCC 27756]
          Length = 456

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 106/468 (22%), Positives = 193/468 (41%), Gaps = 41/468 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R + + +L  V         +L      + ++ L +R++  +  +   TL  +
Sbjct: 1   MAKAINEREIVAAILMEVTENGRYSHIVLREVL--TKYQYLEKRERAFITRVTEGTLEHM 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID +LD      + + K  ++ +LR +V QI Y+D + D+AV   +V+ A + K    
Sbjct: 59  TEIDYILDCFSKVKVKKMKPLIRAILRSAVYQIKYMDSIPDHAVCSESVKLAVK-KGFSG 117

Query: 120 FAKLVNSILR------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
               VN +LR             + ++R++     PEW     +  Y    +  +     
Sbjct: 118 LRGYVNGVLRSVVKGIDEVEYPSDPIKRLSVRYSCPEWIIRLWKETYDLSLIETMLKDFQ 177

Query: 174 SPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWW 224
           +     +         E    +L    +            L    + + SL  F EG++ 
Sbjct: 178 TEKPTTIRRCRSRITMEQLKKRLEEEHVLVENHPYLKDALLISKYDYLESLETFREGLFV 237

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGK---------TAQLIVSGAKVTALDVSKRR 275
           VQD S+ +  +L        V+DLCAAPGGK                   V A D+++ +
Sbjct: 238 VQDISSMLVGELAHVQAGAQVIDLCAAPGGKALDVAERILMEGQAGCSGHVEARDLTEYK 297

Query: 276 LEKLRCNLDRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRD 333
           +  +  N++R+ L     +  DA  Y  K     D V+ D PCS  G + +  D+ +   
Sbjct: 298 VSLIEENIERMGLCNVTAVCQDASVYDEKSAGKADIVIADLPCSGLGVLGKKTDLKYKAS 357

Query: 334 TDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPL 393
            + IV     QRK+L    S+VKPGG +++S C+++ +++ E V   L+  P   E    
Sbjct: 358 PEGIVSLVKLQRKILSCAASYVKPGGELLYSTCTVNPKENIENVHWFLKEFP---EFYAD 414

Query: 394 NSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +      +++  +++  G I++ P +           DGFF   LR+ 
Sbjct: 415 DIREDLCLELRESVTENGCIQLLPGV--------HKSDGFFIARLRKK 454


>gi|326790876|ref|YP_004308697.1| sun protein [Clostridium lentocellum DSM 5427]
 gi|326541640|gb|ADZ83499.1| sun protein [Clostridium lentocellum DSM 5427]
          Length = 445

 Score =  270 bits (689), Expect = 4e-70,   Method: Composition-based stats.
 Identities = 106/464 (22%), Positives = 208/464 (44%), Gaps = 45/464 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M      R     LL  + ++      +L     D     +  +D+  V  +V  TL++ 
Sbjct: 1   MNKT--VREQIVDLLIEIEKEASYAQLVLKRALQD-----IDAKDKGFVTEVVYGTLKYQ 53

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
            ++D +L+    + + R K  ++ ++R+S+ Q+LYLD V   A+++ AV+  K+ ++ ++
Sbjct: 54  IKLDYILNQFSKTPVHRMKPLIRNVMRMSLYQMLYLDKVPTSAIINEAVKIVKK-RKFQN 112

Query: 120 FAKLVNSILRRVSREKIELLQR---------IAGISIIPEWFKERLENFYGKERVLAISD 170
            +  VN +LR + R++ +++           ++    IPEW  E     Y +E V +I +
Sbjct: 113 LSGFVNGLLRNIDRQREQIIYPDETKNLVLAMSIHYAIPEWMIEEWLKVYKEEEVKSICE 172

Query: 171 ACISPLYIDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEG 221
           A      +                                     +  +++ + P F +G
Sbjct: 173 ALNERAEVCARYNTLKTNKLEFEETLKVEGIQLKEGAFLEEAFYLKGVDNLQNSPSFKKG 232

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEK 278
            W VQD SA +   +        +LD+C+APGGK+  +   + +  ++ + D+   +LE 
Sbjct: 233 EWTVQDESAMLVAHVMAPQKGDCILDMCSAPGGKSIHMAELMENAGRIVSCDIHPHKLEL 292

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYCPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           ++ N +R+ +   +    D        +  FD VL+DAPCS  G ++R PD+   +  + 
Sbjct: 293 IKKNAERMGITIIEPTLQDGTLKNECYVEAFDKVLLDAPCSGLGIMKRKPDIRTHKSKEG 352

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +++    Q+KL L  IS++KPGG +V+S C++  +++E +V  +       + L   N  
Sbjct: 353 LLEIVALQKKLALAAISYLKPGGRLVYSTCTISHEENEGMVSYI-----KALGLELENIV 407

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                 +  A+  +G I+I P M         G DGFF  + ++
Sbjct: 408 DTIPSPLKRAIKEKGMIQILPHMA--------GTDGFFIASFKK 443


>gi|110643527|ref|YP_671257.1| 16S rRNA methyltransferase B [Escherichia coli 536]
 gi|123343554|sp|Q0TCH3|RSMB_ECOL5 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|110345119|gb|ABG71356.1| SUN protein [Escherichia coli 536]
          Length = 429

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCA PGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAGPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|127514666|ref|YP_001095863.1| sun protein [Shewanella loihica PV-4]
 gi|126639961|gb|ABO25604.1| sun protein [Shewanella loihica PV-4]
          Length = 427

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 125/452 (27%), Positives = 206/452 (45%), Gaps = 38/452 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++ ++  V+ K +SL+  L  +      RL S +D+ L+  +    +R L
Sbjct: 1   MK---NLRALAARVVFQVLEKGVSLSVALPEQ----QQRLTSGKDKALLAELCYGVMRHL 53

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D ++   +   L  K+  + QLL V   Q+ +  +  +A +    E A R  +    
Sbjct: 54  PQLDKLVSDCMSKPLKGKQRIVHQLLLVGCYQLYFTRIPGHAAISETAE-ACRQLKFEGL 112

Query: 121 AKLVNSILRRVSREKIELLQRIAGISI-IPEWFKERLENFYGKERVLAISDACISPLYI- 178
            K+VN +LR + R +  L +    ++   P W  +RL+  Y       I+ +   P    
Sbjct: 113 VKVVNGVLRNLQRNQKPLPEDNETLAFNTPAWLIKRLKAAYPDSWQEMIAQSHQRPPMWL 172

Query: 179 -DLTVKFDIETWA-----HKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASI 232
            +  +    E +       ++ A    +    L E P+ +  LPGFA+GV  VQD +A  
Sbjct: 173 RNNQLSQTREQYLTLLDEQEIAATPGASNDAILLESPKDVGMLPGFADGVASVQDGAAQW 232

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
              L     N  +LD CAAPGGK+           + A+D   +RLE+++ NLDRL L A
Sbjct: 233 AASLLAPEANELILDACAAPGGKSCHLLESQPSIDLVAVDFDAKRLERVQQNLDRLSLKA 292

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                       +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q ++L
Sbjct: 293 KLVHGDAAKIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKQADIEELATLQSQIL 352

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                ++KPGG ++++ CS+  Q++ E +   L  +     L+P+              S
Sbjct: 353 DHCWQWLKPGGTLLYATCSILPQENAEQIAAFLART-QDATLIPI---------AQQQNS 402

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +   +ITP            MDGF+   L +
Sbjct: 403 DDIGWQITPG--------QDNMDGFYYARLVK 426


>gi|322418095|ref|YP_004197318.1| sun protein [Geobacter sp. M18]
 gi|320124482|gb|ADW12042.1| sun protein [Geobacter sp. M18]
          Length = 479

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 114/464 (24%), Positives = 189/464 (40%), Gaps = 42/464 (9%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           S  N R  +  +L  + +++     L+D E        +   D+ L+  +V   LR    
Sbjct: 32  SSKNPRRAAFDILLRIEKEKSFADILIDHELSKDM---IKGADRGLLTELVYGVLRRQGT 88

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +D ++         + +  +  LLR+ + Q  +LD V   A V+  V+ AK        +
Sbjct: 89  LDHIIGQFSKQRTDKLELYVLLLLRLGLYQCFFLDRVPVSAAVNETVKLAKE--LAPRAS 146

Query: 122 KLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDAC 172
             +N+ILR   R +  +             A     P W   +     G E   A++ A 
Sbjct: 147 GFINAILRNADRNRDNISYPDRAENPVGYLAVRYSHPAWLTSQWCEQLGVEGAEALAAAM 206

Query: 173 ISPLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVW 223
             P    + V       E    +L    +     R             I  LP F +G++
Sbjct: 207 SEPPPFTIRVNTLRISREALMARLAEEGISCSETRWSPDGIRLNQSGQITRLPSFRDGLF 266

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            VQD S+ +            VLD C+APGGKT Q+   + +  ++ A DV+ ++L  ++
Sbjct: 267 TVQDESSQLAPLFLSPEKGDRVLDACSAPGGKTTQIAQLMGNSGEIYACDVNHKKLRLIK 326

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPKKL---FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
              DRL + +     MDA    P      F  +LVDAPCS  G IRR+P+  W++  DD+
Sbjct: 327 ETCDRLGITSVRTFTMDATSPSPAIKEVTFQRILVDAPCSGLGVIRRNPEGKWSKSPDDL 386

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
           ++ A  Q  +L     ++   G ++++ CS   Q++E V+   LR  P  V         
Sbjct: 387 LQQARTQVTILENLCKYLDKSGTLLYATCSTSVQENEYVIDTFLREHPEFV----AEDLR 442

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               + A   +  G+ R  P           GMDGFFA  L+++
Sbjct: 443 TLFPEFAPLFTERGFFRSWPH--------RDGMDGFFAARLKKI 478


>gi|167621966|ref|YP_001672260.1| sun protein [Shewanella halifaxensis HAW-EB4]
 gi|167351988|gb|ABZ74601.1| sun protein [Shewanella halifaxensis HAW-EB4]
          Length = 426

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 122/448 (27%), Positives = 201/448 (44%), Gaps = 35/448 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L ++         S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALPVQQKHLD----SGKDKALLAELCYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   +   +  K+  + QLL V   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KQVSDCMSKQMKGKQRIVHQLLLVGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGI-SIIPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++  L      +    P W  +RL+  Y       I  +   P     +  
Sbjct: 116 NGVLRNIQRQEKPLSTDNDTLAYNTPAWIIKRLQAAYPDNWQTVIEQSHERPPMWLRNNQ 175

Query: 182 VKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                ET+   L      A    +    L   P  ++ LPGF  G   VQD +A     L
Sbjct: 176 QSQTRETYLQALAGLDIEAQAGNSPDSILLSSPRDVMQLPGFESGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
                +  VLD CAAPGGK+     +    K+ A+D   +RLE+++ NLDRL L AE + 
Sbjct: 236 LAPQGDELVLDACAAPGGKSCHLLELAPDIKLVAVDFDAKRLERVQQNLDRLSLKAELVH 295

Query: 295 --EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
               +   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q ++     
Sbjct: 296 GDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDIEELAQLQSQIFDHCW 355

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++++ CS+  Q++++ V   L  +P    LVP+                   
Sbjct: 356 KWLKPGGTLLYATCSILPQENKDQVSAFLARTPDAT-LVPIEQQANPD------------ 402

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRR 440
                D+  +I      MDGF+   L +
Sbjct: 403 -----DIGWQIVPGQDNMDGFYYARLVK 425


>gi|323692061|ref|ZP_08106308.1| sun protein [Clostridium symbiosum WAL-14673]
 gi|323503861|gb|EGB19676.1| sun protein [Clostridium symbiosum WAL-14673]
          Length = 449

 Score =  269 bits (688), Expect = 5e-70,   Method: Composition-based stats.
 Identities = 102/457 (22%), Positives = 201/457 (43%), Gaps = 32/457 (7%)

Query: 1   MKSGMNA-RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M     A R +   +L  V+ K      +L      + ++ L ++D+  ++ +V+ T+ +
Sbjct: 6   MTVKEPALREIILDILLEVLEKGKYSHVILSQAL--TKYQYLEKQDRSFIKRVVDGTVEY 63

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENR 118
             ++D +L+      + + K  ++ +LR+S  QI ++D V D A  + AV+ A++ +   
Sbjct: 64  RIQLDYILNSYSKVKVNKMKPVIRTILRMSAYQICHMDRVPDSAACNEAVKLAEK-RGFS 122

Query: 119 HFAKLVNSILRRVSR-EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
                VN +LR +SR +   +    +    +PEW     ++ YG+E    + ++ +    
Sbjct: 123 GLKGFVNGVLRSISRGKDNLVFPDDSIRYSMPEWLASMWKSAYGEETFRRMMESFLKDRP 182

Query: 178 IDLTVKFDIETWAHKLNAVM---------LPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           +   +  +       L+++               +   E  + +  L  F EG   +QD 
Sbjct: 183 LMARLCLNRAEKQQILDSLGAQGVTAKDSRYADDVICLEGVDYLEGLEAFREGWLQIQDL 242

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDR 285
           S+S+     G  +   V+D+C APGGK             V   D+S+ ++  +  N+ R
Sbjct: 243 SSSLAGDAAGIKDGDYVIDVCGAPGGKGLHAADILGGTGMVEIRDISEAKVSLIEENIGR 302

Query: 286 LHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
             L        DA  + P  ++  D V+ D PCS  G I R PD+ +    + +   AC 
Sbjct: 303 SGLTNLRAAVCDALSFDPDSEEAADVVIADLPCSGLGIIGRKPDIKYNMTPEKLHDLACL 362

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR++L     +VKPGG +V+S C+++++++E+ ++  L   P      P+N        +
Sbjct: 363 QREILSVVQRYVKPGGTLVYSTCTVNREENEDNMRWFLEHFP----FEPVNLKGRLGEKL 418

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +      G+I+  P +           DGFF   +++
Sbjct: 419 SELSMESGYIQFLPGI--------HPCDGFFIAVMKK 447


>gi|183600721|ref|ZP_02962214.1| hypothetical protein PROSTU_04317 [Providencia stuartii ATCC 25827]
 gi|188019701|gb|EDU57741.1| hypothetical protein PROSTU_04317 [Providencia stuartii ATCC 25827]
          Length = 428

 Score =  269 bits (688), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 115/454 (25%), Positives = 203/454 (44%), Gaps = 43/454 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+    SL+ +L         + ++++D+ L++ I    LR+L
Sbjct: 1   MKNTYNLRSIAAVAIGQVIDGGQSLSTVLPEL-----QKNINEKDKSLLQEICFGVLRYL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKEN--R 118
           P+++  +  ++   L  K+ +L  L+ V + Q+LY  +  +A +   V  A   K    +
Sbjct: 56  PKLEWFVAQLMEKPLTGKQRTLHYLIMVGIYQLLYTRIPPHAALAETVNGAVALKRPQLK 115

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPLY 177
                V    +R   +  E     +   + P W  +RL+N Y  +    I  +    P++
Sbjct: 116 GLINGVLRSFQRQQTQLEERNTNNSSQYLHPSWLLKRLQNAYPDKWQTIIDANNQRPPMW 175

Query: 178 IDLTVKFDIETWAHKLNAVMLPTGGIRLKELP-------ESIVSLPGFAEGVWWVQDASA 230
           + +  +        K          +              S+  LPGF +G   VQD SA
Sbjct: 176 LRVNSQHHTAEQYQKYLEENEIASELHPHHPCAIKLSEPTSVTRLPGFEKGWATVQDVSA 235

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLHL 288
               +L    N+ ++LDLCAAPGGKT  ++     A V A+D+ + RL++++ NL RL  
Sbjct: 236 QGCAELLEPQNHETILDLCAAPGGKTTHILELAPKAHVVAVDIDEHRLKRVKENLQRLQQ 295

Query: 289 YAEDIIE--MDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
            A  I        ++   +LFD +L+DAPCS+TG IRRHPD+ W R   DI +    Q K
Sbjct: 296 QAAVIQGDGTKPEEWANGQLFDRILLDAPCSATGVIRRHPDIKWLRRDSDINELTELQAK 355

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA 406
           +L     ++K GG +V++ CS+  +++   ++  L   P                + ++ 
Sbjct: 356 ILESIWPYLKVGGTLVYATCSIMPEENSLQIKNFLAKHP----------------EASLN 399

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                 ++I P +         G DGFF   L +
Sbjct: 400 DGTTAGLQILPSIT--------GGDGFFYARLVK 425


>gi|283788076|ref|YP_003367941.1| ribosomal RNA small subunit methyltransferase B [Citrobacter
           rodentium ICC168]
 gi|282951530|emb|CBG91229.1| ribosomal RNA small subunit methyltransferase B [Citrobacter
           rodentium ICC168]
          Length = 429

 Score =  269 bits (688), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 121/458 (26%), Positives = 210/458 (45%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MNKKLNLRSIAAQAVEQVVEQGHSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ +L  L+ V   Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLIGKLMSRPMTGKQRTLHYLIMVGFYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R +  LL   A      + P W  +RL+  +  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRNQDALLAEFAHSEARFLHPSWLLKRLQKAWP-EQWESIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V         W   L    +                P  + +LPGF +G    QDA
Sbjct: 174 MWLRVNRTHHTRNAWLALLEEAGMKGFTHPDYPDAVRLDTPVPVHALPGFDKGWVTAQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   V      N   +LDLCAAPGGKT  ++     AKV A+DV ++RL ++  NL RL
Sbjct: 234 SAQGCVAFLAPQNGEQILDLCAAPGGKTTHILEAAPDAKVLAVDVDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            +    + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GM-NATVKQGDGRYPLQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAAL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG +V++ CS+  +++ + ++  L+ +                  +
Sbjct: 353 QAEILDAVWPHLKPGGTLVYATCSVLPEENSQQIKAFLQRTADA--------------TL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +   +PE      P +  +    +   DGFF   L + 
Sbjct: 399 SETGTPE-----LPGL--QNLPGAEEGDGFFYAKLIKK 429


>gi|37681411|ref|NP_936020.1| sun protein [Vibrio vulnificus YJ016]
 gi|320154882|ref|YP_004187261.1| ribosomal RNA small subunit methyltransferase B [Vibrio vulnificus
           MO6-24/O]
 gi|46396771|sp|Q7MGK4|RSMB_VIBVY RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|37200163|dbj|BAC95991.1| sun protein [Vibrio vulnificus YJ016]
 gi|319930194|gb|ADV85058.1| ribosomal RNA small subunit methyltransferase B [Vibrio vulnificus
           MO6-24/O]
          Length = 426

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 122/454 (26%), Positives = 210/454 (46%), Gaps = 44/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ +  SL+  L       A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYQVVDRGNSLSTALPE-----AQQSIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIAGKLMDKPLKGKQRVFHHLILVGLYQLGHMRIPAHAAVGETVEGAQALKGPR-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N++LR   RE+       +   AG  + P W  + L++ Y  + + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQREQQALDEFSVSHNAGKYVHPSWLLKILQDAYPEQWQTIVEANNNKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +     D + +   L    + +              P  + SLPGF +G   VQDA+A +
Sbjct: 175 VNHAHHDRDEYLQLLKNANIDSTLHSEAMDAIKLAAPCDVHSLPGFEQGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
                   +   +LD CAAPGGKTA     VS  +V ALD  ++RL+++  NL RL+L A
Sbjct: 235 SFNYLQPKDGELILDCCAAPGGKTAHILERVSAREVVALDCDEQRLKRVTENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +   +   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q ++ 
Sbjct: 295 KVICGDARNPEQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDITALAQLQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+   ++ E V+  L  +P                 +  +  
Sbjct: 355 DAMWAQLKPGGTLVYATCSITPMENVEQVKAFLARTPAA--------------QLVGSER 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                +I P            MDGF+   L +  
Sbjct: 401 ENPGRQILPG--------EEDMDGFYYAVLVKQA 426


>gi|194014930|ref|ZP_03053547.1| ribosomal RNA small subunit methyltransferase B [Bacillus pumilus
           ATCC 7061]
 gi|194013956|gb|EDW23521.1| ribosomal RNA small subunit methyltransferase B [Bacillus pumilus
           ATCC 7061]
          Length = 442

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 115/456 (25%), Positives = 204/456 (44%), Gaps = 38/456 (8%)

Query: 8   RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVL 67
           R ++   L  + + +     LL     D   + L+ +D+ L+  +V  TL+    +D +L
Sbjct: 2   RELALDALIKLEQNQAYSNLLLQSVMKD---KDLADQDKPLLTELVYGTLQNKLALDYML 58

Query: 68  DFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNS 126
              +     +    + QLLR+S+ Q++YL+ +   A +  AVE  K+ + ++  + LVN 
Sbjct: 59  APFVKKP-QKVAPWVMQLLRMSLYQMVYLEKIPHRAAIHEAVELTKK-RGHKGISSLVNG 116

Query: 127 ILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           +LR V RE +     I       +  +  P W  +     YG E   ++    + P    
Sbjct: 117 VLRSVQREGVPAFDDIKDPVKRLSIETSHPLWLVQEWVQSYGFEAAESMCRIHLVPPKQT 176

Query: 180 LTVKFD---IETWAHKLNAVMLPTG-----GIRLKELPESIVSLPGFAEGVWWVQDASAS 231
           L V            +L    + T         LK +  SIVS P F EG   +QD S+ 
Sbjct: 177 LRVNRMKIGRAALQQELLDAGIETELGDLSEDALKLMKGSIVSTPSFQEGYVTIQDESSM 236

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRLHL 288
           +  +        +VLD CAAPGGK+      +    ++ +LD+ + +++ ++    RL+L
Sbjct: 237 LVARALDPQPGEAVLDACAAPGGKSTHIAERMNDKGQIVSLDLHEHKVKLIKQAAKRLNL 296

Query: 289 YAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
              +   +DA        +  FD +L+DAPCS  G IRR PD+ +T+  +D  + A  Q+
Sbjct: 297 TQIEAKALDARKAKGDYSEASFDRILIDAPCSGFGVIRRKPDMKYTKSKEDSARLAAIQQ 356

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
            +L +    +KPGG +V+S C++D  ++++V+   L+         P  S   +  +   
Sbjct: 357 AILKETAPLLKPGGTLVYSTCTMDPTENQQVIHAFLQEHQDF---EPDLSLNERLPEQVA 413

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                G ++I P           G DGFF  ++R+ 
Sbjct: 414 PFVQNGSVQILPHYF--------GTDGFFICSMRKK 441


>gi|331659579|ref|ZP_08360517.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA206]
 gi|331052794|gb|EGI24827.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA206]
          Length = 429

 Score =  269 bits (687), Expect = 6e-70,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKISDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N ILR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGILRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|304392692|ref|ZP_07374632.1| ribosomal RNA small subunit methyltransferase B [Ahrensia sp.
           R2A130]
 gi|303295322|gb|EFL89682.1| ribosomal RNA small subunit methyltransferase B [Ahrensia sp.
           R2A130]
          Length = 471

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 176/454 (38%), Positives = 259/454 (57%), Gaps = 18/454 (3%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
           K G+ AR V++ LL+ ++     L  LLD  +G +A R + + D++LVRAIV   LR   
Sbjct: 23  KPGLAARQVATTLLTRIVDDGRGLDGLLDTRHGPAALRDMPEADRLLVRAIVTTALRHRG 82

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            I+  LD  +    P+    L   L V+ AQIL+++V D A VDLAV     D+ +  F+
Sbjct: 83  EIEHALDRCMDRKPPKNARQLIHALHVAAAQILFMEVPDSAAVDLAVTALSSDQRSTRFS 142

Query: 122 KLVNSILRRVSREKIELLQRIAGIS----IIPEWFKERLENFYGKERVLAISDACISPLY 177
            L N++LRR+ REK  L + ++  +     +P W ++R    YGKER+ +I+   +    
Sbjct: 143 GLANAVLRRMGREKDTLFEAMSDEARAVINMPPWLRKRTRKSYGKERLASIAMRHMQEPV 202

Query: 178 IDLTVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLF 237
           ID+ V+ + E WA KL  V    G         +I + PG+ +G WWVQDA+A +P QL 
Sbjct: 203 IDICVRENPEEWAEKLGGV-HLFGNAVRVMREGAIHTWPGYDDGGWWVQDAAAQLPAQLM 261

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G ++   VLDLCAAPGGKTAQL  +GA VTAL+++  RL +L+ N++RL L   + IE D
Sbjct: 262 GDIDGKRVLDLCAAPGGKTAQLAAAGASVTALELNASRLHRLKGNMERLKLD-VETIEGD 320

Query: 298 AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKP 357
            F+Y P +LFDAVL+DAPCSS GTIRRHPDV W +    + + A  Q+++     +F+KP
Sbjct: 321 LFEYEPAELFDAVLLDAPCSSLGTIRRHPDVQWAKSQAIVEELADLQKRMCEHAATFIKP 380

Query: 358 GGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITP 417
           GG ++F+NCSLD+ + E+VV  +      P+EL PL       +D    ++ +G +R  P
Sbjct: 381 GGTLIFANCSLDRAEGEDVVAAI-TKGAAPLELSPLTPDDLFGLD--DFITGQGTVRTHP 437

Query: 418 DMLEKIDGVS---------SGMDGFFAVALRRLI 442
             L  +   +          G+DGFFA    R  
Sbjct: 438 GQLNDVPPPTSADVDPARYGGLDGFFAARFIRTA 471


>gi|281180323|dbj|BAI56653.1| putative rRNA methylase [Escherichia coli SE15]
          Length = 429

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRNPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|319780892|ref|YP_004140368.1| Fmu (Sun) domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317166780|gb|ADV10318.1| Fmu (Sun) domain protein [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 475

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 196/424 (46%), Positives = 261/424 (61%), Gaps = 5/424 (1%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           V+  R  L  L D E G   ++ L  RD+ LVRAI+   LR+   I  +L   L   LP 
Sbjct: 54  VIDARTPLDGLTDHENGHPQYKALDLRDRGLVRAILVTALRYRMTISGLLARRLEKPLPP 113

Query: 78  KKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIE 137
              +L  +L V+ AQIL+LD+ D A VD+AV  AK D     F+ LVN +LR ++R K  
Sbjct: 114 NATALSHILHVAAAQILFLDIPDSAAVDIAVTHAKSDPRTVRFSGLVNGVLRTLARAKET 173

Query: 138 L-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETWAHKLNAV 196
                +A     P+WF ERL+  YG E+   I +A      +D +VK D   WA KL  +
Sbjct: 174 ELPAALAATDEAPKWFSERLKTTYGNEKARQILEAHRVEAPVDFSVKADPGLWAEKLGGI 233

Query: 197 MLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT 256
           +LPTG +R++ L   +  LPGFAEG WWVQDA+AS+P +LFG +  L V DLCAAPGGKT
Sbjct: 234 VLPTGTVRVENLVGPVTELPGFAEGAWWVQDAAASLPARLFGDVTGLRVADLCAAPGGKT 293

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPC 316
           AQLIV+GAKVTA+D SK RL +L  NL+RL L AE + + D   Y PK+LFDAVL+DAPC
Sbjct: 294 AQLIVAGAKVTAVDTSKNRLVRLTQNLERLGLSAEIV-QADLLKYEPKELFDAVLLDAPC 352

Query: 317 SSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEV 376
           SSTGT+RRHPDV WT+ + D+ K A  QR+LL + ++ VKPGG +VFSNCSLD  + E++
Sbjct: 353 SSTGTVRRHPDVPWTKTSADVEKLADLQRRLLARTVTLVKPGGRIVFSNCSLDPLEGEDL 412

Query: 377 VQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAV 436
            +  L  +P   E+        +   +   L+P+G +R TP  L+      SG+DGFFA 
Sbjct: 413 CRAFLAGTP---EITNDPLLQGEIAGIDPFLTPQGTLRTTPADLDLGAPERSGLDGFFAA 469

Query: 437 ALRR 440
            +RR
Sbjct: 470 RMRR 473


>gi|116747600|ref|YP_844287.1| sun protein [Syntrophobacter fumaroxidans MPOB]
 gi|116696664|gb|ABK15852.1| sun protein [Syntrophobacter fumaroxidans MPOB]
          Length = 449

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 130/461 (28%), Positives = 207/461 (44%), Gaps = 40/461 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           +NAR+++  +L  + R       L+    G      L +RD+ L+  +V   LR+  R+D
Sbjct: 2   INARVLAFQILLHMDRDASHPDRLIRGMLGRHE--RLEERDRALLTELVYGVLRWQGRLD 59

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
             +D +  +   +   +++ LLR+++ QIL LD + D+A V+ AV  AK  +   +  K 
Sbjct: 60  WHIDQLSRTRPEKIDPAVRILLRLALYQILMLDRIPDHAAVNEAVNMAKTTQ-PAYLVKF 118

Query: 124 VNSILRRVSREKIELLQRIAGISI---------IPEWFKERLENFYGKERVLAISDACIS 174
           VN +LR   R +   +   AG             P W+ ERL + +G E  L I +A  +
Sbjct: 119 VNGVLREALRRRSRWIWPEAGEEPGKYIAVTTAHPIWYVERLLHEFGFEETLDICNANNT 178

Query: 175 PLYIDLTVK---FDIETWAHKLNAVMLPTGG-------IRLKELPESIVSLPGFAEGVWW 224
              + L V      I+T         +           +RL  L   +     + +G+  
Sbjct: 179 VAPMTLRVNALKTSIDTILQWCAEHGIDAEPSGVVPTAVRLSGLRRDLAETSIYRDGLVQ 238

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           VQD ++ I   L        VLDLCA  GGK+     L+    +V A+D S  +LE+LR 
Sbjct: 239 VQDEASQIVSTLVAPRAGERVLDLCAGFGGKSTHLGILMGDRGEVVAVDNSAWKLEELRK 298

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKL--FDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           N  R  L        D F++ P     FD VL+DAPCS  GT+RR+PD+ W R   D  +
Sbjct: 299 NARRQGLRIIKPRTADLFEFSPGTEDLFDRVLLDAPCSGFGTLRRNPDIKWRRHLKDPRR 358

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
               Q+++L     FVKPGG +V+S C+L +++++ V +    S P       +      
Sbjct: 359 FGRIQKEMLDHAARFVKPGGALVYSACTLFQEENDAVAEHFAASHPDWQ----IEPVGPD 414

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             D    ++   + R  P            +DGFFA  L+R
Sbjct: 415 LPDACRGMASGPFFRTWPH--------RHQVDGFFAARLKR 447


>gi|191174468|ref|ZP_03035969.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           F11]
 gi|300973968|ref|ZP_07172375.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 200-1]
 gi|306816369|ref|ZP_07450507.1| 16S rRNA methyltransferase B [Escherichia coli NC101]
 gi|190905276|gb|EDV64914.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           F11]
 gi|222034997|emb|CAP77740.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           LF82]
 gi|300308978|gb|EFJ63498.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 200-1]
 gi|305850765|gb|EFM51222.1| 16S rRNA methyltransferase B [Escherichia coli NC101]
 gi|312947839|gb|ADR28666.1| 16S rRNA methyltransferase B [Escherichia coli O83:H1 str. NRG
           857C]
 gi|324014965|gb|EGB84184.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 60-1]
          Length = 429

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 120/458 (26%), Positives = 213/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|86609413|ref|YP_478175.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557955|gb|ABD02912.1| ribosomal RNA small subunit methyltransferase B [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 457

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 122/485 (25%), Positives = 192/485 (39%), Gaps = 80/485 (16%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR ++   L  + R+      +L     +S    L   D+ LV  +V    R    +D
Sbjct: 1   MNARQLALLALQKIERQNAYADLVLGHLLANS---SLIPADRHLVSELVYGITRRRRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
           A++D +      ++   L+ +L + + Q+ +LD +   A +  +VE A++         +
Sbjct: 58  ALIDCLAQRPAHKQPPDLRLILHLGLYQLAFLDQIPASAAIHTSVELARQMGLG-SLTGV 116

Query: 124 VNSILRRVSREKIELLQRIA-----------------GISIIPEWFKERLENFYGKERVL 166
           VN ILR   R+ ++  ++                        P+W         G     
Sbjct: 117 VNGILRAYQRQVLDQPEKDPLKPLEDTLPADPIQALGIRHSFPDWLVSLWWERLGPVETE 176

Query: 167 AISDACISPLYIDLTVKFDIETWAHKLNA----------VMLPTGGIRLKELPESIVSLP 216
            +      P ++DL V          + A          +    G +RL++    I +LP
Sbjct: 177 QLCAWFNQPPHLDLRVNPLRADVNKVIQALAAAGIPALPISEVPGALRLQDHAGDITALP 236

Query: 217 GFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK---VTALDVSK 273
           GFA+G W VQDASA   V          V+D CAAPGGKT Q+         + ALD   
Sbjct: 237 GFAQGWWSVQDASAQQVVHWLDPQPGERVIDCCAAPGGKTTQIAQHMQDRGEIWALDRHP 296

Query: 274 RRLEKLRCNLDRLHLYAEDIIEMD------------------AFDYCPKKLFDAVLVDAP 315
            RL +L  N  RL L +   + +D                       P +  D VL+DAP
Sbjct: 297 HRLRRLEENRQRLGLSSIRPLAIDLLSLSAAADRVSGTESLPPAPLPPWQSADRVLLDAP 356

Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375
           CS  GT+ RH D  W +  + I + A  Q +LL     ++KPGG++V++ C+L   ++EE
Sbjct: 357 CSGLGTLHRHADARWRQTPERIPELAHLQAQLLQVAARWLKPGGVLVYATCTLHPAENEE 416

Query: 376 VVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFA 435
           ++Q  L S P                           + I P   ++        DGFF 
Sbjct: 417 IIQAFLDSHPNWAAEGDP-------------------LLIWPHRQDR--------DGFFI 449

Query: 436 VALRR 440
             LRR
Sbjct: 450 QRLRR 454


>gi|158522242|ref|YP_001530112.1| sun protein [Desulfococcus oleovorans Hxd3]
 gi|158511068|gb|ABW68035.1| sun protein [Desulfococcus oleovorans Hxd3]
          Length = 468

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 110/460 (23%), Positives = 185/460 (40%), Gaps = 40/460 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
            R V+  +L+ + +   +L  + D      +F    +RD+ LV  +V   LR+   +D  
Sbjct: 21  PRAVALRILTALEKGHRTLDQVADEALARVSFP--EKRDRALVTTLVYGVLRWRNTLDYT 78

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +     + L R   ++  +LR+ + Q+ +LD + D+A ++ +V+ +K+    R  +  VN
Sbjct: 79  IVHFSRTPLQRMDPAVLNILRLGLFQLRFLDRIPDFAAINSSVDLSKQAGLGR-LSGFVN 137

Query: 126 SILRRVSREKIELLQRIAGISI---------IPEWFKERLENFYGKERVLAISDACISPL 176
            +LR  +R   E                    PEW   R    +G E  + + D   +  
Sbjct: 138 GLLRSSTRHPGEPDPPDMDKDPVQALCVTKSFPEWMIRRWIARFGIEETVQLCDFLNTVP 197

Query: 177 YIDLTVKFDI---ETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
            I + V       E  A  L                +        +  +  F  G + VQ
Sbjct: 198 PITVRVNGLRAAPEQVAASLAQEAAGVTPGRHAPEAVSFSSPKVPVHEMTAFGAGWFQVQ 257

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D +A +   L        VLD CA  GGKT  L   + +  ++ A D    +LE+L   +
Sbjct: 258 DEAAQLIGLLTDPRPGQRVLDACAGLGGKTGHLARLMENQGRIVAADRDTAKLERLAGEM 317

Query: 284 DRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            RL +     + +D            FD VL D PCS TG IRR+PD  W     D+ + 
Sbjct: 318 TRLGITNVRPMTLDMLVPEQLKDAGGFDRVLADCPCSGTGVIRRNPDTKWRLSEQDLARL 377

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q  +L      V+ GG++V++ CS++ ++++ VVQ  L+  P       + +     
Sbjct: 378 QNDQIAMLTNLADHVRDGGLLVYAVCSMEPEENDAVVQSFLKRRPDFAIDTGVAADVPAV 437

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                     G+ R  P           GMDGFF V L++
Sbjct: 438 AGFTDDP---GFFRTFP--------WRHGMDGFFGVRLKK 466


>gi|320195380|gb|EFW70007.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           WV_060327]
          Length = 429

 Score =  269 bits (687), Expect = 7e-70,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C K+ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGKQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|315297154|gb|EFU56434.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 16-3]
          Length = 429

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|331649085|ref|ZP_08350171.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M605]
 gi|330909333|gb|EGH37847.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           AA86]
 gi|331041583|gb|EGI13727.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M605]
          Length = 429

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 121/458 (26%), Positives = 213/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       +TW   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDTWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|260857409|ref|YP_003231300.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O26:H11 str. 11368]
 gi|260870031|ref|YP_003236433.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O111:H- str. 11128]
 gi|257756058|dbj|BAI27560.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O26:H11 str. 11368]
 gi|257766387|dbj|BAI37882.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O111:H- str. 11128]
 gi|323154126|gb|EFZ40329.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           EPECa14]
 gi|323179175|gb|EFZ64749.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1180]
          Length = 429

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 209/458 (45%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  ++ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQIVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V V Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGVYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAGFYASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNL 412

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               + EG                   DGFF   L + 
Sbjct: 413 PG--TEEG-------------------DGFFYAKLIKK 429


>gi|296104996|ref|YP_003615142.1| 16S rRNA methyltransferase B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295059455|gb|ADF64193.1| 16S rRNA methyltransferase B [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 438

 Score =  269 bits (686), Expect = 8e-70,   Method: Composition-based stats.
 Identities = 117/456 (25%), Positives = 210/456 (46%), Gaps = 45/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 11  MKK-QNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 64

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+L+  +  +A +   VE A   K  +  
Sbjct: 65  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLHTRIPPHAALAETVEGAVAIKRPQ-L 123

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ ELL   A      + P+W   RL+  Y +        +    P+
Sbjct: 124 KGLINGVLRQFQRQQEELLAEFAKSETRFLHPDWLLNRLKKAYPQRWQDIADANNQRPPM 183

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGF EG   VQDAS
Sbjct: 184 WLRVNRNHHTRDAWLALLEEAGMSGFAHDAYPDAVRLASPVPVHALPGFDEGWVTVQDAS 243

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT  ++    +  V A+D+  +RL ++  NL RL 
Sbjct: 244 AQGCMTWLEPKNGEQILDLCAAPGGKTTHILEVAPQASVMAVDIDDQRLSRVYDNLKRLG 303

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D     ++C +  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 304 MKA-QVKQGDGRKPTEWCGETQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIKELAQLQ 362

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + +   L+ +P                 + 
Sbjct: 363 SEILDAIWPHLKPGGTLVYATCSILPEENSQQISAFLKRTPGA--------------TLR 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              +PE          ++    +   DGFF   L +
Sbjct: 409 DTGTPE-------HPGQQNLPGAEEGDGFFYAKLIK 437


>gi|323487019|ref|ZP_08092331.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           symbiosum WAL-14163]
 gi|323399667|gb|EGA92053.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           symbiosum WAL-14163]
          Length = 444

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 102/457 (22%), Positives = 201/457 (43%), Gaps = 32/457 (7%)

Query: 1   MKSGMNA-RLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M     A R +   +L  V+ K      +L      + ++ L ++D+  ++ +V+ T+ +
Sbjct: 1   MTVKEPALREIILDILLEVLEKGKYSHVILSQAL--TKYQYLEKQDRSFIKRVVDGTVEY 58

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENR 118
             ++D +L+      + + K  ++ +LR+S  QI ++D V D A  + AV+ A++ +   
Sbjct: 59  RIQLDYILNSYSKVKVNKMKPVIRTILRMSAYQICHMDRVPDSAACNEAVKLAEK-RGFS 117

Query: 119 HFAKLVNSILRRVSR-EKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
                VN +LR +SR +   +    +    +PEW     ++ YG+E    + ++ +    
Sbjct: 118 GLKGFVNGVLRSISRGKDNLVFPDDSIRYSMPEWLASMWKSTYGEETFRRMMESFLKDRP 177

Query: 178 IDLTVKFDIETWAHKLNAVM---------LPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           +   +  +       L+++               +   E  + +  L  F EG   +QD 
Sbjct: 178 LMARLCLNRAEKQQILDSLGAQGVTAKDSRYADDVICLEGVDYLEGLEAFREGWLQIQDL 237

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDR 285
           S+S+     G  +   V+D+C APGGK             V   D+S+ ++  +  N+ R
Sbjct: 238 SSSLAGDAAGIKDGDYVIDVCGAPGGKGLHAADILGGTGMVEIRDISEAKVSLIEENIGR 297

Query: 286 LHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
             L        DA  + P  ++  D V+ D PCS  G I R PD+ +    + +   AC 
Sbjct: 298 SGLTNLRAAVCDALSFDPDSEEAADVVIADLPCSGLGIIGRKPDIKYNMTPEKLHDLACL 357

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR++L     +VKPGG +V+S C+++++++E+ ++  L   P      P+N        +
Sbjct: 358 QREILSVVQRYVKPGGTLVYSTCTVNREENEDNMRWFLEHFP----FEPVNLKGRLGEKL 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +      G+I+  P +           DGFF   +++
Sbjct: 414 SEPSMESGYIQFLPGI--------HPCDGFFIAVMKK 442


>gi|168823234|ref|ZP_02835234.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|205354964|ref|YP_002228765.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|207858650|ref|YP_002245301.1| 16S rRNA methyltransferase B [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224493261|sp|B5R1E5|RSMB_SALEP RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493262|sp|B5RH47|RSMB_SALG2 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|205274745|emb|CAR39801.1| sun protein [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|205340499|gb|EDZ27263.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Weltevreden str.
           HI_N05-537]
 gi|206710453|emb|CAR34811.1| sun protein [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|326630113|gb|EGE36456.1| ribosomal RNA small subunit methyltransferase B [Salmonella
           enterica subsp. enterica serovar Gallinarum str. 9]
          Length = 429

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 121/457 (26%), Positives = 209/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLSNVLP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|154505951|ref|ZP_02042689.1| hypothetical protein RUMGNA_03493 [Ruminococcus gnavus ATCC 29149]
 gi|153793969|gb|EDN76389.1| hypothetical protein RUMGNA_03493 [Ruminococcus gnavus ATCC 29149]
          Length = 448

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 95/462 (20%), Positives = 188/462 (40%), Gaps = 35/462 (7%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +  R +   +L  V ++ +     L+       ++ L ++++  +  +   TL  +
Sbjct: 1   MTKQVTERELVLAILMEVTQQNVYSHLALNAVLE--KYQYLEKKERAFITRVTEGTLEHM 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L+      + + K  ++ +LR +V Q+ Y+D V D AV + AV+ A + K    
Sbjct: 59  IELDYILNQFSKVKVNKMKPVIRNILRSAVYQLKYMDSVPDSAVCNEAVKLAVK-KGFGT 117

Query: 120 FAKLVNSILRR------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
               VN +LR             E ++R++ +  +PEW  +  +  Y  + + ++  A  
Sbjct: 118 LRGFVNGVLRNVARGLDQVEYPTEGIERLSVVYSMPEWILKLWKKTYDLDVIESMLQAFQ 177

Query: 174 SPLYIDLTVK---FDIETWAHKLNAVM------LPTGGIRLKELPESIVSLPGFAEGVWW 224
               + +         E     L                   +  + +  L  F +G ++
Sbjct: 178 EETPVTIRCNLAKTTPENLKESLQKEGVTVTPHPYLSYAFWIQDYDHLSELESFQKGEFY 237

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRC 281
           VQD S+ +  +L        V+D+CAAPGGK   +         V A D+S  ++  +  
Sbjct: 238 VQDISSMLVGELADPKKGDRVIDVCAAPGGKALHVAEKLRGTGSVEARDLSLYKVGLITE 297

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           N++R  L     ++ DA           D V+ D PCS  G + +  D+ +        +
Sbjct: 298 NIERSGLTNIHAVQKDATVCDADVKDAADLVIADLPCSGLGVLAKKTDLKYKATEQSTKE 357

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
            A  QR++L    S+V+PGG +++S C+++  ++ E V   L+  P    L P+      
Sbjct: 358 LAGLQREILKNAASYVRPGGTLIYSTCTINPAENIENVHWFLKEFP-EFVLDPIADRL-- 414

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +  ++   G +++ P +           DGFF     + 
Sbjct: 415 CSTLQNSVEEAGCLQLLPGI--------HKSDGFFIARFGKK 448


>gi|158338705|ref|YP_001519882.1| ribosomal RNA small subunit methyltransferase B [Acaryochloris
           marina MBIC11017]
 gi|158308946|gb|ABW30563.1| ribosomal RNA small subunit methyltransferase B [Acaryochloris
           marina MBIC11017]
          Length = 443

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 124/464 (26%), Positives = 200/464 (43%), Gaps = 48/464 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R ++   L  V  +       L         + ++  D+ L+  ++  ++R  
Sbjct: 1   MTP--NPRQLAYRGLKAV-HRGAYADVALSRVM----PKTIADADRRLLTELLYGSVRRQ 53

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +DA++D        ++   L+ LL + + Q+ +LD + D A +   VE AK+++ +  
Sbjct: 54  RTLDALIDQFAKKPAHQQPPDLRTLLHLGLYQLRFLDHIPDAAAIFTTVELAKQNQLS-G 112

Query: 120 FAKLVNSILRRVSRE----------KIELLQRIAGISIIPEWFKERLENFYGKERVLAIS 169
            +  VN +LR+ +R             + +Q +  +   P+W  +   +  G E    + 
Sbjct: 113 LSGFVNGLLRQYARAAANLNDPLELPPDPIQHLGILYSYPDWIVQVWHDQLGSEETEKLC 172

Query: 170 DACISPLYIDLTVK---FDIETWAHKLNAVM-------LPTGGIRLKELPESIVSLPGFA 219
           D C  P +IDL +     D E+   +L +              +R++     I  LPGF 
Sbjct: 173 DYCNQPPHIDLRINSLKTDRESVRSQLASAGVTTTPLPHLPQALRIEGKSGPIPQLPGFQ 232

Query: 220 EGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRL 276
           EG+W VQ+ASA +   L         LD+CAAPGGKT  +   + +  +V A D +  RL
Sbjct: 233 EGLWTVQEASAQLVGHLLNPQPGAIALDVCAAPGGKTTHIAELMENQGEVWACDRTPSRL 292

Query: 277 EKLRCNLDRLHLYAEDIIEMDAFDYCPKKL-FDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
            KL  N  RL +    I   D+          D VLVDAPCS  GT+ RH D  W +  D
Sbjct: 293 RKLNQNTQRLGIDTVTIWTGDSRQLSNHIPLADYVLVDAPCSGLGTLHRHADARWQQTPD 352

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           +I   +  Q  LLL     VKPGGI+++S C+L   ++E ++ + L   P      P+  
Sbjct: 353 NIQDLSTLQLDLLLNSARRVKPGGILLYSTCTLHPLENENIIDQFLAQMPQWQTQQPIAE 412

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALR 439
               S   +        ++I P            MDGFF   LR
Sbjct: 413 WVPTSGPQSS-------VKILPH--------QQNMDGFFMAILR 441


>gi|164687800|ref|ZP_02211828.1| hypothetical protein CLOBAR_01444 [Clostridium bartlettii DSM
           16795]
 gi|164603075|gb|EDQ96540.1| hypothetical protein CLOBAR_01444 [Clostridium bartlettii DSM
           16795]
          Length = 441

 Score =  269 bits (686), Expect = 9e-70,   Method: Composition-based stats.
 Identities = 104/460 (22%), Positives = 215/460 (46%), Gaps = 43/460 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M +R ++  +L  + + +      ++  + D     L  RD+     I+   +     +D
Sbjct: 1   MKSRNLAYKVLFDIEKNQNYSNMAINKHFKD---CNLDNRDRGFATEIIYGVVENKIYLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D +      +    ++ LLR+ + QIL+LD V+DYA V+  V   K+   +   A  
Sbjct: 58  YIIDKLSKIKSNKLNLKVKILLRMGIYQILFLDSVSDYAAVNETVNLTKK--LDNRSAGF 115

Query: 124 VNSILRRVSRE--------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           VN++LR V R+          + +  +A      +W      + +G+E    + +A    
Sbjct: 116 VNAVLRNVIRQKEDIGEVKIKDTVDNLATKYSYNKWIVRNWISNFGREFTEDLLEANTER 175

Query: 176 LYIDLTVK---FDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQ 226
             I L V       +     L    +    +            ++I +   + +G++ VQ
Sbjct: 176 PSIYLRVNTLKTTRDELIKLLEEQEVNCEKVPFMDEAIKVNNLKNIENNELYKKGLFTVQ 235

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ +  ++     +  VLD+C+APGGKT  +   + +  +V + D+ + +++ ++ ++
Sbjct: 236 DISSMLVGKILNPQKDTKVLDVCSAPGGKTTHIATLMENSGQVISRDIFEHKIKLIQNSV 295

Query: 284 DRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           +RL L   D+   DA +        FD+VL D PCS  G I+R P++ + ++ ++I    
Sbjct: 296 NRLGLKNVDVQLFDALNLDKDSIDKFDSVLADVPCSGLGIIKRKPEIKY-KEKEEIKDLP 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q+++L     +VK GG +++S C++   ++ EVV+  L+S+    +L  +     ++I
Sbjct: 355 KLQKQILQNAAKYVKVGGTLIYSTCTIQDDENIEVVESFLQSNK-RFKLEKI-----ENI 408

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ++ +    +G+++I P++         GMDGFF   L+R+
Sbjct: 409 NIDLENEDKGYLKIYPNV--------HGMDGFFIAKLKRV 440


>gi|307132808|ref|YP_003884824.1| Ribosomal RNA small subunit methyltransferase B [Dickeya dadantii
           3937]
 gi|306530337|gb|ADN00268.1| Ribosomal RNA small subunit methyltransferase B [Dickeya dadantii
           3937]
          Length = 431

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 129/460 (28%), Positives = 207/460 (45%), Gaps = 46/460 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++  L  V+ +  SL+ LL     D     +S++D+ L++ I    LR L
Sbjct: 1   MKSKYNLRSIAATALVQVVEQGQSLSHLLPALQRD-----ISEKDRGLLQEICFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  L  ++   L  K+  L  LL V + Q+++  +  +A +   V  A   K  +  
Sbjct: 56  PQLDWHLRQLMAKPLTGKQKVLHYLLMVGLYQLIHTRIPPHAALAETVNGAVALKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +    +R   E  + LQ        P+W  +RL+  Y ++    I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELQQRLQNNPARYAHPDWLLQRLKKAYPQQW-ERIVEANNQHPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V         +   L    +                P ++  LPGF +G   VQDA
Sbjct: 174 MWLRVNRQHHTRAAYLALLQEKEITAYPHAFYPDAIRLGTPCAVNQLPGFEQGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      ++  +LDLCAAPGGKT  ++     A V A+DV ++RL+++R NL RL
Sbjct: 234 SAQGCIHWLAPQDHEEILDLCAAPGGKTTHILEAAPHAHVLAVDVDEQRLKRVRENLQRL 293

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
             +AE +   D     ++C  KLFD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GQHAE-VKCGDGRTPTEWCGDKLFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELASL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+ +L      +K GG +V++ CS+  +++ + V   L+  P  V +             
Sbjct: 353 QQAILEAIWPRLKSGGTLVYATCSILPEENHQQVAAFLQRHPDAVLVDTGR--------- 403

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                             +    +   DGFF   L +  Q
Sbjct: 404 ------------LEHPGIQNLPAAEDGDGFFYAKLVKNGQ 431


>gi|91212715|ref|YP_542701.1| 16S rRNA methyltransferase B [Escherichia coli UTI89]
 gi|117625571|ref|YP_858894.1| 16S rRNA methyltransferase B [Escherichia coli APEC O1]
 gi|218560350|ref|YP_002393263.1| 16S rRNA methyltransferase B [Escherichia coli S88]
 gi|237703018|ref|ZP_04533499.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|123265979|sp|Q1R644|RSMB_ECOUT RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493249|sp|A1AGI0|RSMB_ECOK1 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766854|sp|B7MCQ4|RSMB_ECO45 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|91074289|gb|ABE09170.1| SUN protein [Escherichia coli UTI89]
 gi|115514695|gb|ABJ02770.1| Sun protein [Escherichia coli APEC O1]
 gi|218367119|emb|CAR04893.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli S88]
 gi|226902282|gb|EEH88541.1| conserved hypothetical protein [Escherichia sp. 3_2_53FAA]
 gi|294490375|gb|ADE89131.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           IHE3034]
 gi|307628323|gb|ADN72627.1| 16S rRNA methyltransferase B [Escherichia coli UM146]
 gi|315284577|gb|EFU44022.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 110-3]
 gi|323950202|gb|EGB46084.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H252]
 gi|323954589|gb|EGB50372.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H263]
          Length = 429

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 120/458 (26%), Positives = 213/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSMLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|218702051|ref|YP_002409680.1| 16S rRNA methyltransferase B [Escherichia coli IAI39]
 gi|300935286|ref|ZP_07150297.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 21-1]
 gi|254766856|sp|B7NLK8|RSMB_ECO7I RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218372037|emb|CAR19897.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           IAI39]
 gi|300459489|gb|EFK22982.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 21-1]
          Length = 429

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|300903537|ref|ZP_07121459.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 84-1]
 gi|301305498|ref|ZP_07211590.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 124-1]
 gi|300404410|gb|EFJ87948.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 84-1]
 gi|300839193|gb|EFK66953.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 124-1]
 gi|315255872|gb|EFU35840.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 85-1]
          Length = 429

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 209/458 (45%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADAELCETGTPEQPGKQNL 412

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               + EG                   DGFF   L + 
Sbjct: 413 PG--TEEG-------------------DGFFYAKLIKK 429


>gi|215488588|ref|YP_002331019.1| 16S rRNA methyltransferase B [Escherichia coli O127:H6 str.
           E2348/69]
 gi|312968386|ref|ZP_07782596.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           2362-75]
 gi|254766853|sp|B7UK12|RSMB_ECO27 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|215266660|emb|CAS11099.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O127:H6 str. E2348/69]
 gi|312287211|gb|EFR15121.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           2362-75]
 gi|323189106|gb|EFZ74390.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           RN587/1]
          Length = 429

 Score =  268 bits (685), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C K+ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGKQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|327441110|dbj|BAK17475.1| tRNA and rRNA cytosine-C5-methylase [Solibacillus silvestris
           StLB046]
          Length = 453

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 113/458 (24%), Positives = 201/458 (43%), Gaps = 42/458 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R  +  +L  V + +     LL           +  +D+ L+  +   TL+    +D 
Sbjct: 12  NVRDAALTILLTVDKSQAYSNLLLHQTIEKYK---IDAKDRGLLTELTYGTLQHKLTLDY 68

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLV 124
            L+  +     +    ++ LLR+S+ Q+ YL  +  +A V+ AVE AKR + ++  A +V
Sbjct: 69  YLEPFIRG---KVDIWVRWLLRMSLYQMQYLTRIPAHAAVNEAVEIAKR-RGHKGIASMV 124

Query: 125 NSILR-------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N ILR       R +    +  +R+A  +  P+W  +R    YG ++   +         
Sbjct: 125 NGILRSILREGVRSTDLIEDANERLAIETSHPQWLVDRWVESYGYDKTREMLLENNIAPL 184

Query: 178 IDLTVKFDIETWAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
             + V     T    L         A         L            F  G+  +QD S
Sbjct: 185 QTVRVNTTKATVEQVLTTLEREGVKARRSEYIPECLHLESGQAARTGAFRNGLITIQDES 244

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           + +P ++      + VLD+CAAPGGKT     ++ +   + A D+  ++L+ +  N+ RL
Sbjct: 245 SMLPAKVLNPQPGMKVLDMCAAPGGKTTHLAEVMKNEGSILATDLHPKKLDLIEENVARL 304

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L   +   +D      +  K+ +DA+LVDAPCS  G +RR PD+ +T+  +D+      
Sbjct: 305 GLNIIETAPLDGRKAAGFLQKEGYDAILVDAPCSGLGVMRRKPDIKYTKREEDLESLQTI 364

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q  +L   +  +K  G +V+S C++D+ ++E  VQ  L+  P  + LVP+ +   +    
Sbjct: 365 QLSILNNAVQLLKQDGRLVYSTCTVDRSENEGTVQAFLKEHP-EMNLVPIENLPTQL--- 420

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             A   +G +++ P  +        G DGFF  A  + 
Sbjct: 421 -EAKQQDGMLQVFPQDI--------GSDGFFVAAFVKK 449


>gi|89895438|ref|YP_518925.1| hypothetical protein DSY2692 [Desulfitobacterium hafniense Y51]
 gi|89334886|dbj|BAE84481.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 453

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 109/460 (23%), Positives = 189/460 (41%), Gaps = 39/460 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           +R ++  +L  +  ++     ++     D +      R++ L   +VN TL+    +D  
Sbjct: 6   SRALAVQILQRIEEEKAYANLVMQKSLHDLS----DPRERQLTTLLVNGTLKHRLTLDYA 61

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L   L   L +    ++ +LR+S  Q+LYL  +     ++  VE  K+ +    +  LVN
Sbjct: 62  LRRHLRKPLSQLPREVRWILRISALQVLYLSRIPAAVAINEGVELTKKQQG--KYTSLVN 119

Query: 126 SILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           S+LRRV     E+L           ++     PEW  +R    YG     A+  A   P 
Sbjct: 120 SVLRRVLETGWEMLWPSQEKEPVRYLSLRYSHPEWMVKRWLKRYGMADTEALCQANNEPA 179

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWWVQD 227
            + +              +L    +            + E   S+  LP F EG++ VQD
Sbjct: 180 PVWIRTNTLKISRADLQARLEEEGVKVTIGERVPESLMIEEFGSLDQLPSFQEGLFTVQD 239

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLD 284
            S+ +   +        VLD C APGGKT      + +  ++ A D+   +++ +     
Sbjct: 240 ESSQLIAHVLNPQAGQKVLDACGAPGGKTTHLAQRMENQGEILAFDIHPHKVKLIEDLAA 299

Query: 285 RLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL +        DA +           VLVDAPCS  G +RR  D+ W ++ D+I     
Sbjct: 300 RLGITIIRAQAGDARELAGVKDASCHKVLVDAPCSGLGVLRRRADMRWHKEEDEIKTLPA 359

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIP-VELVPLNSAYWKSI 401
            Q  +L +    V  GG +V+S C+++ +++ EVV+      P      +     Y  + 
Sbjct: 360 LQLAILERAAQCVAAGGELVYSTCTIEPEENFEVVKAFRAKHPEFTTVDLSGELPYSLAS 419

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +     + +G+++I P           GMDGFF    RR+
Sbjct: 420 EQDRKQAAKGFLQILPH--------KQGMDGFFLAKFRRV 451


>gi|82778586|ref|YP_404935.1| 16S rRNA methyltransferase B [Shigella dysenteriae Sd197]
 gi|309785611|ref|ZP_07680242.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1617]
 gi|123742076|sp|Q32B61|RSMB_SHIDS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|81242734|gb|ABB63444.1| conserved hypothetical protein [Shigella dysenteriae Sd197]
 gi|308926731|gb|EFP72207.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1617]
          Length = 429

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMSGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGKHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|324009054|gb|EGB78273.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 57-2]
          Length = 429

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 120/458 (26%), Positives = 213/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTTDA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|74313807|ref|YP_312226.1| 16S rRNA methyltransferase B [Shigella sonnei Ss046]
 gi|123759539|sp|Q3YWX1|RSMB_SHISS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|73857284|gb|AAZ89991.1| conserved hypothetical protein [Shigella sonnei Ss046]
          Length = 429

 Score =  268 bits (684), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVHDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|168186789|ref|ZP_02621424.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum C str. Eklund]
 gi|169295225|gb|EDS77358.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum C str. Eklund]
          Length = 443

 Score =  268 bits (684), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 107/457 (23%), Positives = 186/457 (40%), Gaps = 40/457 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
            AR +   +L  V +K      +L      +    +  +D+ L+  IV  T+++   ID 
Sbjct: 3   KARKICVDVLEMVFKKNAYSNIVLRQTLNKNK---IDDKDKGLITEIVYGTIKYKYTIDT 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L+  L   +      +  +LR++V QI +LD + ++A V+ AVE AK+   +   +KLV
Sbjct: 60  ILNNYLKKGIKSLDSYVLNILRITVYQIKFLDKIPNFAAVNEAVEIAKKQ-RSVGASKLV 118

Query: 125 NSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N +LR   R   +                   +W    L   YG E    I         
Sbjct: 119 NGVLRNYLRNLDKKYYNEKSLVETLCFKYSYDKWLVNMLIKQYGNEIAEDILKGLNERPA 178

Query: 178 IDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V      +                        +    +SI   P F EG   VQD 
Sbjct: 179 VTVRVNNLKTDYDEAFKNLEDYGYDVEEGYICPEAIVINKGKSIEKNPLFKEGKITVQDE 238

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA +           +VLDLC+APGGKT  +   + +   V A D+   ++  ++ N  R
Sbjct: 239 SAMLVAPSIDAKEGATVLDLCSAPGGKTTHISEIMNNTGIVKAFDIHDNKISLVKENAKR 298

Query: 286 LHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +      EMDA  +  +     D VL+D PCS  G IR+ P++ +T+D          
Sbjct: 299 LGINNIACAEMDACKFNKELENSADMVLIDVPCSGLGIIRKKPEIKYTKDVKSTKDIVAI 358

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+K++     +V+  G +V+S C+++K ++E+ +   ++  P            +     
Sbjct: 359 QKKIMENAAKYVRKEGTLVYSTCTINKDENEKNINWFIKKFPEYKV-----EPLFYGNMN 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +  + +G + I P+           MDGFF   L++
Sbjct: 414 NIIYNEDGTVTILPNKY---------MDGFFIAKLKK 441


>gi|262273082|ref|ZP_06050899.1| ribosomal RNA small subunit methyltransferase B [Grimontia hollisae
           CIP 101886]
 gi|262222838|gb|EEY74146.1| ribosomal RNA small subunit methyltransferase B [Grimontia hollisae
           CIP 101886]
          Length = 426

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 122/452 (26%), Positives = 203/452 (44%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R V++ ++  V+ +  SL+  L       A + ++ RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAVAAQVIYQVVDQGQSLSAALP-----PAQQKVAPRDGALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    LV
Sbjct: 56  SITQSLMDKPLKGKQRVFHHLILVGLYQLSYMRIPAHAAVAETVNATKVLKKPQ-LRGLV 114

Query: 125 NSILRRVSREKIE----LLQRIAGISIIPEWFKERLENFYGKERVLAISDAC-ISPLYID 179
           N++LR   R +       +   AG    P W    L+  Y  +    +      +P+++ 
Sbjct: 115 NAVLRSYQRNQETLDAASVAHDAGKYGHPGWLLTLLQQAYPTQWEQVVEANHEKAPMWLR 174

Query: 180 LT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       E +   L+   + T      E       P  + +LPGF+EG   VQDA+A +
Sbjct: 175 VNRTHHTREAYKALLDQAGIETSVHPEAEDALKLATPCDVTALPGFSEGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLHLYA 290
            V          +LD CAAPGGKT  ++       V A+DV   RL ++  N+ RL L A
Sbjct: 235 AVDYLKPQAGELILDCCAAPGGKTCHILEHEPSANVVAMDVDAARLTRVEDNVKRLKLKA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI +    Q ++L
Sbjct: 295 RVICGDARTPDEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIDQLVSLQSEIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +K GG +V++ CS+  Q++ E V+  L  +P  V              +     
Sbjct: 355 DAMWAQLKSGGTLVYATCSVTPQENAEQVKAFLTRTPDAV--------------LETGTP 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +   +I P            MDGF+   L++
Sbjct: 401 TQPGRQILPG--------QEDMDGFYYAVLKK 424


>gi|167648734|ref|YP_001686397.1| Fmu (Sun) domain-containing protein [Caulobacter sp. K31]
 gi|167351164|gb|ABZ73899.1| Fmu (Sun) domain protein [Caulobacter sp. K31]
          Length = 426

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 158/440 (35%), Positives = 226/440 (51%), Gaps = 23/440 (5%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR  +  L+   + +R  L          +AFR L  R++   RA+   TLR L  I
Sbjct: 8   GLPAREGALALIDAALSRRGGLDEA----ASANAFRFLEPRERAFARALAMATLRHLGPI 63

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D  L   L    P     ++ LLR+   Q  +L+V  +A V  +VE A   K +R F  L
Sbjct: 64  DRALAGKLAKEPP---PRVRNLLRLGATQAFFLEVPAFAAVATSVELAGASKTSRPFKGL 120

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN++LR + R+        A   + P W   R  + YGKE   A++         DL++K
Sbjct: 121 VNAVLRGLLRDGALSD---ASEHLAPPWLYARWVSAYGKETADAVAAQIGFEPATDLSLK 177

Query: 184 FDIET--WAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
            D +    A +L   +LP G +R  E    + + P F +GVWW+QDA+A+IP +L     
Sbjct: 178 PDFDATALAAELEGEILPGGTLR-TERRGDVSAWPAFDDGVWWIQDAAAAIPARLLNLKP 236

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             + LDLCAAPGGKT Q++ +GA+V A+D S  RL ++  NL R+ + AE I    A  +
Sbjct: 237 GETALDLCAAPGGKTMQMVAAGAQVVAIDRSPARLGRVTENLARMSMQAEVIAAD-AGAW 295

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDAVL+DAPCS+TGT RRHPDVLW     D+   A  Q KLL      +KPGG +
Sbjct: 296 DDARTFDAVLLDAPCSATGTFRRHPDVLWAARPGDVASLAGVQSKLLDSAAGRLKPGGRL 355

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E  V+  L   P  + L P+ S    +   A +L+P G +RI P    
Sbjct: 356 VYCVCSLEPEEGEAQVEAFLARRP-DMALDPITSEEGGAP--AASLTPRGTLRILPHH-- 410

Query: 422 KIDGVSSGMDGFFAVALRRL 441
                  G+DGFFA    +L
Sbjct: 411 ----REGGLDGFFAARFVKL 426


>gi|297180807|gb|ADI17013.1| tRNA and rRNA cytosine-c5-methylases [uncultured Vibrionales
           bacterium HF0010_22E23]
          Length = 426

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 126/455 (27%), Positives = 203/455 (44%), Gaps = 46/455 (10%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ +  SLT +L       A + ++ RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAMAAKVIFQVVDQGQSLTAVLPK-----AQQQIADRDGALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A+   ++   L  K+     L+ V + Q+ Y+ V  +A V   V  A +  +      LV
Sbjct: 56  AITQSLMEKPLTGKQRVFHHLILVGLYQLNYMRVPAHAAVAETVN-ATKPLKKPQLRGLV 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKERVLAISDACIS-PLYID 179
           N++LR   RE+  L +      AG    P W  + L+N Y       +       P+++ 
Sbjct: 115 NAVLRNYQREQDALNEKAISHDAGRYGHPGWLLKLLQNAYPDSWQQIVDSNHQKAPMWLR 174

Query: 180 LT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +     + + +   LNA  +        E       P  +  LPGF +G   VQDA+A +
Sbjct: 175 VNRTHHNRDEYLELLNAEGIEGEAHPEAEDAIKLGSPCDVTKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            V          +LD CAAPGGKT         AKV A+D    RL ++  NL RL+L  
Sbjct: 235 SVNYLQPKAGELILDCCAAPGGKTCHILEHQPNAKVVAIDADANRLTRVEENLGRLNL-N 293

Query: 291 EDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
            D+I  D     ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI +    Q ++
Sbjct: 294 ADVICGDARSPDEWWNGEDFDRILLDAPCSATGVIRRHPDIKWLRRADDIEQLVTLQAEI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
                  +K GG +V++ CS+  Q++ E V+  L                    ++    
Sbjct: 354 FDAMWQKLKRGGTLVYATCSVTPQENAEQVKAFLARHDDA--------------NLQTGD 399

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           +     +I P            MDGF+   L++  
Sbjct: 400 ADNPGRQILPG--------QDDMDGFYYAVLQKQA 426


>gi|82545651|ref|YP_409598.1| 16S rRNA methyltransferase B [Shigella boydii Sb227]
 gi|123728324|sp|Q31VY8|RSMB_SHIBS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|81247062|gb|ABB67770.1| conserved hypothetical protein [Shigella boydii Sb227]
 gi|320173933|gb|EFW49109.1| Ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae CDC 74-1112]
          Length = 429

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|16124357|ref|NP_418921.1| rRNA methyltransferase RsmB [Caulobacter crescentus CB15]
 gi|221233040|ref|YP_002515476.1| 16S rRNA m5C methyltransferase RsmB [Caulobacter crescentus NA1000]
 gi|13421207|gb|AAK22089.1| rRNA methyltransferase RsmB [Caulobacter crescentus CB15]
 gi|220962212|gb|ACL93568.1| 16S rRNA m5C methyltransferase RsmB [Caulobacter crescentus NA1000]
          Length = 429

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 157/441 (35%), Positives = 221/441 (50%), Gaps = 22/441 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR  +  L+   + +R  L          + FR L  R++   RA+    LR L  I
Sbjct: 8   GLPAREAALTLIDAALSRRGGLDEA----ASANGFRFLEPRERAFARALAMAVLRHLGPI 63

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D  L   L  + P +   +  LLR+  AQ  YL+V  +A V  +VE A  +K +R F  L
Sbjct: 64  DRALTARLQKAPPDR---VMHLLRLGAAQAFYLEVPAFAAVATSVELAGANKTSRPFKGL 120

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           VN++LR + R+            + P W   R    +G+     I+         DL+ K
Sbjct: 121 VNAVLRGLLRDAPPAD---DPSLLAPPWLYARWVAAFGEATARQIAGQIAIEPATDLSAK 177

Query: 184 F--DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              D+      L A +LP G +RL+     + + PGF +G WWVQDA+A++P +L     
Sbjct: 178 PGADLAPLVEALEAEVLPGGTLRLRR-KGDVAAWPGFEDGTWWVQDAAAAVPARLLDVQP 236

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             SVLDLCAAPGGKT QL  +GA+V ALD S  RL++L  NL R  L AE +   DA  +
Sbjct: 237 GASVLDLCAAPGGKTLQLAAAGAQVVALDRSAARLKRLSENLTRTGLSAEIV-AADAAVW 295

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDA+L+DAPCS+TGT RRHPDVLW     D+   A  Q ++L      +KPG  +
Sbjct: 296 DDTRTFDAILLDAPCSATGTFRRHPDVLWAARPGDVASLANVQARILDAAADRLKPGARL 355

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA-LSPEGWIRITPDML 420
           V+  CSL+ ++ E  V+  L      V L P+ +A   S     A L+P G +R+ P   
Sbjct: 356 VYCVCSLEPEEGEAQVEAFLARR-QDVALEPITAAEAPSAGFPEASLTPRGTLRLLPHH- 413

Query: 421 EKIDGVSSGMDGFFAVALRRL 441
                   G DGFFA   R+L
Sbjct: 414 -----RDDGQDGFFAARFRKL 429


>gi|157157639|ref|YP_001464756.1| 16S rRNA methyltransferase B [Escherichia coli E24377A]
 gi|193066472|ref|ZP_03047516.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E22]
 gi|193071559|ref|ZP_03052468.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E110019]
 gi|194430276|ref|ZP_03062771.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B171]
 gi|209920754|ref|YP_002294838.1| 16S rRNA methyltransferase B [Escherichia coli SE11]
 gi|218555846|ref|YP_002388759.1| 16S rRNA methyltransferase B [Escherichia coli IAI1]
 gi|218696981|ref|YP_002404648.1| 16S rRNA methyltransferase B [Escherichia coli 55989]
 gi|256020647|ref|ZP_05434512.1| 16S rRNA methyltransferase B [Shigella sp. D9]
 gi|260846086|ref|YP_003223864.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O103:H2 str. 12009]
 gi|293453607|ref|ZP_06664026.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B088]
 gi|300815501|ref|ZP_07095726.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 107-1]
 gi|300822908|ref|ZP_07103044.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 119-7]
 gi|300918263|ref|ZP_07134867.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 115-1]
 gi|300921903|ref|ZP_07138058.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 182-1]
 gi|301325146|ref|ZP_07218678.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 78-1]
 gi|307315133|ref|ZP_07594716.1| sun protein [Escherichia coli W]
 gi|309794564|ref|ZP_07688986.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 145-7]
 gi|331670118|ref|ZP_08370957.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA271]
 gi|331679357|ref|ZP_08380027.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H591]
 gi|332281843|ref|ZP_08394256.1| 16S rRNA m5C967 methyltransferase S-adenosyl-L-methionine-dependent
           [Shigella sp. D9]
 gi|224493245|sp|A7ZSH7|RSMB_ECO24 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766855|sp|B7LHZ0|RSMB_ECO55 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766858|sp|B7M0Z4|RSMB_ECO8A RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|254766860|sp|B6I202|RSMB_ECOSE RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|157079669|gb|ABV19377.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E24377A]
 gi|192925853|gb|EDV80503.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E22]
 gi|192955147|gb|EDV85641.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E110019]
 gi|194411665|gb|EDX27992.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B171]
 gi|209914013|dbj|BAG79087.1| putative rRNA methylase [Escherichia coli SE11]
 gi|218353713|emb|CAU99984.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           55989]
 gi|218362614|emb|CAR00240.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           IAI1]
 gi|257761233|dbj|BAI32730.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           O103:H2 str. 12009]
 gi|291321733|gb|EFE61164.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B088]
 gi|300414524|gb|EFJ97834.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 115-1]
 gi|300421704|gb|EFK05015.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 182-1]
 gi|300524674|gb|EFK45743.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 119-7]
 gi|300532393|gb|EFK53455.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 107-1]
 gi|300847978|gb|EFK75738.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 78-1]
 gi|306905482|gb|EFN36017.1| sun protein [Escherichia coli W]
 gi|308121614|gb|EFO58876.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 145-7]
 gi|315062580|gb|ADT76907.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli W]
 gi|323162967|gb|EFZ48802.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E128010]
 gi|323182767|gb|EFZ68168.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1357]
 gi|323376833|gb|ADX49101.1| sun protein [Escherichia coli KO11]
 gi|323944291|gb|EGB40367.1| ribosomal RNA small methyltransferase B [Escherichia coli H120]
 gi|324017855|gb|EGB87074.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 117-3]
 gi|324116322|gb|EGC10242.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E1167]
 gi|331062180|gb|EGI34100.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA271]
 gi|331072529|gb|EGI43854.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H591]
 gi|332104195|gb|EGJ07541.1| 16S rRNA m5C967 methyltransferase S-adenosyl-L-methionine-dependent
           [Shigella sp. D9]
          Length = 429

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|293412707|ref|ZP_06655375.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B354]
 gi|301018854|ref|ZP_07183093.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 69-1]
 gi|291468354|gb|EFF10847.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B354]
 gi|300399511|gb|EFJ83049.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 69-1]
          Length = 429

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMSWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|323173925|gb|EFZ59553.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           LT-68]
          Length = 429

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKTGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|218691575|ref|YP_002399787.1| 16S rRNA methyltransferase B [Escherichia coli ED1a]
 gi|254766857|sp|B7N0S9|RSMB_ECO81 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218429139|emb|CAR09947.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           ED1a]
          Length = 429

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 213/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|16078637|ref|NP_389456.1| RNA-binding Sun protein [Bacillus subtilis subsp. subtilis str.
           168]
 gi|221309449|ref|ZP_03591296.1| hypothetical protein Bsubs1_08691 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221313774|ref|ZP_03595579.1| hypothetical protein BsubsN3_08627 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221318698|ref|ZP_03599992.1| hypothetical protein BsubsJ_08561 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221322969|ref|ZP_03604263.1| hypothetical protein BsubsS_08667 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|3915867|sp|P94464|RSMB_BACSU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|2337803|emb|CAA74264.1| putative Fmu protein [Bacillus subtilis subsp. subtilis str. 168]
 gi|2633946|emb|CAB13447.1| RNA-binding Sun protein; 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Bacillus subtilis
           subsp. subtilis str. 168]
          Length = 447

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 125/463 (26%), Positives = 207/463 (44%), Gaps = 39/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   + R ++   L  + + +     LL      +    LS +++ L+  +V  TL+  
Sbjct: 1   MKK-TSVRDIALEALIKLEQNQAYSNLLLKSVIKSN---ELSDQNRGLLTELVYGTLQNK 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D +L   +     + K  + QLLR+S+ Q+ YL+ + D A +  AVE AK  + ++ 
Sbjct: 57  IALDYMLKPFINKP-QKVKPWVIQLLRLSLYQMEYLEKIPDRAAIHEAVEIAK-IRGHKG 114

Query: 120 FAKLVNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN +LR + RE +     I       A  +  PEW  +   + YG E    I    
Sbjct: 115 IASFVNGVLRSIQREGVPSFDAIEDPVRRLATETSHPEWLVKEWADAYGFEAAEKICRIH 174

Query: 173 ISPLYIDLTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           + P    L V       A  L+                  +K L  +I     F  G   
Sbjct: 175 LIPPKQTLRVNQMKADRAELLDQMAAEGIEVEKGDLAEDAVKLLKGTIAGTHFFQNGEVS 234

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +  +     ++ +VLD CAAPGGK+A +   + +   VT+LD+ K +++ ++ 
Sbjct: 235 IQDESSMLVARALDPKSDETVLDACAAPGGKSAHIAELMKNKGSVTSLDLHKHKVKLIKE 294

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
             DRL L       MDA         + FD +LVDAPCS  G IRR PD+ +T+  DD  
Sbjct: 295 AADRLGLTIIHAETMDARKAGETFENEQFDRILVDAPCSGFGVIRRKPDMKYTKKPDDSA 354

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + A  Q  +L +    VK GG +V+S C++D+ +++EV+   ++  P      P  S   
Sbjct: 355 RLAEIQLSILREIAPLVKKGGTLVYSTCTMDRTENDEVIHAFIQEHPDF---EPDLSLEK 411

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +  +       +G ++I P           G DGFF  ++R+ 
Sbjct: 412 RLPEKVRPFVRDGRLQILPHYF--------GTDGFFICSMRKK 446


>gi|293416707|ref|ZP_06659344.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B185]
 gi|291431283|gb|EFF04268.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           B185]
          Length = 429

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       + W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDNWLALLDEAGMKGFPHTDYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|323974759|gb|EGB69872.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TW10509]
          Length = 456

 Score =  267 bits (682), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 115/457 (25%), Positives = 211/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 28  MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 82

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 83  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 141

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ E            + P W  +RL+  Y ++    I  +    P+
Sbjct: 142 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 201

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       ++W   L+   +                P  +  LPGF EG   VQDAS
Sbjct: 202 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHVLPGFEEGWVTVQDAS 261

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 262 AQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLG 321

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 322 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQ 380

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +K GG ++++ CS+  +++   ++  L+ +                 ++ 
Sbjct: 381 SEILDAIWPHLKSGGTLIYATCSVLPEENSLQIKAFLQRTADA--------------ELC 426

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE          ++    +   DGFF   L + 
Sbjct: 427 ETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 456


>gi|320087854|emb|CBY97617.1| Ribosomal RNA small subunit methyltransferase B rRNA
           (cytosine-C(5)-)-methyltransferase; 16S rRNA m5C967
           methyltransferase [Salmonella enterica subsp. enterica
           serovar Weltevreden str. 2007-60-3289-1]
          Length = 429

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 120/457 (26%), Positives = 208/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +          + ++ +D+ L++ +    LR L
Sbjct: 1   MKKQNNLRSLAAQAVELVVEQGQSLSNVFP-----PLQQKVADKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+LY  V  +A +   VE A   K  +  
Sbjct: 56  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLYTRVPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+N Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQETLLNEFATSDARFLHPGWLVKRLQNAYPTQWQHIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L    +                P  + +LPGFAEG   VQDAS
Sbjct: 175 WLRVNRTHHTRDGWLGLLEDAGMKGYPHPDYPDAVRLETPAPVHALPGFAEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A          N   +LDLCAAPGGKT     +   A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCAVFLAPQNGEHILDLCAAPGGKTTHILEVAPEADVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPAQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +KPGG +V++ CS+  +++ + ++  L+ +P                ++ 
Sbjct: 354 AEILDAVWPRLKPGGTLVYATCSVLPEENRDQIKTFLQRTPDAALSETGTPDQPGQQNLP 413

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                EG                   DGFF   L + 
Sbjct: 414 GG--EEG-------------------DGFFYAKLIKK 429


>gi|331654881|ref|ZP_08355880.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M718]
 gi|331046896|gb|EGI18974.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M718]
          Length = 429

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|20807946|ref|NP_623117.1| tRNA and rRNA cytosine-C5-methylase [Thermoanaerobacter
           tengcongensis MB4]
 gi|254479565|ref|ZP_05092880.1| ribosomal RNA small subunit methyltransferase B [Carboxydibrachium
           pacificum DSM 12653]
 gi|20516516|gb|AAM24721.1| tRNA and rRNA cytosine-C5-methylases [Thermoanaerobacter
           tengcongensis MB4]
 gi|214034503|gb|EEB75262.1| ribosomal RNA small subunit methyltransferase B [Carboxydibrachium
           pacificum DSM 12653]
          Length = 443

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 104/460 (22%), Positives = 195/460 (42%), Gaps = 41/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR ++  +L  V+ K+  +         +   + +   D   V+ +V   +     +D
Sbjct: 1   MNARELAYRILYDVVVKKAYINISFAKHLRNDEVKEV---DAAFVKELVYGVIERKYTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +L F +  S   K      LL + + Q+LY+D V DYA ++  VE AK+    +  +  
Sbjct: 58  FILSFFIKKSADTKA---LLLLEMGLYQLLYMDKVPDYAAINETVEIAKKFLSKKGAS-F 113

Query: 124 VNSILRRV--------SREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +N++LR            +K      +      P+W  ER    +  ++   +  +    
Sbjct: 114 LNAVLRSYLREKEKVKFPDKQNFPYYLKVTYSYPDWIIERFLKNFDADKAEKLLASLNEK 173

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPTGGIR-----LKELPESIVSLPGFAEGVWWVQD 227
             I   V       E    KL    +           L    ++  S P + +G+   QD
Sbjct: 174 PEISYRVNTLKISAEELQEKLKREDISYKKGYYLEEALYIDLKNPESHPIYKDGLIHPQD 233

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            ++ +  ++        +LD+CAAPGGKT  +   + +  +V A D+   RL+ +  N  
Sbjct: 234 EASMLVSRILSPQKGERILDVCAAPGGKTTHISQIMENTGEVVAFDLHPHRLKLIEENCR 293

Query: 285 RLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWT-RDTDDIVKSA 341
           RL +        DA           D VL D PC+  G IR+ PD+     D +++    
Sbjct: 294 RLGVTNVKTEVFDATFVNESYLEKADRVLADVPCTGIGIIRKKPDIKLKSYDKEELRGLI 353

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q ++L     +VK GG++V+S C++ +++++EV+++ L+         P + +    +
Sbjct: 354 ERQYRILKSSSLYVKKGGVLVYSTCTIGREENQEVIERFLKEHKNF---EPADISEDLPL 410

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ++ +  S  G+I+ TP        +   +DGFF   L+R+
Sbjct: 411 NLKVKTSDLGYIQTTP--------LEHKIDGFFIAKLKRI 442


>gi|237728623|ref|ZP_04559104.1| 16S rRNA m5C967 methyltransferase [Citrobacter sp. 30_2]
 gi|226909245|gb|EEH95163.1| 16S rRNA m5C967 methyltransferase [Citrobacter sp. 30_2]
          Length = 439

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 119/457 (26%), Positives = 212/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK  +N R +++  +  V+ K  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 11  MKKHLNLRSMTAQAVEQVVEKGQSLSNVLPAM-----QQKVADKDKALLQELCFGVLRTL 65

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ ++  ++   +  K+ ++  L+ V   Q+L+  +  +A +   VE A   K  +  
Sbjct: 66  SQLEWMIQQLMERPMTGKQRTVHYLIMVGFYQLLHTRIPAHAALAETVEGAVVIKRPQ-L 124

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGK-ERVLAISDACISPL 176
             L+N +LR+  R + ELL   A      + P W  +R+++ Y +    +  ++    P+
Sbjct: 125 KGLINGVLRQFQRRQDELLAEFAQSDLRFLHPSWLVKRIKSAYPQQWEAILEANNQRPPM 184

Query: 177 YIDLTVKFDIETWAHKLNAVMLPTGGIRLKEL-------PESIVSLPGFAEGVWWVQDAS 229
           ++ +            L      TG              P  + +LPGF EG   VQDAS
Sbjct: 185 WLRVNRNHHTRDAWLDLLTEAGLTGFPHPDYPDAVRLETPAPVHALPGFDEGWVTVQDAS 244

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A   V      +   +LDLC APGGKT  ++       V A+DV ++RL ++  NL RL 
Sbjct: 245 AQGCVNYLLPEDGEQILDLCCAPGGKTTHILEVAPLANVMAVDVDEKRLSRVYDNLKRLG 304

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 305 MKAT-VKQGDGRYPQQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 363

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L    S +K GG +V++ CS+  +++++ +   L  +P  V              ++
Sbjct: 364 AEILNATWSHLKSGGTLVYATCSILPEENQQQIAAFLARTPDAV--------------LS 409

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE      P    +    +   DGFF   L + 
Sbjct: 410 ETGTPEK-----PG--RQNLPGAEDGDGFFYAKLIKK 439


>gi|271502215|ref|YP_003335241.1| sun protein [Dickeya dadantii Ech586]
 gi|270345770|gb|ACZ78535.1| sun protein [Dickeya dadantii Ech586]
          Length = 431

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 128/459 (27%), Positives = 210/459 (45%), Gaps = 44/459 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++  L  V+ +  SL+ LL     D     +S+RD+ L++ I    LR L
Sbjct: 1   MKSTYNLRSIAATTLLQVVEQGQSLSQLLPALQRD-----ISERDRGLLQEICFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P++D  L  ++   L  K+  L  LL V + Q+++  +  +A +   V  A   K  +  
Sbjct: 56  PQLDWYLRQLMAKPLTGKQKVLHYLLMVGLYQLIHTRIPPHAALAETVNGAVALKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +    +R      + LQ        P+W  +RL+  Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQREQEALQQRLQNNPARYSHPDWLLQRLKKAYPGQWEQIIDANNQHPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       E +   L    +                P ++  LPGF +G   VQDAS
Sbjct: 175 WLRVNRRHHTREAYLALLQEKGIEAHPHAHYPDAIRLSTPCAVNVLPGFEKGFVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      ++  +LDLCAAPGGKT  ++     A+V A+DV ++RL+++R NL RL+
Sbjct: 235 AQGCIHWLSPQDHEDILDLCAAPGGKTTHILEAAPHARVLAVDVDEQRLKRVRENLQRLN 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+AE +   D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHAE-VKCGDGRTPTQWCGDKCFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELASLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
             +L      +K GG +V++ CS+  +++ + +   L+     + +     A        
Sbjct: 354 NTILEAIWPRLKNGGTLVYATCSVLPEENCQQIADFLQRHADAMLVDTGTPASP------ 407

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                   I++ P         +   DGFF   L +  Q
Sbjct: 408 -------GIQMLP--------AAEDGDGFFYAKLVKSGQ 431


>gi|16131168|ref|NP_417747.1| 16S rRNA m(5)C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. MG1655]
 gi|89110722|ref|AP_004502.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. W3110]
 gi|157162762|ref|YP_001460080.1| 16S rRNA methyltransferase B [Escherichia coli HS]
 gi|170018476|ref|YP_001723430.1| 16S rRNA methyltransferase B [Escherichia coli ATCC 8739]
 gi|170082809|ref|YP_001732129.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188493203|ref|ZP_03000473.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           53638]
 gi|194439994|ref|ZP_03072052.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           101-1]
 gi|238902379|ref|YP_002928175.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           BW2952]
 gi|253771888|ref|YP_003034719.1| 16S rRNA methyltransferase B [Escherichia coli 'BL21-Gold(DE3)pLysS
           AG']
 gi|254038449|ref|ZP_04872505.1| ribosomal RNA small subunit methyltransferase B [Escherichia sp.
           1_1_43]
 gi|254163216|ref|YP_003046324.1| 16S rRNA methyltransferase B [Escherichia coli B str. REL606]
 gi|256025984|ref|ZP_05439849.1| 16S rRNA methyltransferase B [Escherichia sp. 4_1_40B]
 gi|300932181|ref|ZP_07147461.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 187-1]
 gi|300946510|ref|ZP_07160776.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 116-1]
 gi|300955326|ref|ZP_07167708.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 175-1]
 gi|301021178|ref|ZP_07185214.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 196-1]
 gi|301643892|ref|ZP_07243922.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 146-1]
 gi|307139971|ref|ZP_07499327.1| 16S rRNA methyltransferase B [Escherichia coli H736]
 gi|312972450|ref|ZP_07786624.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1827-70]
 gi|331643984|ref|ZP_08345113.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H736]
 gi|1169715|sp|P36929|RSMB_ECOLI RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493247|sp|B1X6E1|RSMB_ECODH RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493248|sp|A8A593|RSMB_ECOHS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493250|sp|B1IQ11|RSMB_ECOLC RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|259495485|sp|C4ZUE3|RSMB_ECOBW RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|49259108|pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With
           S- Adenosylmethionine At 2.1 A Resolution
 gi|49259109|pdb|1SQG|A Chain A, The Crystal Structure Of The E. Coli Fmu Apoenzyme At 1.65
           A Resolution
 gi|1772512|emb|CAA71359.1| sun [Escherichia coli str. K-12 substr. MG1655]
 gi|2367212|gb|AAC76314.1| 16S rRNA m(5)C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. MG1655]
 gi|85676753|dbj|BAE78003.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K12 substr. W3110]
 gi|157068442|gb|ABV07697.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           HS]
 gi|169753404|gb|ACA76103.1| sun protein [Escherichia coli ATCC 8739]
 gi|169890644|gb|ACB04351.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli str.
           K-12 substr. DH10B]
 gi|188488402|gb|EDU63505.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           53638]
 gi|194421046|gb|EDX37075.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           101-1]
 gi|226838955|gb|EEH70978.1| ribosomal RNA small subunit methyltransferase B [Escherichia sp.
           1_1_43]
 gi|238859734|gb|ACR61732.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           BW2952]
 gi|242378815|emb|CAQ33607.1| 16S rRNA m[5]C967 methyltransferase [Escherichia coli BL21(DE3)]
 gi|253322932|gb|ACT27534.1| sun protein [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253975117|gb|ACT40788.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli B
           str. REL606]
 gi|253979273|gb|ACT44943.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           BL21(DE3)]
 gi|260447693|gb|ACX38115.1| sun protein [Escherichia coli DH1]
 gi|299881625|gb|EFI89836.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 196-1]
 gi|300317770|gb|EFJ67554.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 175-1]
 gi|300453816|gb|EFK17436.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 116-1]
 gi|300460065|gb|EFK23558.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 187-1]
 gi|301077735|gb|EFK92541.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 146-1]
 gi|309703700|emb|CBJ03041.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           ETEC H10407]
 gi|310334827|gb|EFQ01032.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           1827-70]
 gi|315137864|dbj|BAJ45023.1| 16S rRNA methyltransferase B [Escherichia coli DH1]
 gi|323934513|gb|EGB30921.1| ribosomal RNA small methyltransferase B [Escherichia coli E1520]
 gi|323939290|gb|EGB35502.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           E482]
 gi|323959561|gb|EGB55214.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H489]
 gi|323970092|gb|EGB65366.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA007]
 gi|331036278|gb|EGI08504.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H736]
 gi|332345236|gb|AEE58570.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           UMNK88]
          Length = 429

 Score =  267 bits (682), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKTGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|229086418|ref|ZP_04218594.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           Rock3-44]
 gi|228696934|gb|EEL49743.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           Rock3-44]
          Length = 431

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 112/448 (25%), Positives = 196/448 (43%), Gaps = 40/448 (8%)

Query: 17  CVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLP 76
            V +       LL+     S    + ++D  L+  IV  T++    +D  L   L   + 
Sbjct: 2   QVEKSGAYSNLLLNNLIEKS---EIDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE 58

Query: 77  RKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE- 134
                ++ LLR+S+ Q++YLD V + AV+  AVE AKR + ++  A +VN +LR + RE 
Sbjct: 59  ---AWVKVLLRLSLYQMIYLDRVPERAVIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREG 114

Query: 135 ------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET 188
                   + ++R+A     PEW  +   + YG E    + +  + P      V  D  T
Sbjct: 115 VPSVEEIQDPVKRLAVAMSHPEWLVQEWVSAYGLETAQKMCEVNMLPPVSAARVNVDKAT 174

Query: 189 WAHKL--------NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
               +         A         ++    ++     F +G   +QD S+ +  +     
Sbjct: 175 VEEAISLLENEGIQAKYGDLSEDAIQIEKGNVAHTEAFQKGFLSIQDESSMLVARALAPA 234

Query: 241 NNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
               VLD CAAPGGKT  +        +V +LD+   ++  ++    RL L   +   +D
Sbjct: 235 EGDKVLDSCAAPGGKTTHIAERLKGTGQVMSLDLHPHKVRLIQQQAKRLGLENVETKALD 294

Query: 298 AFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISF 354
           A     +   + FD +LVDAPCS  G IRR PD+   ++  D  + +  Q  +L +    
Sbjct: 295 ARKVEEHFANESFDKILVDAPCSGFGVIRRKPDIKLGKEKGDSERLSTIQLSILEKVAPL 354

Query: 355 VKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIR 414
           +K GG +V+S C+++K ++E+V+++ L+  P   E     +   +  +       EG ++
Sbjct: 355 LKTGGRLVYSTCTIEKIENEQVIEQFLQEHP---EFEWDTTMKGRMPEKLHPYINEGQVQ 411

Query: 415 ITPDMLEKIDGVSSGMDGFFAVALRRLI 442
           I P             DGF+   LR+ +
Sbjct: 412 ILPHYFA--------TDGFYIACLRKKV 431


>gi|315617091|gb|EFU97701.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           3431]
          Length = 429

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 115/457 (25%), Positives = 213/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERV-LAISDACISPL 176
             L+N +LR+  R++ E            + P W  +RL+  Y K+   +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPKQWQSIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       ++W   L+   +                P  + +LPGF +G   VQDAS
Sbjct: 175 WLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++ 
Sbjct: 354 SEILDAIWPHLKTGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------ELC 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE          ++    +   DGFF   L + 
Sbjct: 400 ETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|197334196|ref|YP_002157328.1| ribosomal RNA small subunit methyltransferase B [Vibrio fischeri
           MJ11]
 gi|197315686|gb|ACH65133.1| ribosomal RNA small subunit methyltransferase B [Vibrio fischeri
           MJ11]
          Length = 451

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 115/452 (25%), Positives = 200/452 (44%), Gaps = 43/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L       A   +  RDQ L++ I    LRFLPR++
Sbjct: 26  MNVRAAAAKVIYQVVDQGHSLSSALPK-----AQSEIKPRDQALLQEICYGVLRFLPRLE 80

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +V   ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  +    L+
Sbjct: 81  SVAQSLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVAETVEGTKNLKGPK-LRGLI 139

Query: 125 NSILRRVSREKIE----LLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N++LR   R + E     +   +G    P W  + L+  Y  +   +  ++   +P+++ 
Sbjct: 140 NAVLRNYQRSQEELDAKSVSHDSGKYGHPGWLLKMLQQAYPEQWETIVEANNSKAPMWLR 199

Query: 180 LT-VKFDIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    +            L +    + +LPGF +G   VQDA+A +
Sbjct: 200 VNSQHHTRDEYIALLEKEEISVTPHSQATDALLLDKARDVYTLPGFEQGWVSVQDAAAQL 259

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
             +     N   +LD CAAPGGKTA          V A+D  + RL+++  NL+RL+L A
Sbjct: 260 SAEYLQPQNGELILDCCAAPGGKTAHILERTQDTNVVAIDCDETRLKRVYENLERLNLKA 319

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q ++ 
Sbjct: 320 QVICGDARHPEEWWKGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDIKALAELQSEIF 379

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +K GG +V++ CS+   ++ + V+  L  +     +   +              
Sbjct: 380 DAMWLQLKSGGTMVYATCSITPLENCDQVKAFLARTSDATLIDNTDPEKP---------- 429

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L++
Sbjct: 430 ---GRQILPG--------EENMDGFYYAVLQK 450


>gi|194435072|ref|ZP_03067310.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1012]
 gi|194416679|gb|EDX32810.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 1012]
 gi|320182714|gb|EFW57600.1| Ribosomal RNA small subunit methyltransferase B [Shigella boydii
           ATCC 9905]
 gi|332086286|gb|EGI91442.1| ribosomal RNA small subunit methyltransferase B [Shigella
           dysenteriae 155-74]
          Length = 429

 Score =  267 bits (681), Expect = 3e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +   +   ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTQHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYANLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 429


>gi|320187010|gb|EFW61722.1| Ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           CDC 796-83]
          Length = 429

 Score =  267 bits (681), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IR HPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRHHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|15803816|ref|NP_289850.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 EDL933]
 gi|168752263|ref|ZP_02777285.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4113]
 gi|168758516|ref|ZP_02783523.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4401]
 gi|168764971|ref|ZP_02789978.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4501]
 gi|168769150|ref|ZP_02794157.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4486]
 gi|168777854|ref|ZP_02802861.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783855|ref|ZP_02808862.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4076]
 gi|168786178|ref|ZP_02811185.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC869]
 gi|168802718|ref|ZP_02827725.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC508]
 gi|195939836|ref|ZP_03085218.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. EC4024]
 gi|208808123|ref|ZP_03250460.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4206]
 gi|208812777|ref|ZP_03254106.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4045]
 gi|208820338|ref|ZP_03260658.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4042]
 gi|209396232|ref|YP_002272745.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4115]
 gi|217326360|ref|ZP_03442444.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. TW14588]
 gi|254795225|ref|YP_003080062.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str.
           TW14359]
 gi|261224593|ref|ZP_05938874.1| 16S rRNA m5C967 methyltransferase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261254513|ref|ZP_05947046.1| 16S rRNA m5C967 methyltransferase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|46396973|sp|Q8XEE5|RSMB_ECO57 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493246|sp|B5YT08|RSMB_ECO5E RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|12517918|gb|AAG58410.1|AE005556_3 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933]
 gi|187767005|gb|EDU30849.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4196]
 gi|188013841|gb|EDU51963.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4113]
 gi|188998877|gb|EDU67863.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4076]
 gi|189354681|gb|EDU73100.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4401]
 gi|189361764|gb|EDU80183.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4486]
 gi|189365121|gb|EDU83537.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4501]
 gi|189373894|gb|EDU92310.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC869]
 gi|189375353|gb|EDU93769.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC508]
 gi|208727924|gb|EDZ77525.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4206]
 gi|208734054|gb|EDZ82741.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4045]
 gi|208740461|gb|EDZ88143.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4042]
 gi|209157632|gb|ACI35065.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC4115]
 gi|209757340|gb|ACI76982.1| RNA methyltransferase [Escherichia coli]
 gi|209757342|gb|ACI76983.1| RNA methyltransferase [Escherichia coli]
 gi|209757346|gb|ACI76985.1| RNA methyltransferase [Escherichia coli]
 gi|217322581|gb|EEC31005.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. TW14588]
 gi|254594625|gb|ACT73986.1| 16S rRNA m5C967 methyltransferase [Escherichia coli O157:H7 str.
           TW14359]
 gi|320191677|gb|EFW66327.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. EC1212]
 gi|320639593|gb|EFX09187.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. G5101]
 gi|326342537|gb|EGD66311.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. 1044]
 gi|326344524|gb|EGD68273.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           O157:H7 str. 1125]
          Length = 429

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       +TW   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDTWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|83945706|ref|ZP_00958051.1| rRNA methyltransferase RsmB [Oceanicaulis alexandrii HTCC2633]
 gi|83850907|gb|EAP88767.1| rRNA methyltransferase RsmB [Oceanicaulis alexandrii HTCC2633]
          Length = 450

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 151/441 (34%), Positives = 235/441 (53%), Gaps = 14/441 (3%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
              +  R V+   +  V+ K + L   L    G   ++ +  RD+   RAI +  +R   
Sbjct: 21  TKNLMPRAVALGAVEGVLAKAVPLDGALA---GRPEWKRMEPRDRAFARAIASAVIRRPI 77

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFA 121
            +DA L  VL   LP ++     +LR   A+ L LD   +A VD  V    +D+    F 
Sbjct: 78  ALDAALMQVLDKPLPDEEVRAHLILRCGAAERLILDTPAHAAVDAWVSLMAQDRHTARFK 137

Query: 122 KLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            L N++LRRV  +  +       +  +P+W  ER    YG+    AI+ A   P  +DLT
Sbjct: 138 NLANAVLRRVVDQGKDAFLDSDPLEDLPDWLAERWVETYGEPTARAIAIARSVPPTLDLT 197

Query: 182 VKF--DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGT 239
            K   D +++A ++ A +L TG IR +    ++  LPGF  G WWVQDA+A++P +L G 
Sbjct: 198 AKPGFDAQSFAEEIGASVLETGTIR-RPDIGAVDGLPGFENGDWWVQDAAAALPAKLLGV 256

Query: 240 LNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAF 299
               +V DLCAAPGGKT QL  +GA V A+D S +RL++L  NL+R  L AE +   D  
Sbjct: 257 KAGETVADLCAAPGGKTLQLAATGASVIAVDASPKRLKRLEDNLERTKLKAEIV-AADVA 315

Query: 300 DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGG 359
           D+   +  DA+L+DAPCS+TGT+RR PD  W +   DI   A  QR+LL    + +KPGG
Sbjct: 316 DWTAPEPLDAILLDAPCSATGTLRRRPDAAWAKQPGDIANLADIQRRLLDASFNQLKPGG 375

Query: 360 IVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDM 419
            +V+  CSL++++ E+ ++  L+ +P    L P+ +       +  A++P+G +R  PD+
Sbjct: 376 RLVYCTCSLEREEGEDQIEAFLKRTP-DARLDPVTADELPG--LKAAITPDGAVRTRPDL 432

Query: 420 LEKIDGVSSGMDGFFAVALRR 440
             +      G+DGF+   + +
Sbjct: 433 WSE----RGGLDGFYIARIVK 449


>gi|291619144|ref|YP_003521886.1| RsmB [Pantoea ananatis LMG 20103]
 gi|291154174|gb|ADD78758.1| RsmB [Pantoea ananatis LMG 20103]
          Length = 433

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 136/461 (29%), Positives = 216/461 (46%), Gaps = 46/461 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSTNLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDAALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+ +L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALIGKLMERPLTGKQRTLHFLIMVGLYQLLYTRVPAHAALAETVAGAEVLKR-ANL 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++      +Q      + P W   RL+  +  E+   I +A      
Sbjct: 115 KGLINGVLRQFQRQQEALLASIQDGPQRHLHPGWLLNRLQQAWP-EQWQQIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W  +L A        +          P  +  LPGF +G + VQD 
Sbjct: 174 MWLRVNRQHHSRDSWLARLTAEEKSAAVAQDVPEALRLTAPAPVTLLPGFEQGWFTVQDL 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LDLCAAPGGKT     I   A+V A+DV  +RL+++  NL RL
Sbjct: 234 SAQRCALLLEPKNGEQILDLCAAPGGKTTHILEIAPEAQVLAVDVDAQRLKRVNENLTRL 293

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMTAE-VKQGDGRTPQQWCDQRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAAL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR++L      +KPGG ++++ CS+   +++  + + +       E V L+ A       
Sbjct: 353 QREILDATWPLLKPGGTMIYATCSVLPDENQRQISEFIERH-ADAEAVSLSGA------- 404

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
                P    ++ P         + G DGFF   L +   P
Sbjct: 405 -----PLNGWQVFP--------EAEGGDGFFYAKLVKRTGP 432


>gi|320666401|gb|EFX33384.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. LSU-61]
          Length = 429

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++ ++  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQVVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYGNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|187732355|ref|YP_001881972.1| 16S rRNA methyltransferase B [Shigella boydii CDC 3083-94]
 gi|224493269|sp|B2U2Q6|RSMB_SHIB3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|187429347|gb|ACD08621.1| ribosomal RNA small subunit methyltransferase B [Shigella boydii
           CDC 3083-94]
          Length = 429

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 210/458 (45%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N+  +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNSEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IR HPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRHHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +    EL    +        
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRT-ADAELCETGAPEQPG--- 408

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                            ++    +   DGFF   L + 
Sbjct: 409 -----------------KQNLPGAEEGDGFFYAKLIKK 429


>gi|281602657|gb|ADA75641.1| Ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           2002017]
          Length = 436

 Score =  266 bits (680), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 8   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 62

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 63  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 121

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I++A      
Sbjct: 122 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYP-EQWQSIAEANNQRPP 180

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 181 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 240

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 241 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRIYDNLKRL 300

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 301 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 359

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 360 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 405

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 406 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 436


>gi|323966250|gb|EGB61685.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           M863]
 gi|327250937|gb|EGE62630.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           STEC_7v]
          Length = 429

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 117/457 (25%), Positives = 212/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ E            + P W  +RL+  Y ++    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       ++W   L+   +                P  +  LPGF EG   VQDAS
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHVLPGFEEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++ 
Sbjct: 354 SEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------ELC 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE          ++    +   DGFF   L + 
Sbjct: 400 ETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|110807136|ref|YP_690656.1| 16S rRNA methyltransferase B [Shigella flexneri 5 str. 8401]
 gi|110616684|gb|ABF05351.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401]
          Length = 436

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 8   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 62

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 63  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 121

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I++A      
Sbjct: 122 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYP-EQWQSIAEANNQRPP 180

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 181 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 240

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 241 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 300

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 301 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 359

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 360 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 405

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 406 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 436


>gi|154497982|ref|ZP_02036360.1| hypothetical protein BACCAP_01962 [Bacteroides capillosus ATCC
           29799]
 gi|150272972|gb|EDN00129.1| hypothetical protein BACCAP_01962 [Bacteroides capillosus ATCC
           29799]
          Length = 447

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 99/457 (21%), Positives = 180/457 (39%), Gaps = 42/457 (9%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR  +   LS   R+       L     +     L  RD  L   +    L+    +D  
Sbjct: 8   ARETALLALSACERQGAWSDGFLKKTLRE---AGLDSRDAALATRLCFGVLQNRLLLDFY 64

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           +     +   + +  ++  LR+ V Q+ ++  +   A V+ +VE  K+  +N   A +VN
Sbjct: 65  IGKFSTTRPEKMEIKVRNALRLGVYQMAFMTKIPHNAAVNESVELTKKHCKNPRAAGMVN 124

Query: 126 SILRRVSREKIE--------LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
            +LR VSR              + ++     P W         G E   A+ +A      
Sbjct: 125 GVLRNVSRNIDRLPVIESGSREEYLSIRYSHPLWLVREFTALLGSEEAEALLEADNGQPP 184

Query: 178 IDLTVKFDIETWAHKLNAVM---------LPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           I   +     T    L  +                 +     ++  L  F EG++++QD 
Sbjct: 185 ITAQINTCRATMEQTLERLAEAGVEAQPHPWLADCLVLSGTGNLEHLTAFREGLFYIQDP 244

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTA---QLIVSGAKVTALDVSKRRLEKLRCNLDR 285
           +A + V++      + VLD CAAPGGKT      +    ++ + D+   + + ++   +R
Sbjct: 245 AARLAVEVADPKPGMKVLDACAAPGGKTFASAIRMGGEGEIQSCDIHAHKEKLIQAGAER 304

Query: 286 LHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L         MD   + P  +  FD V+ D PCS  G IR+ PD+ + +D + +      
Sbjct: 305 LGFNCIKTAVMDGKKHRPAFENAFDVVIADVPCSGLGIIRKKPDIRY-KDPEPLEGLPAV 363

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q  +L    ++VKPGG+++++ C+L ++++ +VV+  L  +          +     +  
Sbjct: 364 QSAILDNVATYVKPGGVLLYATCTLLERENGDVVRGFLDRNKDF-------TLEKFQLPE 416

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +  +  G     P           G DGFF   LRR
Sbjct: 417 PLGRADNGMFTFWPQ--------RHGTDGFFIAKLRR 445


>gi|260588062|ref|ZP_05853975.1| ribosomal RNA small subunit methyltransferase B [Blautia hansenii
           DSM 20583]
 gi|260541589|gb|EEX22158.1| ribosomal RNA small subunit methyltransferase B [Blautia hansenii
           DSM 20583]
          Length = 454

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 105/466 (22%), Positives = 214/466 (45%), Gaps = 38/466 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M + +N R +   +L  + ++      ++        ++ L ++++  +  +   TL + 
Sbjct: 1   MVNKVNLRELVLGILLEINKEGQHSHLVIRSTLE--KYQYLEKQERAFLTRVCEGTLEYK 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
            R+D +LD      + + K  ++++LR SV Q+LY+D V D AV D AV+ A++ K   +
Sbjct: 59  LRLDYILDQYSSVPVEKMKPVIREILRSSVYQLLYMDNVPDSAVCDEAVKLARK-KGFYN 117

Query: 120 FAKLVNSILRRVSREKIELLQ--------RIAGISIIPEWFKERLENFYGKERVLAISDA 171
               VN +LR+V+RE   +           ++ +  +P+W  E+    YG E+   + +A
Sbjct: 118 LTGFVNGVLRKVAREYGSIHFPEKDQPVEYLSVLYSMPKWLVEKFLGEYGFEKTEKMLEA 177

Query: 172 CISPLYIDLTVKFDIETWAHKLNAV---------MLPTGGIRLKELPESIVSLPGFAEGV 222
            ++     + ++  +      L+++                   +  + + +L  F  G 
Sbjct: 178 FLTEKPTTIRIRQHLVDKGAVLDSLKRQKVTVEPAPYVENAYYIKDYDYLPALEAFRMGN 237

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKL 279
             VQD S+ +  ++        V+DLCAAPGGKT  +        ++ A D+S+ + + +
Sbjct: 238 IQVQDVSSMLVGEVADPKEGDYVIDLCAAPGGKTLCIADKLKGTGRIDARDISRTKTDLI 297

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
           R N  R +     + E DA     +  +  D ++ D PCS  G I +  D+ +    + I
Sbjct: 298 RENAIRQNFLNVVVTEKDATQLDSESFEKADILIADVPCSGLGVIGKKTDIKYNITQNGI 357

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            +    QRK+L Q  ++VKPGG +++S C+++K+++ E V+  + + P  +E +      
Sbjct: 358 AELVNLQRKILEQASTYVKPGGTLIYSTCTINKEENIENVRWFVENYPYELESID----D 413

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
           +   ++    + EG++++               DGFF   L+R  +
Sbjct: 414 YLCEELRSDTTKEGYLQLL--------SGVHDCDGFFIARLKRKTE 451


>gi|224493306|sp|Q0T014|RSMB_SHIF8 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
          Length = 429

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I++A      
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYP-EQWQSIAEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 429


>gi|30064610|ref|NP_838781.1| 16S rRNA methyltransferase B [Shigella flexneri 2a str. 2457T]
 gi|56480310|ref|NP_709076.2| 16S rRNA methyltransferase B [Shigella flexneri 2a str. 301]
 gi|46396790|sp|Q7UBD3|RSMB_SHIFL RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|30042869|gb|AAP18592.1| hypothetical protein S3545 [Shigella flexneri 2a str. 2457T]
 gi|56383861|gb|AAN44783.2| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301]
 gi|313648789|gb|EFS13229.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           2a str. 2457T]
 gi|332749603|gb|EGJ80020.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-671]
 gi|332749746|gb|EGJ80161.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           4343-70]
 gi|332766528|gb|EGJ96735.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           2930-71]
 gi|332998314|gb|EGK17914.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-218]
 gi|333012367|gb|EGK31748.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-304]
          Length = 429

 Score =  266 bits (680), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I++A      
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYP-EQWQSIAEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRIYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 429


>gi|170684100|ref|YP_001745551.1| 16S rRNA methyltransferase B [Escherichia coli SMS-3-5]
 gi|224493251|sp|B1LGP5|RSMB_ECOSM RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|170521818|gb|ACB19996.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           SMS-3-5]
          Length = 429

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       + W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDRWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|320199476|gb|EFW74066.1| Ribosomal RNA small subunit methyltransferase B [Escherichia coli
           EC4100B]
          Length = 429

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LP F +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPSFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|327395473|dbj|BAK12895.1| ribosomal RNA small subunit methyltransferase B RsmB [Pantoea
           ananatis AJ13355]
          Length = 433

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 136/461 (29%), Positives = 216/461 (46%), Gaps = 46/461 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M    N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSTNLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDAALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+ +L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALIGKLMERPLTGKQRTLHFLIMVGLYQLLYTRVPAHAALAETVAGAEVLKR-ANL 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++      +Q      + P W   RL+  +  E+   I +A      
Sbjct: 115 KGLINGVLRQFQRQQEALLASIQDGPQRHLHPGWLLNRLQQAWP-EQWQQIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W  +L A        +          P  +  LPGF +G + VQD 
Sbjct: 174 MWLRVNRQHHSRDSWLARLIAEEKSAAVAQDVPEALRLTAPAPVTLLPGFEQGWFTVQDL 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LDLCAAPGGKT     I   A+V A+DV  +RL+++  NL RL
Sbjct: 234 SAQRCALLLEPKNGEQILDLCAAPGGKTTHILEIAPEAQVLAVDVDAQRLKRVNENLTRL 293

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + AE + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMTAE-VKQGDGRTPQQWCDQRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAAL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR++L      +KPGG ++++ CS+   +++  + + +       E V L+ A       
Sbjct: 353 QREILDATWPLLKPGGTMIYATCSVLPDENQRQISEFIERH-ADAEAVSLSGA------- 404

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
                P    ++ P         + G DGFF   L +   P
Sbjct: 405 -----PLNGWQVFP--------EAEGGDGFFYAKLVKRTGP 432


>gi|157372746|ref|YP_001480735.1| 16S rRNA methyltransferase B [Serratia proteamaculans 568]
 gi|224493268|sp|A8GKG7|RSMB_SERP5 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|157324510|gb|ABV43607.1| sun protein [Serratia proteamaculans 568]
          Length = 429

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 129/457 (28%), Positives = 219/457 (47%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ +  SL+ +L      S  + +S +D+ L++ +   TLR L
Sbjct: 1   MKNNYNLRSIAAIAIGQVLDQGQSLSTVLP-----SLQKTISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+ +L  LL V + Q+LY  +  +AV+   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPMTGKQRTLHYLLMVGLYQLLYTRIPAHAVLAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ ELLQR A      + P W  +R++  Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLQRAANNDSRYLHPSWLLKRIQQAYPAQWEQIIDANNQKPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    E +   +    +                P ++  LPGFA+G   VQDAS
Sbjct: 175 WLRVNRLHHTREDYLQLMEQAGIAAEPHAEYRDAVRLLAPCAVTDLPGFADGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++     A V A+D+ ++RL++++ NL RL 
Sbjct: 235 AQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLKRVKENLQRLR 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+AE + + D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHAE-VKQGDGRTPQQWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+   ++ E V   L+       LV   +         
Sbjct: 354 AEIIEAIWPHLKSGGVMVYATCSILPAENAEQVSAFLQRH-ADARLVETGNQQQPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                            +        DGFF   L ++
Sbjct: 409 ----------------RQNLPHPEDGDGFFYAKLIKM 429


>gi|59713152|ref|YP_205928.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Vibrio fischeri
           ES114]
 gi|59481253|gb|AAW87040.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Vibrio fischeri
           ES114]
          Length = 426

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 120/453 (26%), Positives = 200/453 (44%), Gaps = 45/453 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L       A   +  RDQ L++ I    LRFLPR++
Sbjct: 1   MNVRAAAAKVIYQVVDQGHSLSSALPK-----AQSEIKPRDQALLQEICYGVLRFLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +V   ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  +    L+
Sbjct: 56  SVAQSLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVAETVEGTKNLKGPK-LRGLI 114

Query: 125 NSILRRVSREKIE----LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           N++LR   R + E     +   +G    P W  + L+  Y  E+   I +A  S   + L
Sbjct: 115 NAVLRNYQRSQEELDAKSVSHDSGKYGHPGWLLKMLQQAYP-EQWENIVEANNSKAPMWL 173

Query: 181 TV---KFDIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWWVQDASAS 231
            V       + +   L    +            L +    + +LPGF +G   VQDA+A 
Sbjct: 174 RVNSQHHTRDEYIALLEKEEISVTPHSQATDALLLDKARDVYTLPGFEQGWVSVQDAAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
           +  +     N   +LD CAAPGGKTA          V A+D  + RL+++  NL+RL+L 
Sbjct: 234 LSAEYLQPQNGELILDCCAAPGGKTAHILERTQDTSVVAIDCDETRLKRVYENLERLNLK 293

Query: 290 A--EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
           A           ++   + FD +L+DAPCS+TG IRRHPD+ W R ++DI   A  Q ++
Sbjct: 294 AQVICGDARHPEEWWKGEQFDRILLDAPCSATGVIRRHPDIKWLRRSEDIKALAELQSEI 353

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
                  +K GG +V++ CS+   ++ + V+  L  +     +   +             
Sbjct: 354 FDAMWLQLKSGGTMVYATCSITPLENCDQVKAFLARTSDATLIDNTDPEKP--------- 404

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                 +I P            MDGF+   L++
Sbjct: 405 ----GRQILPG--------EENMDGFYYAVLQK 425


>gi|27364478|ref|NP_760006.1| 16S rRNA methyltransferase B [Vibrio vulnificus CMCP6]
 gi|46396909|sp|Q8DDE5|RSMB_VIBVU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|27360597|gb|AAO09533.1| ribosomal RNA small subunit methyltransferase B [Vibrio vulnificus
           CMCP6]
          Length = 426

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 121/454 (26%), Positives = 209/454 (46%), Gaps = 44/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ +  SL+  L       A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYQVVDRGNSLSTALPE-----AQQSIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ ++ +  +A V   VE A+  K  R    L+
Sbjct: 56  SIAGKLMDKPLKGKQRVFHHLILVGLYQLGHMRIPAHAAVGETVEGAQALKGPR-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N++LR   RE+       +   AG  + P W  + L++ Y  + + +  ++   +P+++ 
Sbjct: 115 NAVLRNYQREQQALDEFSVSHNAGKYVHPSWLLKILQDAYPEQWQTIVEANNNKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +     D + +   L    + +              P  + SLPGF +G   VQDA+A +
Sbjct: 175 VNHAHHDRDEYLQLLKNANIDSTLHSEAMDAIKLAAPCDVHSLPGFEQGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
                   +   +LD CAAPGGKTA     VS  +V ALD  ++RL+++  NL RL+L A
Sbjct: 235 SFNYLQPKDGELILDCCAAPGGKTAHILERVSAREVVALDCDEQRLKRVTENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +   +   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q ++ 
Sbjct: 295 KVICGDARNPEQWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRAEDITALAQLQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+   ++ E V+  L  +                  +  +  
Sbjct: 355 DAMWAQLKPGGTLVYATCSITPMENVEQVKAFLARTSAA--------------QLVGSER 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                +I P            MDGF+   L +  
Sbjct: 401 ENPGRQIIPG--------EEDMDGFYYAVLVKQA 426


>gi|260774556|ref|ZP_05883469.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           metschnikovii CIP 69.14]
 gi|260610462|gb|EEX35668.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           metschnikovii CIP 69.14]
          Length = 426

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 121/454 (26%), Positives = 204/454 (44%), Gaps = 44/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSHALP-----AAQKTIRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++ + L  KK     L+ V + Q+ Y+ +  +A V   VE A +       + L+
Sbjct: 56  SIAGQLMDNPLKGKKRVFHHLILVGLYQLSYMRIPSHAAVAETVE-ATKTLRGPSLSGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC-ISPLYID 179
           N++LR   R++       +   AG+   P W  + L+  Y ++    I      +P+++ 
Sbjct: 115 NAVLRSYLRDQEALDAFAVSHNAGLYAHPSWLLKLLQEAYPQQWQTIIEANNSKAPMWLR 174

Query: 180 LT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       E +   L+   +                P  +  LPGF  G   VQDA+A +
Sbjct: 175 VNRQHHSREAYLALLDNEQIEYTVHPQAADAIKLASPCDVTLLPGFDRGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA         +V A+D    RLE++  NL+RL L A
Sbjct: 235 AIDYLQPQDGELILDCCAAPGGKTAHILEHTQDTEVVAIDSDAARLERVYDNLERLQLRA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R   DI   A  Q ++L
Sbjct: 295 DVICGDARYPEEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRASDIEALAELQSEIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +K GG +V++ CS+  Q++ + ++  L  +P   +L+  +              
Sbjct: 355 DAMWKQLKIGGTLVYATCSITPQENSQQIKAFLARTP-KAQLIDSDPEQP---------- 403

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
                +I P            MDGF+   LR+  
Sbjct: 404 ---GRQILPG--------EQDMDGFYYAVLRKQA 426


>gi|26249873|ref|NP_755913.1| 16S rRNA methyltransferase B [Escherichia coli CFT073]
 gi|227883420|ref|ZP_04001225.1| 16S rRNA methyltransferase B [Escherichia coli 83972]
 gi|300979825|ref|ZP_07174727.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 45-1]
 gi|301046059|ref|ZP_07193238.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 185-1]
 gi|46396925|sp|Q8FD12|RSMB_ECOL6 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|26110301|gb|AAN82487.1|AE016767_247 SUN protein [Escherichia coli CFT073]
 gi|227839564|gb|EEJ50030.1| 16S rRNA methyltransferase B [Escherichia coli 83972]
 gi|300301944|gb|EFJ58329.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 185-1]
 gi|300409431|gb|EFJ92969.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 45-1]
 gi|307555376|gb|ADN48151.1| 16S rRNA m5C967 methyltransferase [Escherichia coli ABU 83972]
 gi|315292336|gb|EFU51688.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 153-1]
          Length = 429

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 120/458 (26%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAIEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            + D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQSDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQDELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  + +LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVQLETPAPVHALPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVLAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L    S +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWSHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|227115242|ref|ZP_03828898.1| 16S rRNA methyltransferase B [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 429

 Score =  266 bits (679), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 122/456 (26%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +       R +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVY-----QREVSDKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE     K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGTVSLKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERV-LAISDACISPL 176
             L+N +    +R   E I+     +   + P W   R+E  Y      +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELIQREATHSSHYLHPSWLLTRIERAYPHHWQNIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    E + + L+   +                P ++  LPGF++G   VQDAS
Sbjct: 175 WLRVNRLHHTREAYLNLLDQEGIEAFPHAEYNDAIRLAAPCAVDQLPGFSQGWATVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V      +   +LDLCAAPGGKT  ++     + V A+DV + RL +++ NL RL 
Sbjct: 235 AQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDVDETRLGRVKENLLRLQ 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++AE + + D      +C  ++FD VL+DAPCS+TG IRRHPD+ W R   DI +    Q
Sbjct: 295 MHAE-VKQGDGRYPDSWCEGRVFDRVLLDAPCSATGVIRRHPDIKWLRRDRDIEELVALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           +++L      +K GG +V++ CS+  Q++ + V   L        LV   +         
Sbjct: 354 KEILDAIWPHLKTGGTLVYATCSILPQENTQQVADFLTRH-TDATLVDTGTREMPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                   I++ P         + G DGFF   L +
Sbjct: 409 --------IQMLPH--------ADGGDGFFYAKLVK 428


>gi|15833408|ref|NP_312181.1| 16S rRNA methyltransferase B [Escherichia coli O157:H7 str. Sakai]
 gi|13363627|dbj|BAB37577.1| RNA methyltransferase [Escherichia coli O157:H7 str. Sakai]
          Length = 429

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       +TW   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDTWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|238752659|ref|ZP_04614130.1| Ribosomal RNA small subunit methyltransferase B [Yersinia rohdei
           ATCC 43380]
 gi|238709086|gb|EEQ01333.1| Ribosomal RNA small subunit methyltransferase B [Yersinia rohdei
           ATCC 43380]
          Length = 429

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 122/456 (26%), Positives = 215/456 (47%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPGL-----NKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNESHYLHPSWLLARIKQAYPDQWQQILEANNQKPPM 174

Query: 177 YIDL-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +      +         P S+  LPGF  G   VQDAS
Sbjct: 175 WLRVSRLHHSRSEYLELLKQADIEALPHDVYPDAVRLITPCSVNDLPGFDLGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 235 AQGCVDLLSPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLK 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A D+   D     ++C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHA-DVRVGDGRTPDEWCGNQQFDRILLDAPCSATGVIRRHPDIKWLRRNSDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+      ELV   +         
Sbjct: 354 SEIIEAIWPKLKKGGVMVYATCSILPEENQQQIAAFLQRH-SEAELVETGTTSAPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                            +        DGFF   L +
Sbjct: 409 ----------------RQNLPHPEDGDGFFYAKLIK 428


>gi|291284647|ref|YP_003501465.1| Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Escherichia coli
           O55:H7 str. CB9615]
 gi|209757338|gb|ACI76981.1| RNA methyltransferase [Escherichia coli]
 gi|209757344|gb|ACI76984.1| RNA methyltransferase [Escherichia coli]
 gi|290764520|gb|ADD58481.1| Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Escherichia coli
           O55:H7 str. CB9615]
 gi|320645091|gb|EFX14107.1| 16S rRNA methyltransferase B [Escherichia coli O157:H- str. 493-89]
 gi|320650402|gb|EFX18868.1| 16S rRNA methyltransferase B [Escherichia coli O157:H- str. H 2687]
 gi|320661379|gb|EFX28794.1| 16S rRNA methyltransferase B [Escherichia coli O55:H7 str. USDA
           5905]
          Length = 429

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|238754203|ref|ZP_04615561.1| Ribosomal RNA small subunit methyltransferase B [Yersinia ruckeri
           ATCC 29473]
 gi|238707699|gb|EEQ00059.1| Ribosomal RNA small subunit methyltransferase B [Yersinia ruckeri
           ATCC 29473]
          Length = 429

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 113/455 (24%), Positives = 203/455 (44%), Gaps = 42/455 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ K  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDKGQSLSTVLPGL-----QKSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVE--QAKRDKENR 118
           P+++  +  ++   +  K+     L+ V + Q+LY  +  +A +   VE   A +  + +
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLLYTRIPPHAALAETVEGTVALKRPQLK 115

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPLY 177
                V    +R   + +E         + P W   R++  Y  +    I  +    P++
Sbjct: 116 GLVNGVLRQFQRQQVDLLERAANNESRYLHPSWLLARIKKAYPDKWQQIIDANNQKPPMW 175

Query: 178 IDL-TVKFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDASA 230
           + +  +      +   +    +                P ++  LPGF +G   VQDASA
Sbjct: 176 LRVSRLHHSRADYLELMKQAGIEAEPHTEYSDAVRLITPCAVNDLPGFTQGWVTVQDASA 235

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLHL 288
              V L    N   +LDLCAAPGGKT  ++     + V A+D+ ++RL +++ NL RL L
Sbjct: 236 QGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKSHVLAVDIDEQRLSRVKENLQRLQL 295

Query: 289 YAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           +A  +   D      +C  +LFD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q 
Sbjct: 296 HAT-VTVGDGRAPDKWCGNQLFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAQLQS 354

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L      +K  G++V++ CS+  +++++ +   L+  P    +     A         
Sbjct: 355 EILEAIWPKLKKDGVMVYATCSILPEENQQQIANFLQRHPEARLVETGTPAQPG------ 408

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                          ++        DGFF   L +
Sbjct: 409 ---------------KQNLPHPEDGDGFFYAKLIK 428


>gi|291549490|emb|CBL25752.1| ribosomal RNA small subunit methyltransferase RsmB [Ruminococcus
           torques L2-14]
          Length = 463

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 113/477 (23%), Positives = 196/477 (41%), Gaps = 49/477 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R V   +L  +         +L      S ++ L +R++  +  +V  TL  +
Sbjct: 1   MGKQINEREVVLEILMEITENGAYSHKILGDVL--SKYQYLEKRERAFITRVVEGTLEHM 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID +L+ +  + + + K  ++ LLR SV Q+ Y+D V D+AV   AV+ A R K    
Sbjct: 59  IEIDYILNQISKTKVKKMKPVIRNLLRSSVYQLKYMDSVPDHAVCSEAVKLAVR-KGFSG 117

Query: 120 FAKLVNSILRRVSREKIELLQRI------AGISIIPEWFKERLENFYGKERVLAISDACI 173
               VN +LR V R+  E+          +    +PEW     +  YG+E    ++    
Sbjct: 118 LRGYVNGVLRNVVRKMDEIEYPKEDVQRLSVKYSVPEWILSLWKKEYGEEITEKMAADFQ 177

Query: 174 SPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVWW 224
               I +    +    E    KL A                    + +  L  F EG++ 
Sbjct: 178 KEKPITIRCCMNRVTPEVLKEKLEAEGAKVEAHPYLPYAFYLSDYDYLEGLESFQEGLFA 237

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ-----------------LIVSGAKVT 267
           VQD S+    +L        V+D+CAAPGGK+                         +V 
Sbjct: 238 VQDISSMFVGELADLKAGDHVIDVCAAPGGKSLHVAEKLQLADEVAARENGTEEKTGRVE 297

Query: 268 ALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRH 325
           A D+++ + + +  N+DR  L     +  DA  +        D V+ D PCS  G + + 
Sbjct: 298 ARDLTEYKTDLIWQNIDRSGLGNICAVCKDASVFDEYDKETADLVIADLPCSGLGVLGKK 357

Query: 326 PDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           PD+ +    +D+ + A  QRK+L    + VK GG +++S C+++  ++ + V   L+  P
Sbjct: 358 PDLKYRVQPEDLEELADLQRKILTCAQAIVKDGGTLLYSTCTVNPGENMDNVHWFLKEYP 417

Query: 386 IPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
              EL  +     K  ++   +  +G I+  P +           DGFF   L++  
Sbjct: 418 -QFELDDITENLCK--ELRSDVIEKGCIQFFPGV--------HDCDGFFIARLKKKA 463


>gi|162420599|ref|YP_001605204.1| 16S rRNA methyltransferase B [Yersinia pestis Angola]
 gi|162353414|gb|ABX87362.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           Angola]
          Length = 435

 Score =  266 bits (679), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 114/457 (24%), Positives = 207/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 7   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPEL-----QKNISDKDRALLQELCFGTLRVL 61

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 62  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ-L 120

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++E            + P W   R++  Y  +    +  +    P+
Sbjct: 121 KGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPPM 180

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +         +   L    +      +         P ++  LPGF  G   VQDAS
Sbjct: 181 WLRVNRQHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPGFELGWVTVQDAS 240

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 241 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLQ 300

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 301 LQAV-VRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDISELAQLQ 359

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+  P             ++    
Sbjct: 360 SEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP-------------EAQLTE 406

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +     +  P             DGFF   + + 
Sbjct: 407 TGTTAAPGKQNLPH--------PEDGDGFFYAKIIKK 435


>gi|45434953|gb|AAS60514.1| tRNA and rRNA cytosine-C5-methylases [Yersinia pestis biovar
           Microtus str. 91001]
          Length = 435

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 114/457 (24%), Positives = 208/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 7   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPEL-----QKNISDKDRALLQELCFGTLRVL 61

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 62  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ-L 120

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++E            + P W   R++  Y  +    +  +    P+
Sbjct: 121 KGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPPM 180

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +      +         P ++  LPGF  G   VQDAS
Sbjct: 181 WLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPGFELGWVTVQDAS 240

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 241 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLQ 300

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 301 LQAV-VRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDISELAQLQ 359

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+  P             ++    
Sbjct: 360 SEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP-------------EAQLTE 406

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +     +  P             DGFF   + + 
Sbjct: 407 TGTTAAPGKQNLPH--------PEDGDGFFYAKIIKK 435


>gi|332085437|gb|EGI90603.1| ribosomal RNA small subunit methyltransferase B [Shigella boydii
           5216-82]
          Length = 429

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 116/458 (25%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTHIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +   +   ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTQHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYANLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG +RRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVVRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 429


>gi|224493303|sp|A9R925|RSMB_YERPG RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
          Length = 429

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 114/457 (24%), Positives = 207/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPEL-----QKNISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++E            + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +         +   L    +      +         P ++  LPGF  G   VQDAS
Sbjct: 175 WLRVNRQHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPGFELGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 235 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLQ 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LQAV-VRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDISELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+  P             ++    
Sbjct: 354 SEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP-------------EAQLTE 400

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +     +  P             DGFF   + + 
Sbjct: 401 TGTTAAPGKQNLPH--------PEDGDGFFYAKIIKK 429


>gi|304399258|ref|ZP_07381124.1| sun protein [Pantoea sp. aB]
 gi|304353184|gb|EFM17565.1| sun protein [Pantoea sp. aB]
          Length = 433

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 134/458 (29%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSINLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDSALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+  L  L+ V + Q+ Y  V  +A +   V  A+  K     
Sbjct: 56  PQLEALIGKLMARPLTGKQRVLHYLIMVGLYQLEYTRVPAHAALAETVAGAEVLKRT-SL 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E    +Q      + P W  +RL++ +  E+   I +A      
Sbjct: 115 KGLLNGVLRQFQRQREELLASIQDGPQRYLHPGWLLKRLQHAWP-EQWQQIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V     + + W   L                     P  +  LPGF +G   VQD 
Sbjct: 174 MWLRVNQQHHERDAWLALLTESGRNAQPADDVPDALRLDAPAPVSQLPGFGQGWVTVQDL 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA     L    N   +LDLCAAPGGKT     I   A+V A+DV  +RL+++  NL RL
Sbjct: 234 SAQRCALLLEPQNGEQILDLCAAPGGKTTHILEIAPEAEVMAVDVDAQRLKRVEENLQRL 293

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A D+ + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKA-DVKQGDGRTPQQWCGDRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAKL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +KPGG ++++ CS+  +++ + +   L+      + VPL  A       
Sbjct: 353 QSEILNAVWPHLKPGGTLIYATCSILPEENHQQIDAFLQRQH-DAQAVPLRDA------- 404

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                P   +++ P         + G DGFF   L + 
Sbjct: 405 -----PANGLQVFPQ--------AEGGDGFFYAKLIKK 429


>gi|22127891|ref|NP_671314.1| 16S rRNA methyltransferase B [Yersinia pestis KIM 10]
 gi|51597957|ref|YP_072148.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis IP 32953]
 gi|108809224|ref|YP_653140.1| 16S rRNA methyltransferase B [Yersinia pestis Antiqua]
 gi|108813989|ref|YP_649756.1| 16S rRNA methyltransferase B [Yersinia pestis Nepal516]
 gi|145597481|ref|YP_001161556.1| 16S rRNA methyltransferase B [Yersinia pestis Pestoides F]
 gi|150260712|ref|ZP_01917440.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis CA88-4125]
 gi|153947745|ref|YP_001402832.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis IP 31758]
 gi|161511468|ref|NP_991637.2| 16S rRNA methyltransferase B [Yersinia pestis biovar Microtus str.
           91001]
 gi|165927896|ref|ZP_02223728.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|166010534|ref|ZP_02231432.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|167468244|ref|ZP_02332948.1| 16S rRNA methyltransferase B [Yersinia pestis FV-1]
 gi|170022575|ref|YP_001719080.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis YPIII]
 gi|186897153|ref|YP_001874265.1| 16S rRNA methyltransferase B [Yersinia pseudotuberculosis PB1/+]
 gi|218927446|ref|YP_002345321.1| 16S rRNA methyltransferase B [Yersinia pestis CO92]
 gi|229836278|ref|ZP_04456445.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Pestoides A]
 gi|229840098|ref|ZP_04460257.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229842180|ref|ZP_04462335.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229904520|ref|ZP_04519631.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Nepal516]
 gi|46396984|sp|Q8ZJ81|RSMB_YERPE RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|81638254|sp|Q664V2|RSMB_YERPS RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|122979388|sp|Q1C2X7|RSMB_YERPA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|122979880|sp|Q1CCX4|RSMB_YERPN RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493292|sp|A7FNK4|RSMB_YERP3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493293|sp|B2K506|RSMB_YERPB RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493294|sp|A4TH21|RSMB_YERPP RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|224493295|sp|B1JJH6|RSMB_YERPY RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|21961028|gb|AAM87565.1|AE014004_3 hypothetical protein y4021 [Yersinia pestis KIM 10]
 gi|51591239|emb|CAH22905.1| conserved hypothetical protein [Yersinia pseudotuberculosis IP
           32953]
 gi|108777637|gb|ABG20156.1| hypothetical protein YPN_3829 [Yersinia pestis Nepal516]
 gi|108781137|gb|ABG15195.1| hypothetical protein YPA_3233 [Yersinia pestis Antiqua]
 gi|115346057|emb|CAL18923.1| conserved hypothetical protein [Yersinia pestis CO92]
 gi|145209177|gb|ABP38584.1| hypothetical protein YPDSF_0162 [Yersinia pestis Pestoides F]
 gi|149290120|gb|EDM40197.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis CA88-4125]
 gi|152959240|gb|ABS46701.1| ribosomal RNA small subunit methyltransferase B [Yersinia
           pseudotuberculosis IP 31758]
 gi|165920172|gb|EDR37473.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165990624|gb|EDR42925.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|169749109|gb|ACA66627.1| sun protein [Yersinia pseudotuberculosis YPIII]
 gi|186700179|gb|ACC90808.1| sun protein [Yersinia pseudotuberculosis PB1/+]
 gi|229678638|gb|EEO74743.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Nepal516]
 gi|229690490|gb|EEO82544.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. India 195]
 gi|229696464|gb|EEO86511.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis biovar
           Orientalis str. PEXU2]
 gi|229706346|gb|EEO92353.1| 16S rRNA m5C967 methyltransferase [Yersinia pestis Pestoides A]
 gi|320013373|gb|ADV96944.1| 16S rRNA methyltransferase B [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 429

 Score =  265 bits (678), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 114/457 (24%), Positives = 208/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPEL-----QKNISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++E            + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +      +         P ++  LPGF  G   VQDAS
Sbjct: 175 WLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPGFELGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 235 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLQ 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LQAV-VRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDISELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+  P             ++    
Sbjct: 354 SEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP-------------EAQLTE 400

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +     +  P             DGFF   + + 
Sbjct: 401 TGTTAAPGKQNLPH--------PEDGDGFFYAKIIKK 429


>gi|157959859|ref|YP_001499893.1| sun protein [Shewanella pealeana ATCC 700345]
 gi|157844859|gb|ABV85358.1| sun protein [Shewanella pealeana ATCC 700345]
          Length = 426

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 123/448 (27%), Positives = 201/448 (44%), Gaps = 35/448 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ ++  V+ K ISL+  L  +         S +D+ L+  +    +R LP++D
Sbjct: 1   MNLRALAAKVVFQVLEKGISLSVALPDQQRHLD----SGKDKALLAELCYGVMRHLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   +   +  K+  + QLL +   Q+ +  +  +A +    E A R  +     K+V
Sbjct: 57  KQVSDCMSKQMKGKQRIVHQLLLIGCYQLYFTRIPSHAAISETAE-ACRQLKFEGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAGI-SIIPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++  L      +    P W  +RL++ Y       I  +   P     +  
Sbjct: 116 NGVLRNIQRQEKPLATDNDTLAYNTPAWIIKRLKDAYPDNWQSVIEQSHERPPMWLRNNQ 175

Query: 182 VKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                ET+   L      A    +    L   P  ++ LPGF  G   VQD +A     L
Sbjct: 176 QSQTRETYLLALAGLEIEAQAGNSPDSILLSSPRDVMQLPGFETGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDII 294
                +  VLD CAAPGGKT     +    K+ A+D   +RLE+++ NLDRL L AE + 
Sbjct: 236 LAPQGDELVLDACAAPGGKTCHLLELAPNIKLVAVDFDAKRLERVQQNLDRLSLKAELVH 295

Query: 295 --EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
               +   +     FD +L+DAPCS+TG IRRHPD+ W R  +DI + A  Q ++     
Sbjct: 296 GDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNNDIEELAQLQSQIFDHCW 355

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++F+ CS+  Q++++ V   L  +P    LVP+                   
Sbjct: 356 KWLKPGGTLLFATCSILPQENKDQVSAFLARTPDAT-LVPIEEQANPD------------ 402

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRR 440
                D+  +I      MDGF+   L +
Sbjct: 403 -----DIGWQIVPGQDNMDGFYYARLVK 425


>gi|238788880|ref|ZP_04632670.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           frederiksenii ATCC 33641]
 gi|238722907|gb|EEQ14557.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           frederiksenii ATCC 33641]
          Length = 429

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 120/456 (26%), Positives = 212/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L   +       +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPGLHK-----SISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKQTYPAQWQQILDANNQKPPM 174

Query: 177 YIDL-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +      +         P ++  LPGF  G   VQDAS
Sbjct: 175 WLRVSRLHHSRNEYLDLLKQANIDALPHDVYPDAVRLITPCAVSDLPGFELGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++       V A+D+ ++RL +++ NL RL 
Sbjct: 235 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKTHVLAVDIDEQRLNRVKENLQRLK 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LNAV-VRVGDGRTPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAKLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+      ELV   +A        
Sbjct: 354 SEIIEAIWPKLKKGGVMVYATCSILPEENQQQITAFLQRH-DEAELVETGTASAPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                            +        DGFF   L +
Sbjct: 409 ----------------RQNLPHPEDGDGFFYAKLIK 428


>gi|253682518|ref|ZP_04863315.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum D str. 1873]
 gi|253562230|gb|EES91682.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum D str. 1873]
          Length = 443

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 113/457 (24%), Positives = 204/457 (44%), Gaps = 40/457 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR +   +L  V  K      +L     +   + ++++D+ L+  IV  T+++   IDA
Sbjct: 3   NARKICIDILEMVFNKNAYSNIVLRQSLNN---QKINEKDKGLITEIVYGTIKYKYTIDA 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L+  L          +  +LR+++ QI YLD + ++A V+ AV  AK+ K  R  +KLV
Sbjct: 60  ILNTYLKKGTKSVDSYILNILRITIYQIKYLDKIPNFAAVNEAVNIAKKHKSIRE-SKLV 118

Query: 125 NSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N +LR   R   ++                  +W  +   N Y +E    I +       
Sbjct: 119 NGVLRNYLRNLDKVYYNKNSVVERLCFEYSCEKWLVKMFINQYNEEITEKILNGLNERPA 178

Query: 178 IDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V      +    N                   +    +SI S P F +G   VQD 
Sbjct: 179 VTVRVNNLKTDYDEAFNKLEEYGYSIEEGYVCPEAIIINKGKSIESNPLFEDGKVTVQDE 238

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA +            VLDLC+APGGKT  +   + +  KV A D+ + +L  ++ N  R
Sbjct: 239 SAMLVAATMDIKEGSLVLDLCSAPGGKTTHISEIMNNTGKVMAFDIHENKLSLVKDNAKR 298

Query: 286 LHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +   +  ++DA  +  K     DAVL+D PCS  G IR+ P++ +T++ + +      
Sbjct: 299 LGINNIECSKLDASKFNEKLKETADAVLIDVPCSGLGIIRKKPEIKYTKNMESVKDIVNI 358

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q++++     +VK GG +++S C+++K+++E+ +   +R+ P       +   ++  +D 
Sbjct: 359 QKEIMKNAARYVKVGGTLLYSTCTINKKENEQNIDWFIRNFPEYT----VEPIFYGEMD- 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +  +    + I P+           MDGFF   L+R
Sbjct: 414 NIIYNENRTVTILPNKY---------MDGFFIAKLKR 441


>gi|295687552|ref|YP_003591245.1| sun protein [Caulobacter segnis ATCC 21756]
 gi|295429455|gb|ADG08627.1| sun protein [Caulobacter segnis ATCC 21756]
          Length = 431

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 145/439 (33%), Positives = 216/439 (49%), Gaps = 19/439 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           G+ AR  +  L+   + +R  L          + FR L  R++   RA+    LR L  I
Sbjct: 8   GLPAREAALTLIDAALSRRGGLDEA----ASANGFRFLEPRERAFARALAMAVLRHLGPI 63

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D  L   L  + P +   +  LLR+  AQ  +L+V  +A V  +VE A  +K +R F  L
Sbjct: 64  DRALAARLQKAPPDR---VMHLLRLGAAQAFHLEVPAFAAVATSVELAGANKASRPFKGL 120

Query: 124 VNSILRRVSREKIELLQRIAGISII-PEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           VN++LR + R+           +++ P W   R    +G+     I+         DL++
Sbjct: 121 VNAVLRGLLRDAPTPDSLGDDPTLLAPPWLYSRWVAAFGEATAREIAGQIALEPATDLSL 180

Query: 183 KFDIETWAHKLNAVMLP-TGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
           K + +  A           GG         + + PGF +G WWVQDA+A++P +L     
Sbjct: 181 KPNADAAALAEALEGEVLPGGTLRLRRKGDVAAWPGFEDGSWWVQDAAAAVPARLLDVKT 240

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             +VLDLCAAPGGKT QL  +GA V ALD S  RL++L  NL R  L A  ++  D   +
Sbjct: 241 GEAVLDLCAAPGGKTLQLAAAGADVVALDRSAARLKRLEENLVRTGLSA-QVVVADGAAW 299

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDA+L+DAPCS+TGT RRHPDVLW     D+   A  Q ++L      +KPG  +
Sbjct: 300 DDARTFDAILLDAPCSATGTFRRHPDVLWAARPGDVASLANVQARILDSAAGRLKPGARL 359

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           V+  CSL+ ++ E  V+  L   P  +EL P+      + +   +L+  G +R+ P  L+
Sbjct: 360 VYCVCSLEPEEGEAQVEAFLARRP-DMELDPIQPGEAGAPE--ASLTARGTLRLLPHQLD 416

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G DGFFA   R+
Sbjct: 417 ------GGQDGFFAARFRK 429


>gi|331684931|ref|ZP_08385517.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H299]
 gi|331077302|gb|EGI48514.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           H299]
          Length = 429

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 119/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDACYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  +  LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|165936548|ref|ZP_02225116.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166213307|ref|ZP_02239342.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167399475|ref|ZP_02304999.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167419402|ref|ZP_02311155.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167425618|ref|ZP_02317371.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|270488262|ref|ZP_06205336.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           KIM D27]
 gi|294502314|ref|YP_003566376.1| hypothetical protein YPZ3_0204 [Yersinia pestis Z176003]
 gi|165915664|gb|EDR34273.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166205605|gb|EDR50085.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166963396|gb|EDR59417.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167051979|gb|EDR63387.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167055308|gb|EDR65102.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|262360394|gb|ACY57115.1| hypothetical protein YPD4_0206 [Yersinia pestis D106004]
 gi|262364344|gb|ACY60901.1| hypothetical protein YPD8_0211 [Yersinia pestis D182038]
 gi|270336766|gb|EFA47543.1| ribosomal RNA small subunit methyltransferase B [Yersinia pestis
           KIM D27]
 gi|294352773|gb|ADE63114.1| hypothetical protein YPZ3_0204 [Yersinia pestis Z176003]
          Length = 431

 Score =  265 bits (678), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 114/457 (24%), Positives = 208/457 (45%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 3   MKNTYNLRSIAAKAISQVLDQGQSLSAVLPEL-----QKNISDKDRALLQELCFGTLRVL 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 58  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATVLKRPQ-L 116

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++E            + P W   R++  Y  +    +  +    P+
Sbjct: 117 KGLINGVLRQFQRQQVELLERAVNNDSHYLHPSWLLARIKQAYPAQWQQILDANNQRPPM 176

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +      +         P ++  LPGF  G   VQDAS
Sbjct: 177 WLRVNRLHHSRSEYLELLTQADINAEPHPIYRDAVRLITPCAVNHLPGFELGWVTVQDAS 236

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 237 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLQ 296

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 297 LQAV-VRVGDGRAPDTWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDISELAQLQ 355

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+  P             ++    
Sbjct: 356 SEIIEAIWPKLKHGGVLVYATCSILPEENQQQIAAFLQRHP-------------EAQLTE 402

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +     +  P             DGFF   + + 
Sbjct: 403 TGTTAAPGKQNLPH--------PEDGDGFFYAKIIKK 431


>gi|329847341|ref|ZP_08262369.1| nusB family protein [Asticcacaulis biprosthecum C19]
 gi|328842404|gb|EGF91973.1| nusB family protein [Asticcacaulis biprosthecum C19]
          Length = 457

 Score =  265 bits (677), Expect = 8e-69,   Method: Composition-based stats.
 Identities = 153/439 (34%), Positives = 223/439 (50%), Gaps = 19/439 (4%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           GMNARL +  L+   + KR      +      S F  L+  ++   RA+  + LR L ++
Sbjct: 33  GMNARLAALTLIDAALEKRTGFDEAVTR----SDFLSLNDSERGFARALAMLVLRRLGQL 88

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKL 123
           D V+D     +       +  LLR+ +AQI ++ V D+A V   V+ A+R+   R F  L
Sbjct: 89  DYVIDKKTQKAPNDG---VWALLRIGLAQIGFMQVPDFAAVSTTVKLAEREAHTRPFKGL 145

Query: 124 VNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           +N+ILR V RE        + ++  P+W  +R +  YG+     I+         DLT K
Sbjct: 146 INAILRSVIREGGLNTPLPSRLA--PDWLFQRWKAAYGEPNAEGIALMLTEEPATDLTFK 203

Query: 184 F--DIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              D+E    +L    L  G      L  +I    G+ +GVWWVQDA+AS+   L G L 
Sbjct: 204 TAADLERLKDELQGTPLG-GLALRSALRGNIAEWAGYGQGVWWVQDAAASVAAGLLGDLT 262

Query: 242 NLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDY 301
             + +DLCAAPGGK  Q+I +G  V ALD S+ RL+++  NL R  L AE ++  DA  +
Sbjct: 263 GKTAIDLCAAPGGKALQMIAAGGDVIALDRSRNRLKRVEENLVRTGLTAEVVM-GDAETW 321

Query: 302 CPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIV 361
              + FDAVL+DAPCS+TGT+RR PDVLW     DI K A  Q +LL      VKPGG +
Sbjct: 322 EDTRQFDAVLLDAPCSATGTLRRQPDVLWATRPTDIAKLADVQHRLLDSASGRVKPGGSL 381

Query: 362 VFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLE 421
           ++  CSL++++ E  V   LR  P      P ++          +++ +GW+R+ P    
Sbjct: 382 IYCTCSLEREEGETQVVAFLRRHPDFAIKKPDDATVIALGVPVESVAAQGWLRLLPHH-- 439

Query: 422 KIDGVSSGMDGFFAVALRR 440
                  G DGFF   L R
Sbjct: 440 ----RPGGQDGFFIAHLVR 454


>gi|238758791|ref|ZP_04619965.1| Ribosomal RNA small subunit methyltransferase B [Yersinia aldovae
           ATCC 35236]
 gi|238703088|gb|EEP95631.1| Ribosomal RNA small subunit methyltransferase B [Yersinia aldovae
           ATCC 35236]
          Length = 429

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 120/456 (26%), Positives = 213/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPEL-----QKNISDKDRALLQELCFGALRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPLTGKQRIFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKQAYPDQWQQILEANNQKPPM 174

Query: 177 YIDL-TVKFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +                P ++  LPGF  G   VQDAS
Sbjct: 175 WLRVSRLHHSRNEYLELLKQANIDALPHDFYSDAVRLITPCAVNDLPGFELGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    +   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL+
Sbjct: 235 AQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVLAIDIDEQRLSRVKENLQRLN 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A  +   D     ++C  + FD +L+DAPCS+TG IRRHPD+ W R   DI   A  Q
Sbjct: 295 LHAV-VRVGDGRTPDEWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIADLAKLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+   ++++ +   L+      ELV   +A        
Sbjct: 354 SEIVEAIWPKLKKGGVMVYATCSILPDENQQQIAAFLQRH-SEAELVETGTAVAPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------KQNLPHPEDGDGFFYAKLIK 428


>gi|325290449|ref|YP_004266630.1| sun protein [Syntrophobotulus glycolicus DSM 8271]
 gi|324965850|gb|ADY56629.1| sun protein [Syntrophobotulus glycolicus DSM 8271]
          Length = 461

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 116/462 (25%), Positives = 193/462 (41%), Gaps = 37/462 (8%)

Query: 2   KSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLP 61
            +  NAR  +  +L+   +++  +  LL  +  +        RD+ L  A+VN TL+   
Sbjct: 11  SNDHNARRTAVRILTRAEKEKAYVNLLLQRQLRELG----DSRDRQLAAALVNGTLKNRL 66

Query: 62  RIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHF 120
            +D  +   L + +    + ++ +LR    Q+LY+D +   A V+ AV+  K +     F
Sbjct: 67  TLDYAIRRHLKTPMSALPHMVRAILRTGAFQLLYMDRIPAAAAVNEAVKSVKAE--EPKF 124

Query: 121 AKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISDA 171
           A LVNS+L RV+    E              A     P+W   R    +G E    +  +
Sbjct: 125 AGLVNSVLHRVAEVGWEFPWPDQKKEPARYLAVKYSHPQWLAARWLARWGLEETEKLCIS 184

Query: 172 CISPLYIDLTVKF---DIETWAHKLNAVMLP------TGGIRLKELPESIVSLPGFAEGV 222
              P    +         E    +L    +       T      E   ++  L  + EG+
Sbjct: 185 NNLPAPTCIRTNTLKISRENLVSRLENEGIQVTLSAKTPEGLFIEDFGALDELLSYQEGL 244

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKL 279
           + VQD S+ +   + G      VLD+C APGGKT  L   + +   +   D+   +L  +
Sbjct: 245 FTVQDESSQLVAHILGVKPGERVLDVCCAPGGKTTHLAQLMNNQGTIIGNDLYPAKLSLV 304

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCP-KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              ++RL +        DA      +  FD VLVDAPCS  G IRR  D+ W +   +I 
Sbjct: 305 NELVERLGIGIIQTQAGDAGILEGIEGRFDKVLVDAPCSGLGVIRRRADLRWQKSEQEIK 364

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           + +  Q+K+LL+   FV PGG +V+S C+++ +++ EVV+      P    +       +
Sbjct: 365 ELSEIQKKILLRAADFVAPGGEMVYSTCTIEPEENFEVVKVFRAERPDFSSVSLTGEINF 424

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                      +G  +I P +          MDGFF    RR
Sbjct: 425 PVTAGDKKQLAKGVFQILPHLY--------NMDGFFLAKFRR 458


>gi|209693697|ref|YP_002261625.1| ribosomal RNA small subunit methyltransferase B [Aliivibrio
           salmonicida LFI1238]
 gi|208007648|emb|CAQ77758.1| ribosomal RNA small subunit methyltransferase B [Aliivibrio
           salmonicida LFI1238]
          Length = 444

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 117/452 (25%), Positives = 202/452 (44%), Gaps = 43/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L       A   +  RDQ L++ I    LRFLPR++
Sbjct: 19  MNVRAAAAKVIYQVVDQGHSLSSALPK-----AQSEIKPRDQALLQEICYGVLRFLPRLE 73

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +V   ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  +    L+
Sbjct: 74  SVAQSLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKNLKGPK-LRGLI 132

Query: 125 NSILRRVSREKIE----LLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N +LR   R + E     +   +G    P W  + L+  Y  +   +  ++   +P+++ 
Sbjct: 133 NGVLRSYQRSQEELDAKSISHDSGKYGHPGWLLKMLKEAYPTQWESIVEANNSKAPMWLR 192

Query: 180 LT-VKFDIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    +            L +    + +LPGF +G   VQDA+A +
Sbjct: 193 VNSQHHTRDEYIALLEKEEIAVTPHSQATDALLLDKARDVFTLPGFEKGWVSVQDAAAQL 252

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            V+     +   +LD CAAPGGKTA          V A+D  + RL ++  NL+RL+L A
Sbjct: 253 SVEYLQPQDGELILDCCAAPGGKTAHILERTKNTNVVAIDCDETRLTRVYENLERLNLEA 312

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R ++DI   A  Q ++ 
Sbjct: 313 KVICGDARHPEEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRSEDIKALAELQSEIF 372

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +K GG +V++ CS+  Q++ + V+  L  +     +   + A            
Sbjct: 373 DAMWLQLKSGGTMVYATCSITPQENGDQVKAFLERTENASLVDNTDPAKP---------- 422

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L++
Sbjct: 423 ---GRQILPG--------EENMDGFYYAVLQK 443


>gi|188585963|ref|YP_001917508.1| sun protein [Natranaerobius thermophilus JW/NM-WN-LF]
 gi|179350650|gb|ACB84920.1| sun protein [Natranaerobius thermophilus JW/NM-WN-LF]
          Length = 462

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 110/472 (23%), Positives = 205/472 (43%), Gaps = 46/472 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   ++R ++    + +++ +     +L+   G +    L  +D+ L   I   TL++ 
Sbjct: 1   MKIK-SSRELAFVAYTRIIQDQAYSNLVLNQLLGKT---DLLAQDKALASRITYGTLQWQ 56

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID  L  +    L +       LLR+   QIL+LD V   A V+  V+ A R + ++ 
Sbjct: 57  GLIDYYLKTLSHRPLSKLSNKALFLLRMGAYQILFLDRVPPSASVNETVKVAHR-RTHKG 115

Query: 120 FAKLVNSILRRVSREKIELL---------QRIAGISIIPEWFKERLENFYGKERVLAISD 170
            A  VN ILR + R+K ++L           ++     P W  +   + YG ++ ++I D
Sbjct: 116 IANFVNGILRNLIRKKDQILLPSRDQDLLNYLSVKYSHPYWMVKLWYDKYGLDKTISIMD 175

Query: 171 ACISPLYIDLTVK---FDIETWAHKLNAVMLP------TGGIRLKELPESIVSLPGFAEG 221
              S     + V      +E   ++L    +            L +    + +   F  G
Sbjct: 176 QNNSTPEEAIRVNKLLTSLENLKNELEMTGIQSRLSSKIDDALLVDNLGDLNNNTLFNCG 235

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV---SGAKVTALDVSKRRLEK 278
            + VQD ++ +   L       +++DLC+APG KT  L+        + A+D+ + RL+ 
Sbjct: 236 YFQVQDINSMVVSHLCDPQQGDNIIDLCSAPGSKTTHLVQLIDGQGSILAVDIHEHRLKL 295

Query: 279 LRCNLDRLHLYAEDIIEMD----------AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDV 328
           ++    RL +   ++ + D            +   K  FD  L+DAPCS  GT+R+ P++
Sbjct: 296 VKEACRRLQVNNVNVKQADGTKLISRDQQENNKQLKGQFDLCLIDAPCSGLGTLRKRPEL 355

Query: 329 LWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPV 388
            WT    D+   +  Q KLL  G   VKPGG +V+S C+++ Q++E+ +   L++ P  V
Sbjct: 356 KWTISEQDLNSLSTLQGKLLKAGSQLVKPGGTLVYSTCTINPQENEDQINDFLKNHPDFV 415

Query: 389 ELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              P  +   +       +     ++  P++           DGF+   +++
Sbjct: 416 MESP-RAILKEDTLQGGMILSNNSLQYFPELNLG--------DGFYGARMKK 458


>gi|119943873|ref|YP_941553.1| sun protein [Psychromonas ingrahamii 37]
 gi|119862477|gb|ABM01954.1| sun protein [Psychromonas ingrahamii 37]
          Length = 436

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 202/454 (44%), Gaps = 38/454 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +L+ V+ +  SL+ +L         + LS +D+ L++ +    LR LPR+D
Sbjct: 1   MNVRALAAKILNQVVEQGQSLSNVLP-----PVQQDLSPKDKALLQVLCYGVLRTLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
                ++  +L  K+  L  L+ V   Q+LY  +  +A V   V  AK  K+ +    +V
Sbjct: 56  FFCRSLMDKALKGKQRDLHFLILVGFYQLLYTRIPSHAAVGETVNGAKELKK-QALKGMV 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           N +LR   RE+     +  ++ A +   P W  +RL+  YG E    I         + L
Sbjct: 115 NGVLRNFLREQESLVEKANKQPALVYCHPSWLVKRLQAAYGDELAAQIMHNNNQQAPMWL 174

Query: 181 TV---KFDIETWAHKLNAVM------LPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
            V       + +   LN                  E P  +  LPGF EG   VQD +A 
Sbjct: 175 RVNALHHTRDQYQVLLNDAGLLSFSSEFNDNALRLEKPTDVYKLPGFTEGWVSVQDGAAQ 234

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHL 288
           +            VLD C+APGGKT  +     +  ++ A+D   +RL +++ NLDRL L
Sbjct: 235 LAAHYLDAQAGDLVLDACSAPGGKTVHVLELQKNIKQMVAVDADAKRLLRVQENLDRLKL 294

Query: 289 YA--EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
            A            +   +LFD +L DAPCS+TG IRRHPD+ W R   DI      Q+ 
Sbjct: 295 KASVIHGDASQPGSWWHGELFDRILCDAPCSATGVIRRHPDIRWLRRESDIAGLVSLQKN 354

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA 406
           +L      +KPGGI++++ CS+   +++  +Q  L S      L+PL        D    
Sbjct: 355 ILHALWDKLKPGGILLYATCSILPDENDLQIQDFLESR-QDASLIPL-----IVQDNLQN 408

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  +I P+           MDGF+   L++
Sbjct: 409 NIQNKGRQILPN--------EDAMDGFYYAKLQK 434


>gi|320655927|gb|EFX23847.1| 16S rRNA methyltransferase B [Escherichia coli O55:H7 str. 3256-97
           TW 07815]
          Length = 429

 Score =  265 bits (677), Expect = 9e-69,   Method: Composition-based stats.
 Identities = 117/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++  +   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKSMARPMTGKQRTVHYLIIVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|283797834|ref|ZP_06346987.1| ribosomal RNA small subunit methyltransferase B [Clostridium sp.
           M62/1]
 gi|291074522|gb|EFE11886.1| ribosomal RNA small subunit methyltransferase B [Clostridium sp.
           M62/1]
          Length = 472

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 104/453 (22%), Positives = 206/453 (45%), Gaps = 27/453 (5%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR +++ +L  V+ K+     +L        ++ L ++++  ++ +V+ TL  L +ID +
Sbjct: 29  AREIAADILMEVLEKKQYSHVVLLNALK--KYQYLEKQERSFIKRVVDGTLERLMQIDFI 86

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++    + L + K +++ +LR+ V QI Y+D V D A  + AV+   + +        VN
Sbjct: 87  IESFSSTPLRKMKPTVRTILRMGVYQICYMDRVPDSAACNEAVKLTVK-RGFSGLKGFVN 145

Query: 126 SILRRVSREKIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF 184
            +LR ++R+K E+     +    +P+W   + E  YG++ V  ++++ +    + + +  
Sbjct: 146 GVLRNIARKKEEISWPDDSVRYCLPQWILGQWEPEYGRKAVQVMAESFLRERPLTVRMNL 205

Query: 185 D---IETWAHKLNA------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
           +    E     L            +  +   +  + +  L  FA+G   VQD S+S+   
Sbjct: 206 NQAPREEILESLREQGVEVIESGYSDQVVFLKNVDYLEGLDAFADGFLQVQDLSSSLAGD 265

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLYAED 292
             G      V+D+C APGGK+  +         V   D+S+ ++  +  N+ R  L+  +
Sbjct: 266 AAGVKEGSHVIDVCGAPGGKSLHIAELLNGTGMVEVRDLSESKIALVEDNIRRSGLFNIE 325

Query: 293 IIEMD--AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
               D   FD   ++  D ++ D PCS  G + R PD+ +    +  +  A  QR++L  
Sbjct: 326 ARVQDALEFDRDSEETADLLIADLPCSGLGIMGRKPDIRYNMTREQTLALAGLQREILSV 385

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
              +VKPGG +V+S C++D+ ++EE    +L + P     +        +  +      E
Sbjct: 386 VWRYVKPGGTMVYSTCTIDRAENEENAAWILENLPFEPVDLTERIGEELAKTLCRDTRKE 445

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
           G++++ P             DGFF    RR  +
Sbjct: 446 GYVQLLPGFYPG--------DGFFISVFRRKEE 470


>gi|218550564|ref|YP_002384355.1| 16S rRNA methyltransferase B [Escherichia fergusonii ATCC 35469]
 gi|254766861|sp|B7LRQ5|RSMB_ESCF3 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218358105|emb|CAQ90752.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia
           fergusonii ATCC 35469]
 gi|324111967|gb|EGC05946.1| ribosomal RNA small subunit methyltransferase B [Escherichia
           fergusonii B253]
          Length = 429

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/457 (25%), Positives = 212/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ E            + P W  +RL+  Y ++    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       ++W   L+   +                P  +  LPGF EG   VQDAS
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHVLPGFEEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +K GGI++++ CS+  +++   ++  L+ +                 ++ 
Sbjct: 354 SEILDAIWPHLKSGGILIYATCSVLPEENSLQIKAFLQRTADA--------------ELC 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE          ++    +   DGFF   L + 
Sbjct: 400 ETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|293393280|ref|ZP_06637594.1| RNA methyltransferase Sun [Serratia odorifera DSM 4582]
 gi|291424190|gb|EFE97405.1| RNA methyltransferase Sun [Serratia odorifera DSM 4582]
          Length = 429

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 129/458 (28%), Positives = 212/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +  V+ +  SL+ +L      S  + +S +D+ L++ +   TLR L
Sbjct: 1   MKNNYNLRSIAAQAIGQVLDQGQSLSTILP-----SLQKNISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+ +L  LL V + Q+LY  +  +A +   V  A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPMVGKQRTLHYLLMVGMYQLLYTRIPAHAALAETVNGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ +LLQR A      + P W  +R++  Y  E+   I +A      
Sbjct: 115 KGLINGVLRQFQRQQDQLLQRAANNDSRYLHPSWLLKRIQQAYP-EQWEHIVEANNQKPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       + +   +    +                P ++  LPGFAEG   VQDA
Sbjct: 174 MWLRVNRLHHTRDEYLKLMEQAGIAAAPHAEYRDALRLLSPCAVNELPGFAEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    +   +LDLCAAPGGKT  ++     A V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCVDLLDPQDGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLSRVNENLQRL 293

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
              AE + + D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 RFSAE-VKQGDGRTPQQWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELASL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q +++      +KPGG++V++ CS+  Q++ E V   L+       +             
Sbjct: 353 QAEIMDAIWPHLKPGGVMVYATCSILPQENNEQVLAFLQRHADAQRVETGKQHQPG---- 408

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                             +        DGFF   L +L
Sbjct: 409 -----------------RQNLPHPEDGDGFFYAKLIKL 429


>gi|228966815|ref|ZP_04127859.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228792914|gb|EEM40472.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar sotto str. T04001]
          Length = 429

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 196/447 (43%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A     P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAIAMSHPVWLVQEWTSAYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNE 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GETVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFSNETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQLAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V+ K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIDKFLKEHP---EFEWDTTIKERMPEKLSPYINEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|56964082|ref|YP_175813.1| RNA-binding protein Sun [Bacillus clausii KSM-K16]
 gi|56910325|dbj|BAD64852.1| RNA-binding protein Sun [Bacillus clausii KSM-K16]
          Length = 447

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 123/462 (26%), Positives = 206/462 (44%), Gaps = 36/462 (7%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
           +  + R V+   L  V + +     LL     +     L +RD  L+  +V  T+     
Sbjct: 2   NRPSVREVALDALLKVEKNQAYSHLLLHSTLTN---AGLDKRDSGLLTELVYGTIARKRT 58

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFA 121
           +D  L   L S   ++   +  LLR+SV Q+++LD + D AVV  AV  A + + ++  +
Sbjct: 59  LDYYLAPFLKSG-KKRALWVDVLLRLSVYQMVFLDRIPDRAVVHEAVTIANK-RGHKGIS 116

Query: 122 KLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
            LVN +LR + R+         + ++R A  +  P+W   R  N YG++  +A+++A   
Sbjct: 117 GLVNGVLRSIQRQGLPNVDAIADPIERAAVQTSHPQWLMARWMNQYGEDDAIAMANANNI 176

Query: 175 PLYIDLTVKFDIETWAHKLNAVMLPT---------GGIRLKELPESIVSLPGFAEGVWWV 225
           P  + L V     T A  +  +               + +     +      + +G++  
Sbjct: 177 PPEVCLRVNRMKTTAAELVAHLGNEGVEAERSKLLPDLAVIIKKGNPFGGEAYKKGLFTA 236

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCN 282
           QD ++ +  +L G    + VLD CAAPGGKT      +     + ALD+   +++ +   
Sbjct: 237 QDEASMLVAKLLGPEEGMDVLDACAAPGGKTTHIAEQMNGTGHILALDLHPHKVKLIAEQ 296

Query: 283 LDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
             RL L   +    DA     KK ++ VLVDAPC+  G IRR PD+ W++   D+   A 
Sbjct: 297 AARLGLENIETRAEDARTLQTKKHYNRVLVDAPCTGFGVIRRKPDIRWSKTEKDVKHIAN 356

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q  +L     FVK GG +V+S C+++K+++E  +++ L + P               I 
Sbjct: 357 VQAAILAHASQFVKQGGTLVYSTCTIEKEENEHAIERFLDTHPQFETNERFYGRLPDHIQ 416

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQP 444
                SP G + I P           G DGFF V L R  +P
Sbjct: 417 ANGRFSPLG-LTILPHDF--------GTDGFFMVPLTR--KP 447


>gi|157148863|ref|YP_001456182.1| 16S rRNA methyltransferase B [Citrobacter koseri ATCC BAA-895]
 gi|224493244|sp|A8AQI3|RSMB_CITK8 RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|157086068|gb|ABV15746.1| hypothetical protein CKO_04701 [Citrobacter koseri ATCC BAA-895]
          Length = 428

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 118/457 (25%), Positives = 211/457 (46%), Gaps = 45/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKK-QNLRSLAAQAVEQVVEQGQSLSNVLP-----PLQQKVSDKDKALLQELCFGVLRTL 54

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            +++ +++ ++   +  K+ ++  L+ V   Q+L+  +  +A +   VE A   K  +  
Sbjct: 55  SQLEWLINKLMSRPMTGKQRTVHYLIMVGFYQLLHTRIPPHAALAETVEGAVAIKRPQ-L 113

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYG-KERVLAISDACISPL 176
             L+N +LR+  R++  LL   A      + P W  +RL+  Y  +   +  ++    P+
Sbjct: 114 KGLINGVLRQFQRQQEALLAEFATSEARFLHPSWLLKRLQKSYPTQWEAIVEANNQRPPM 173

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       ++W   L    +                P  + +LPGF EG   VQDAS
Sbjct: 174 WLRVNRTHHSRDSWLTLLQDAGMNGFPHSAYPDALRLESPAPVHALPGFEEGWVTVQDAS 233

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V      N   +LDLCAAPGGKT  ++     A+V A+DV ++RL ++  NL RL 
Sbjct: 234 AQGCVSFLAPQNGEKILDLCAAPGGKTTHILEAAPEAQVLAVDVDEQRLSRVYDNLKRLG 293

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 MKAT-VKQGDGRYPAQWCGEQKFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAKLQ 352

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +K GG +V++ CS+  +++ + +   L+ +P                   
Sbjct: 353 SEILDAIWPHLKSGGTLVYATCSVLPEENSQQILAFLQRTPDATL-------------TG 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                +  ++  P   E         DGFF   L + 
Sbjct: 400 TGTPAQPGVQNLPGAEEG--------DGFFYAKLIKK 428


>gi|153953997|ref|YP_001394762.1| hypothetical protein CKL_1372 [Clostridium kluyveri DSM 555]
 gi|219854611|ref|YP_002471733.1| hypothetical protein CKR_1268 [Clostridium kluyveri NBRC 12016]
 gi|146346878|gb|EDK33414.1| Hypothetical protein CKL_1372 [Clostridium kluyveri DSM 555]
 gi|219568335|dbj|BAH06319.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 443

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 123/460 (26%), Positives = 209/460 (45%), Gaps = 43/460 (9%)

Query: 5   MN-ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           MN AR V+  ++  V+      + +L+          L+++D+ L+  +V  TL++   I
Sbjct: 1   MNSARSVAVEVVKKVLYDNAYSSIVLNKYLNK---FDLNKKDRALITELVYGTLKYKYTI 57

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D +L   + S+L +    +  +LR+S+ Q+ YLD + ++AVV+ AVE +K        +K
Sbjct: 58  DCILKNFIKSNLEKMNKDILNMLRISICQLRYLDKIPEFAVVNEAVEFSKNISF--KLSK 115

Query: 123 LVNSILRRVSREKIELL--------QRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           LVN +LR   R K            + I      P W  E   N YG++    I  +   
Sbjct: 116 LVNGVLRNYLRNKSNSFGGNKEDKIEGICFEYSFPRWMAELFINQYGEDLGKFIMGSLNV 175

Query: 175 PLYIDLTVKFDIETWAHKLNAV---------MLPTGGIRLKELPESIVSLPGFAEGVWWV 225
              + + +      + H  N +                 +     +I   P F +G   V
Sbjct: 176 VPKVTVRINTLKTDYKHAWNELIVNGYDVKRGNVYKEAVIINKGSNIELNPLFEKGHITV 235

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCN 282
           QD SA +         N+++LDLC+APGGK+  +   + +   V   D+ + +L  +R N
Sbjct: 236 QDESAMLVSYFMDVEENMTILDLCSAPGGKSCHIGELMKNTGNVHCYDLYESKLSLVRHN 295

Query: 283 LDRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
            +RL +      ++DA  Y  K     D VL+D PCS  G IR+ P++ W +  D +   
Sbjct: 296 AERLGIKNITCKKLDAAKYLEKLKDTADRVLIDVPCSGLGIIRKKPEIKWNKKEDSLKDL 355

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              QRK++L    +VK GG +V+S C+L+K+++EE +   +  +P   +L  L    + +
Sbjct: 356 IEIQRKIILNAARYVKVGGKLVYSTCTLNKKENEENINWFISRNP-QYKLDKLYCGDFHN 414

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           I        EG++ I PD         + MDGFF   L +
Sbjct: 415 I----IYHEEGYMTILPD---------NHMDGFFIARLIK 441


>gi|331674796|ref|ZP_08375553.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA280]
 gi|331067705|gb|EGI39103.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA280]
          Length = 429

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++    L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRVNRTHHSRDSLLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMSWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG ++++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLIYATCSVLPEENSLQIKSFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|91791391|ref|YP_561042.1| sun protein [Shewanella denitrificans OS217]
 gi|91713393|gb|ABE53319.1| sun protein [Shewanella denitrificans OS217]
          Length = 428

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 122/448 (27%), Positives = 195/448 (43%), Gaps = 35/448 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K +SL+  L L+         + +D+ L+  +    +R LP++D
Sbjct: 2   MNLRALAAKAIFDVLEKGLSLSVALPLQQQHVQ----NGKDKALLAELCYGVMRQLPQLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L      K+  L QLL V   Q+ +  +  +A V    E A R  +     K+V
Sbjct: 58  KCVSDCLAKPFKGKQRILHQLLLVGCYQLYFTRIPSHAAVSETAE-ACRQLKFDGLVKVV 116

Query: 125 NSILRRVSREKIELLQRIAG-ISIIPEWFKERLENFYGKERVLAISDACISPLYI--DLT 181
           N +LR + R++ EL           P W  +RL+  Y ++    I  +   P     +  
Sbjct: 117 NGVLRNIQRQEPELNTDSDTLKYNTPAWLIKRLQQAYPQDWQQVIEQSHERPPMWLRNNR 176

Query: 182 VKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
           +    + +   L      A    +    L E P  ++ LPGF  G   VQD +A     L
Sbjct: 177 LVQTRDAYLASLTNENIEASAGLSPDAILLESPTDVLQLPGFMSGSASVQDGAAQWAATL 236

Query: 237 FGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA--ED 292
                N  VLD CAAPGGKT     I     +TA+D   +RLE+++ NLDRL L A    
Sbjct: 237 LAPQANEVVLDACAAPGGKTCHLLEIAPNISLTAVDFDLKRLERVQQNLDRLKLTAQVIH 296

Query: 293 IIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
               +   +     FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q ++L    
Sbjct: 297 GDAANIDSWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRKNSDIDELATLQMQILDHCW 356

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++++ CS+  +++ + +   L  +     +          I           
Sbjct: 357 QWLKPGGTLLYATCSILPEENSQQINAFLTRTADASLVAISEQKNPADIGW--------- 407

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +I P            MDGF+   L +
Sbjct: 408 -QILPG--------QDNMDGFYYARLVK 426


>gi|325498857|gb|EGC96716.1| 16S rRNA methyltransferase B [Escherichia fergusonii ECD227]
          Length = 429

 Score =  265 bits (677), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 116/457 (25%), Positives = 212/457 (46%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ E            + P W  +RL+  Y ++    I  +    P+
Sbjct: 115 KGLINGVLRQFHRQQEELLAEFNASDARYLHPSWLLKRLQKAYPEQWQSIIEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +       ++W   L+   +                P  +  LPGF EG   VQDAS
Sbjct: 175 WLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHVLPGFEEGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLG 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L      +K GGI++++ CS+  +++   ++  L+ +                 ++ 
Sbjct: 354 SEILDAIWPHLKSGGILIYATCSVLPEENSLQIKAFLQRTADA--------------ELC 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +PE          ++    +   DGFF   L + 
Sbjct: 400 ETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|228902369|ref|ZP_04066525.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis IBL 4222]
 gi|228857267|gb|EEN01771.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis IBL 4222]
          Length = 429

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 196/447 (43%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A     P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAIAMSHPVWLVQEWTSAYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNE 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GETVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFSNETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQLAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V+ K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIDKFLKEHP---EFEWDTTIKERMPEKLSKYINEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|254519240|ref|ZP_05131296.1| sun protein [Clostridium sp. 7_2_43FAA]
 gi|226912989|gb|EEH98190.1| sun protein [Clostridium sp. 7_2_43FAA]
          Length = 439

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 110/458 (24%), Positives = 194/458 (42%), Gaps = 41/458 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M +R ++  ++  V+ +      +L  E  +     +  +D+ L+  IV  TLR    +D
Sbjct: 1   MKSRKLARQIIQRVLEEGAYSNLVLSNELNNI---DIEDKDKGLITEIVYGTLRRKRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            ++   +   +     ++  +LRV++ Q+ +LD + +YA  + AVE+AK        +KL
Sbjct: 58  VLIGNFV-KDINLIDTTVLNILRVAIYQMYFLDKIPEYAACNEAVEEAKEVSLE--ASKL 114

Query: 124 VNSILRRVSREKI------ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           VN ILR   +++         +  +A       W        YG+ER + +         
Sbjct: 115 VNGILRNYIKDEKEIVVPGNRIDELAYKFSFQPWMIRLFIKQYGEERTMKLMAGLNETPK 174

Query: 178 IDLTVKFDIETW---AHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + + V      +     KL  +                   + I     F EG+  VQD 
Sbjct: 175 VTVRVNEFKAEYDEVYEKLEEIGYNIEDGYACPEAIAIKGGKGIEDNQLFKEGLITVQDE 234

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV---SGAKVTALDVSKRRLEKLRCNLDR 285
           SA +   L        VLDLCAAPGGKT  +     +  +V A D+ + +L  +  N  R
Sbjct: 235 SAMLVAPLLDLKEGDKVLDLCAAPGGKTTHIAELLANSGEVLAFDLHENKLSLIEENAKR 294

Query: 286 LHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L L       MDA           D VL+D PCS  G IR+ P++ W +    +      
Sbjct: 295 LGLNNIVCKAMDATKLNSDYISYGDKVLIDVPCSGLGIIRKKPEIKWNKTRQQLKDLVPI 354

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR+++     ++KPGG +V+S C+L+K+++EE ++  L       E+  +    +   + 
Sbjct: 355 QREIMENAWQYLKPGGTLVYSTCTLNKEENEENLKWFLSKH-NDAEIEKI----YIGNNN 409

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               + +G + I P+           MDGFF   ++++
Sbjct: 410 NFIYNGDGSLTILPN---------DSMDGFFIGKIKKI 438


>gi|118444654|ref|YP_878315.1| sun protein [Clostridium novyi NT]
 gi|118135110|gb|ABK62154.1| sun protein [Clostridium novyi NT]
          Length = 443

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 109/457 (23%), Positives = 188/457 (41%), Gaps = 40/457 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
            AR +   +L  V  K      +L      +    +  +D+ L+  IV  T+++   ID 
Sbjct: 3   KARKICVDILEVVFNKNAYSNIVLRQTLNKNK---IDDKDKGLITEIVYGTIKYKYTIDT 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L+  L   +      +  +LR++V QI +LD + ++A V+ AVE AK++K +   +KLV
Sbjct: 60  ILNNFLKKGIKSLDSYVLNILRITVYQIKFLDKIPNFAAVNEAVEIAKKEK-SVGASKLV 118

Query: 125 NSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N +LR   R   +                   +W    L   YG E    I         
Sbjct: 119 NGVLRNYLRNLDKKYYNDKNLVETLCFKYSYDKWLVNMLIKQYGNEIAEDILKGLNERPA 178

Query: 178 IDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V           +                   +    +SI   P F EG   VQD 
Sbjct: 179 VTVRVNNLKTDHDEAFSNLEEYGYDVEEGYICPEAIVINKGKSIEKNPLFKEGKITVQDE 238

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA +           +VLDLC+APGGKT  +   + +   V A D+ + +L  ++ N  R
Sbjct: 239 SAMLVAPSIDAKEGATVLDLCSAPGGKTTHISEIMNNTGIVKAFDIHENKLSLVKENAKR 298

Query: 286 LHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +      EMDA  +  +     D VL+D PCS  G IR+ P++ +T+D          
Sbjct: 299 LGIDNISCAEMDASKFNKELENSADMVLIDVPCSGLGIIRKKPEIKYTKDIKSTKDIVAI 358

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+K++     +VK  G +++S C+++K+++E+ +   ++  P            +     
Sbjct: 359 QKKIMENAAKYVKKEGTLLYSTCTINKEENEKNINWFIKKFPEYKV-----EPLFYGNMS 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +  +  G + I P+           MDGFF   L++
Sbjct: 414 NIIYNENGTVTILPNKY---------MDGFFIAKLKK 441


>gi|163797843|ref|ZP_02191788.1| tRNA and rRNA cytosine-C5-methylase [alpha proteobacterium BAL199]
 gi|159176887|gb|EDP61454.1| tRNA and rRNA cytosine-C5-methylase [alpha proteobacterium BAL199]
          Length = 436

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 163/435 (37%), Positives = 242/435 (55%), Gaps = 13/435 (2%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
            +R V+  L   V+ KR  L   L           L +RD+   R +V  TLR L  +D 
Sbjct: 14  ASRSVAFDLFRAVLAKRTPLDEALA---AHDGLAKLPERDRGFARLLVATTLRRLGHVDR 70

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++D  +   LP K   ++ +LR++ +++L L VA +A VD AV   +  + +  F KL N
Sbjct: 71  LVDACIDKPLPTKAAVVRDILRLAASELLILGVAPHAAVDSAVNTVRS-RGHEPFVKLTN 129

Query: 126 SILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFD 185
           ++LRR+ RE    + +++ +  +P+W  E     YG+    AI+ A      +D++VK D
Sbjct: 130 AVLRRLDREGRGEILKLSALEALPDWLAEGWRAAYGEATAEAIAAAGFVEPPLDISVKDD 189

Query: 186 IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSV 245
            E WA KL A +LP G +R +     I  LPGFAEG WWVQD +AS+P++L G + +  V
Sbjct: 190 PEGWAKKLGATLLPNGTLR-RGFDGRIEGLPGFAEGAWWVQDMAASLPIRLLGPVADRRV 248

Query: 246 LDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKK 305
           +DLCAAPGGKTAQL  +GA+V A+D SK RL++L  NL RL L A      DA +   + 
Sbjct: 249 VDLCAAPGGKTAQLAAAGAQVLAIDRSKPRLQRLERNLARLGL-AASTRVADATEMKLEN 307

Query: 306 LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN 365
             DA+L+DAPCS+TGTIRRHPD+ W +  +D    A  Q +L+   +  + PGG +VF  
Sbjct: 308 PVDAILLDAPCSATGTIRRHPDIPWLKHANDADSLAGLQDRLIANAVRMLAPGGTLVFCT 367

Query: 366 CSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDG 425
           CSL+  +  E V   L ++P  ++ VP+          A  ++ +G +R  PD L  +  
Sbjct: 368 CSLEPIEGPERVAAALAANP-ELKRVPIRPDEIGG--FAELITVDGDLRSRPDQLANL-- 422

Query: 426 VSSGMDGFFAVALRR 440
              G+DGF+A  L R
Sbjct: 423 --GGIDGFYACRLVR 435


>gi|304316972|ref|YP_003852117.1| sun protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778474|gb|ADL69033.1| sun protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 447

 Score =  265 bits (676), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 100/460 (21%), Positives = 204/460 (44%), Gaps = 39/460 (8%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R ++  +L  ++ K+     +L+    +     +   ++  ++ IV  T+     +D
Sbjct: 1   MNQRNIAFKILYEILVKKGYSNIVLNKYLNN---DGIEDVEKSFIKEIVFGTIERKYTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D+     + +    +  +L + + Q++Y+D V DYA ++ +V   K     ++ +K 
Sbjct: 58  RIIDYCSTKDIKKIDNKVLIILEMGLFQLMYMDKVPDYAAINESVNLTKEHVG-KYASKF 116

Query: 124 VNSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN++LR   R  +++            ++     PEW  +RL N Y ++   +I ++   
Sbjct: 117 VNAVLRSYLRNSMKIKFLQPNENLIEYLSFKYSFPEWIVKRLLNNYDRDATESILESLNG 176

Query: 175 PLYIDLTVKF---DIETWAHKLNAVM-----LPTGGIRLKELPESIVSLPGFAEGVWWVQ 226
              I + +     D + +  KLN                    ++I +   + +G+  VQ
Sbjct: 177 KPEISIRLNTLKIDGKNFEKKLNDRGLKYKKGMYNNDAYYIDLKNITNDEIYKDGLIQVQ 236

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNL 283
           D  A I  ++        V+D+C+APGGKT     L+ +  K+ A DV + +++ ++ N 
Sbjct: 237 DEGAMIISKVLSPKPGDMVIDVCSAPGGKTTHLSQLMNNKGKIVAFDVYEHKIDLIKRNC 296

Query: 284 DRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVL-WTRDTDDIVKS 340
            RL +   D    D+     +     D VL D PCS  G IR+ PD+        D  + 
Sbjct: 297 RRLGVDNVDAFVFDSTKVNSEYIDKADKVLADVPCSGIGIIRKKPDIKLKNYTKKDFDEL 356

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q ++L     +VK GG +++S C++ K+++  +V K L  +    ++  +     + 
Sbjct: 357 NNIQYRILSSSSKYVKKGGYILYSTCTIGKEENINIVDKFLNENK-EFKIADIRPFLPQ- 414

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            ++   +  +G I++ P++        +  DGFF   L+R
Sbjct: 415 -NLVHFVDDKGCIQLLPNL--------NNTDGFFICKLQR 445


>gi|323164853|gb|EFZ50644.1| ribosomal RNA small subunit methyltransferase B [Shigella sonnei
           53G]
          Length = 454

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 115/456 (25%), Positives = 209/456 (45%), Gaps = 46/456 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
              N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L +
Sbjct: 28  KQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTLSQ 82

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +    
Sbjct: 83  LDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-LKG 141

Query: 123 LVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           L+N +LR+   ++ E            + P W  +RL+  Y  E+  +I +A      + 
Sbjct: 142 LINGVLRQFQHQQEELLAEFNTSDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPPMW 200

Query: 180 LTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASA 230
           L V       ++W   L+   +                P  + +LPGF +G   VQDASA
Sbjct: 201 LRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDASA 260

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHL 288
              +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL +
Sbjct: 261 QGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVHDNLKRLGM 320

Query: 289 YAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
            A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q 
Sbjct: 321 KAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQS 379

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++  
Sbjct: 380 EILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------ELCE 425

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +PE          ++    +   DGFF   L + 
Sbjct: 426 TGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 454


>gi|218706896|ref|YP_002414415.1| 16S rRNA methyltransferase B [Escherichia coli UMN026]
 gi|293406886|ref|ZP_06650810.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1412]
 gi|298382627|ref|ZP_06992222.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1302]
 gi|300896636|ref|ZP_07115153.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 198-1]
 gi|331664901|ref|ZP_08365802.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA143]
 gi|254766859|sp|B7NDR0|RSMB_ECOLU RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|218433993|emb|CAR14910.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Escherichia coli
           UMN026]
 gi|284923295|emb|CBG36389.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           042]
 gi|291425697|gb|EFE98731.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1412]
 gi|298276463|gb|EFI17981.1| 16S rRNA methyltransferase B [Escherichia coli FVEC1302]
 gi|300359513|gb|EFJ75383.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           MS 198-1]
 gi|331057411|gb|EGI29397.1| ribosomal RNA small subunit methyltransferase B [Escherichia coli
           TA143]
          Length = 429

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAVAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLAEFNASDACYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       ++W   L+   +                P  +  LPGF EG   VQDA
Sbjct: 174 MWLRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHVLPGFEEGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMAWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG ++++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLIYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 429


>gi|253690152|ref|YP_003019342.1| sun protein [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|259495486|sp|C6DFR7|RSMB_PECCP RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|251756730|gb|ACT14806.1| sun protein [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 429

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 120/456 (26%), Positives = 214/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +       R +S++D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVH-----QREVSEKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYG-KERVLAISDACISPL 176
             L+N +    +R   E I+     +   + P W   R+E+ Y    + +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELIQREANHSSHYLHPSWLLARIEHAYPNHWQTIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    E + + L    +                P ++  LPGF++G   VQDAS
Sbjct: 175 WLRVNRLHHTREAYLNLLAQEGIEAFPHTEFTDAIRLASPCAVDQLPGFSQGWATVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V      +   +LDLCAAPGGKT  ++     + V A+D+ + RL +++ NL RL 
Sbjct: 235 AQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPQSHVLAVDIDETRLGRVKENLLRLQ 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI +    Q
Sbjct: 295 MHAE-VKQGDGRYPDSWCEGRMFDRILLDAPCSATGVIRRHPDIKWLRRDRDIEELVALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           +++       +K GG +V++ CS+  Q++ + V   L        LV   +         
Sbjct: 354 KEIFDAIWPHLKVGGTMVYATCSILPQENAQQVTDFLTRH-ADATLVDTGTRELPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                   I++ P         + G DGFF   L +
Sbjct: 409 --------IQMLPH--------ADGGDGFFYAKLVK 428


>gi|331269683|ref|YP_004396175.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum BKT015925]
 gi|329126233|gb|AEB76178.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum BKT015925]
          Length = 443

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 109/457 (23%), Positives = 198/457 (43%), Gaps = 40/457 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR +   +L  V  K      +L     +   + ++ +D+ L+  IV  T+++   ID 
Sbjct: 3   NARKICVDILEMVFNKNAYSNIVLRQSLNN---QKINDKDKGLITEIVYGTIKYKYTIDT 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L+  L          +  +LR ++ QI YLD + ++A V+ AV  AK+ K +   +KLV
Sbjct: 60  ILNAYLKKGTKSVDSYILNILRTTIYQIKYLDKIPNFAAVNEAVNIAKKHK-SIGESKLV 118

Query: 125 NSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N +LR   R   ++           +      +W  +   N Y +E    I         
Sbjct: 119 NGVLRNYLRNLDKVYYNKNSIIERLSFEYSCEKWLVKMFINQYNEEIAEKILKGLNERPA 178

Query: 178 IDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
           + + V      +    N                   +    +SI S P F +G   VQD 
Sbjct: 179 VTVRVNNLKTDYDEAFNKLEEYEYSIEEGYVCPEAIVINKGKSIESNPLFEDGKITVQDE 238

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA +            VLDLC+APGGKT  +   + +  KV A D+ + +L  ++ N  R
Sbjct: 239 SAMLVAPTMNVEQGDLVLDLCSAPGGKTTHISEIMNNTGKVKAFDIHENKLNLVKDNAKR 298

Query: 286 LHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +   +  ++DA  +  +     DAVL+D PCS  G IR+ P++ +T++ + +      
Sbjct: 299 LGINNIECSKLDASKFNEELKEIADAVLIDVPCSGLGIIRKKPEIKYTKNMESVKDIVKI 358

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q++++     +VK GG +++S C+++K+++E+ +   +++ P            +     
Sbjct: 359 QKEIMKNAARYVKVGGTLLYSTCTINKKENEQNIDWFIKNFPQYTV-----EPIFYGKMD 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +  +  G + I P+           MDGFF   L+R
Sbjct: 414 NIIYNENGTVTILPNKY---------MDGFFIAKLKR 441


>gi|238783195|ref|ZP_04627221.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           bercovieri ATCC 43970]
 gi|238715991|gb|EEQ07977.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           bercovieri ATCC 43970]
          Length = 431

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 120/456 (26%), Positives = 215/456 (47%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L   +       +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPGLH-----NTISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKLAYPDQWQQILDANNQKPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +                P ++ +LPGF  G   VQDAS
Sbjct: 175 WLRVNRLHHSRSEYLELLKQADIDAAPHDAYPDALRLITPCAVSALPGFELGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V+L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 235 AQGCVELLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVKENLQRLQ 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHAV-VRVGDGRTPEAWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+      ELV   +         
Sbjct: 354 SEIIEAIWPKLKKGGVMVYATCSILPEENQQQIAAFLQRH-SEAELVETGTTAAPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------KQNLPHPEDGDGFFYAKLIK 428


>gi|323489537|ref|ZP_08094764.1| ribosomal RNA small subunit methyltransferase B [Planococcus
           donghaensis MPA1U2]
 gi|323396668|gb|EGA89487.1| ribosomal RNA small subunit methyltransferase B [Planococcus
           donghaensis MPA1U2]
          Length = 450

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 115/468 (24%), Positives = 200/468 (42%), Gaps = 47/468 (10%)

Query: 1   MKSGM---NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTL 57
           MK+     N R  +  +L  V  K+     LL           ++ +++ L+  I   TL
Sbjct: 1   MKNKKLQGNVRDAAFSILWAVENKQAYSNLLLHQTIESY---GIAAKNRGLLTEITYGTL 57

Query: 58  RFLPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKE 116
           +    +D  L+  L   +      ++ LLR+S+ QI+YLD +  +AVV  AVE AKR + 
Sbjct: 58  QHQMTLDYYLEPYLKGKIES---WVKILLRLSLYQIVYLDRIPAHAVVHEAVEIAKR-RG 113

Query: 117 NRHFAKLVNSILR-------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS 169
           +   A +VN +LR       R      +  ++I+  +  PEW   R    +G E+   ++
Sbjct: 114 HGGVASVVNGVLRSVQRSGVRSFNTISDPYEKISIETSHPEWMIRRWAEQFGLEKTREMA 173

Query: 170 DACISPLYIDLTVKFDIETWAH--------KLNAVMLPTGGIRLKELPESIVSLPGFAEG 221
                     + V     T           +L A         L            F +G
Sbjct: 174 LENNKTPLQTVRVNTVRATVEEAIEMLESEELEAEPSKMIPECLVVTNGQPARTTTFEKG 233

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEK 278
              +QD S+ +P         ++VLD+CAAPGGKT      + +   + ALD+ + +++ 
Sbjct: 234 FITIQDESSMLPAYALQVEPGMTVLDMCAAPGGKTTHIAEKMNNSGTLYALDLHQHKVKL 293

Query: 279 LRCNLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTD 335
           +  N +RL     +    D         ++ FD +LVDAPCS  G I+R PD+ +T+   
Sbjct: 294 IDENAERLGHTVIETTVGDGKQSVERFGEEKFDRILVDAPCSGLGVIKRKPDIKYTKKEQ 353

Query: 336 DIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNS 395
           D  +    Q +LL Q    +K  GI+V+S C++D  ++    ++ L+  P   E+  +  
Sbjct: 354 DFARLQEIQIELLDQAARLLKEDGILVYSTCTVDAVENRGTAERFLKEHP---EMEKIQV 410

Query: 396 AYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
           A    + +       G++++ P           G DGFF  A +++ +
Sbjct: 411 ALPDLMGIKHT----GFVQVFPQDY--------GSDGFFIAAFKKIQK 446


>gi|270264342|ref|ZP_06192608.1| hypothetical protein SOD_h00090 [Serratia odorifera 4Rx13]
 gi|270041478|gb|EFA14576.1| hypothetical protein SOD_h00090 [Serratia odorifera 4Rx13]
          Length = 429

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 128/457 (28%), Positives = 217/457 (47%), Gaps = 44/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R  ++  +  V+ +  SL+ +L      S  + +S +D+ L++ +   TLR L
Sbjct: 1   MKNNYNLRSHAAKAIGQVLDQGQSLSTVLP-----SLQKTISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+ +L  LL V + Q+LY  +  +AV+   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPMTGKQRTLHYLLMVGLYQLLYTRIPAHAVLAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ ELLQR A      + P W  +R++  Y  +    I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELLQRAANNDSRYLHPSWLLKRIQQAYPAQWEQIIDANNQKPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    E +   +    +               +P ++  LPGFA+G   VQDAS
Sbjct: 175 WLRVNRLHHTREDYLRLMEQAGIAAEPHAEYPDALRLLVPCAVTDLPGFADGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL +++ NL RL 
Sbjct: 235 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVMAVDIDEQRLGRVKENLQRLR 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+AE +   D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHAE-VKLGDGRTPQQWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAKLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+   ++ E +   L+  P    +   +          
Sbjct: 354 AEIIDAIWPHLKSGGVMVYATCSILPTENAEQITAFLQRHPDARLVETGDEQQPG----- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                            +        DGFF   L ++
Sbjct: 409 ----------------RQNLPHPEDGDGFFYAKLIKM 429


>gi|313637331|gb|EFS02816.1| ribosomal RNA small subunit methyltransferase B [Listeria seeligeri
           FSL S4-171]
          Length = 446

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 120/467 (25%), Positives = 207/467 (44%), Gaps = 44/467 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVREIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +++IA  + +P W  +R    YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDLIQDPVEKIAVETSLPVWLAKRWAKQYGNEQLREIGMAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNA-----VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN               L     S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRTEQLIKELNDQGITVTRNEFIDEALIVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLATYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDH 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFALEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
              +    +  + ++++ P  +        G DGFF  +LR++  P+
Sbjct: 408 ALPEKLAHIKKDDFVQLLPTDI--------GSDGFFVSSLRKVS-PE 445


>gi|295091953|emb|CBK78060.1| ribosomal RNA small subunit methyltransferase RsmB [Clostridium cf.
           saccharolyticum K10]
          Length = 472

 Score =  264 bits (675), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 104/453 (22%), Positives = 205/453 (45%), Gaps = 27/453 (5%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR +++ +L  V+ K+     +L        ++ L ++++  ++ +V+ TL  L +ID +
Sbjct: 29  AREIAADILMEVLEKKQYSHVVLLNALK--KYQYLEKQERSFIKRVVDGTLERLMQIDFI 86

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           ++    + L + K +++ +LR+ V QI Y+D V D A  + AV+   + +        VN
Sbjct: 87  IESFSSTPLRKMKPTVRTILRMGVYQICYMDRVPDSAACNEAVKLTVK-RGFSGLKGFVN 145

Query: 126 SILRRVSREKIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKF 184
            +LR ++R+K E+     +    +P+W   + E  YG++ V  ++++ +    + + +  
Sbjct: 146 GVLRNIARKKEEISWPDDSVRYCLPQWILGQWEPEYGRKAVQVMAESFLRERPLTVRMNL 205

Query: 185 D---IETWAHKLNA------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQ 235
           +    E     L            +  +   +  + +  L  FA+G   VQD S+S+   
Sbjct: 206 NQAPREEILESLREQGVEVIESGYSDQVVFLKNVDYLEGLDAFADGFLQVQDLSSSLAGD 265

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLI---VSGAKVTALDVSKRRLEKLRCNLDRLHLYAED 292
             G      V+D+C APGGK+  +         V   D+S+ ++  +  N+ R  L+  +
Sbjct: 266 AAGVKEGSHVIDVCGAPGGKSLHIAELLNGTGMVEVRDLSESKIALVEDNIRRSGLFNIE 325

Query: 293 IIEMD--AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
               D   FD   ++  D ++ D PCS  G + R PD+      +  +  A  QR++L  
Sbjct: 326 ARVQDALEFDRDSEETADLLIADLPCSGLGIMGRKPDIRCNMTREQTLALAGLQREILSV 385

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
              +VKPGG +V+S C++D+ ++EE    +L + P     +        +  +      E
Sbjct: 386 VWRYVKPGGTMVYSTCTIDRAENEENAAWILENLPFEPVDLTGRIGEELAKTLCRDTRKE 445

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
           G++++ P             DGFF    RR  +
Sbjct: 446 GYVQLLPGFYPG--------DGFFISVFRRKEE 470


>gi|328471169|gb|EGF42071.1| 16S rRNA methyltransferase B [Vibrio parahaemolyticus 10329]
          Length = 427

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 124/452 (27%), Positives = 208/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGK-ERVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y +    +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMGAIKLAAPCDVMKLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLTK 424


>gi|312882737|ref|ZP_07742472.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309369595|gb|EFP97112.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 426

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 119/452 (26%), Positives = 203/452 (44%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A   +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLFQVVDKGHSLSNALP-----AAQTTIKPRDYALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +  + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  STANQLMDKPLKGKQRVFHHLILVGLYQLSFMRIPAHAAVGETVEATKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELL----QRIAGISIIPEWFKERLENFYGKERVLAISDAC-ISPLYID 179
           N++LR   R + +L        AG    P W  + L+  Y  +    ++     +P+++ 
Sbjct: 115 NAVLRNYQRNQEQLDAQAVSHDAGKYGHPSWLLKLLQASYPTDWQQIVAANNTKAPMWLR 174

Query: 180 LTVKFD-IETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    +        +       P  +  LPGF +G   VQDA+A +
Sbjct: 175 VNQHHHQRQDYLELLKESGIECEIHEEAQDAIKLLSPCDVTQLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
                   +   +LD CAAPGGKTA         KV A+D    RL+++  NL RL L A
Sbjct: 235 SSDFLNAQDGELILDCCAAPGGKTAHILERAPNCKVVAIDCDDTRLQRVHDNLQRLQLNA 294

Query: 291 EDII--EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
             I     +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q ++L
Sbjct: 295 TVICGDARNPEEWWQGEKFDRILLDAPCSATGVIRRHPDIKWLRRAEDIHALAQLQSEIL 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q++++ V+  L  +                  +  +  
Sbjct: 355 DAMWQQLKPGGTLVYATCSITPQENKDQVKAFLTRTCEA--------------SLIGSKL 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P   +        MDGF+   +++
Sbjct: 401 ENPGRQILPGERD--------MDGFYYAVIKK 424


>gi|238792967|ref|ZP_04636597.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           intermedia ATCC 29909]
 gi|238727821|gb|EEQ19345.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           intermedia ATCC 29909]
          Length = 429

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 119/456 (26%), Positives = 211/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L         + +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPGL-----QKNISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ + + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRIFHYLIMIGLYQLVYTRIPPHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNDSRYLHPSWLLARIKQAYPDQWQQIVDANNQKPPM 174

Query: 177 YIDL-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +                P ++  LPGF  G   VQDAS
Sbjct: 175 WLRVSRLHHTRGEYLDLLKEAGIDAEPHAYYPDAVRLITPCAVSDLPGFELGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL ++  NL RL 
Sbjct: 235 AQGCVDLLDPQNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLSRVNENLQRLK 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A  +   D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI   A  Q
Sbjct: 295 LHAV-VRVGDGRTPETWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIADLAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+      ELV   +         
Sbjct: 354 SEIIEAIWPRLKKGGVMVYATCSILPEENQQQIAAFLQRH-SDAELVETGTNTAPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------KQNLPHPEDGDGFFYAKLFK 428


>gi|153809822|ref|ZP_01962490.1| hypothetical protein RUMOBE_00203 [Ruminococcus obeum ATCC 29174]
 gi|149834000|gb|EDM89080.1| hypothetical protein RUMOBE_00203 [Ruminococcus obeum ATCC 29174]
          Length = 450

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 103/465 (22%), Positives = 198/465 (42%), Gaps = 39/465 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M SG+N R +   +L  +  +       +      S ++ L ++++  +  +   TL + 
Sbjct: 1   MTSGINTREMIMEILLQIDEEGEHSHIAIRNAL--SKYQFLPKQERAFITRVCEGTLEYR 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID ++D      + + K  ++++LR +V Q+ ++D V D AV + AV+ A++ K   +
Sbjct: 59  ILIDYIIDSFSKIPVDKMKPPIREILRSAVYQLKFMDRVPDSAVCNEAVKLAQK-KGFYN 117

Query: 120 FAKLVNSILRRVSREKIELLQRI---------AGISIIPEWFKERLENFYGKERVLAISD 170
               VN +LR V+R+  EL             +    +PE   ER    YG+E    +  
Sbjct: 118 LKPFVNGVLRTVARQMDELEYPPREENLVRYLSVRYSMPEELVERWLADYGEETTEKMLA 177

Query: 171 ACISPLYIDLTVKFDIETWAHKLN---------AVMLPTGGIRLKELPESIVSLPGFAEG 221
             +    + +  +  + +                        +       I++L  F +G
Sbjct: 178 DFLEEKPVTVRCRTYLNSVDKICESLKNQGVKVEQAPYLPYAKRISGYNHILALDAFIQG 237

Query: 222 VWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVT---ALDVSKRRLEK 278
              VQD S+ +  ++        V+D+CAAPGGK+  +           A D+S+ ++  
Sbjct: 238 KMVVQDVSSMLVAEIANPQKGDYVIDMCAAPGGKSLHIGDKMEGFGTVDARDISQYKVNL 297

Query: 279 LRCNLDRLHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
           +  N+ RL+         DA  +    +   D VL D PCS  G I + P++ +   T  
Sbjct: 298 IEENIQRLNSINVQAKVQDATIFDVESECKADIVLADVPCSGYGVIGKKPEIKYRSTTQK 357

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
             +    QR +L +   +VKP G++VFS C++ K+++EE +   + + P  +E +     
Sbjct: 358 EEELVILQRTILDKAAEYVKPRGVLVFSTCTIAKEENEENMMWFMNNHPFKLESID---- 413

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            +   ++    +  G++++ P +         G DGFF    RR 
Sbjct: 414 EFIPEELRSETTGLGYLQMLPGV--------HGTDGFFIARFRRK 450


>gi|312898700|ref|ZP_07758090.1| ribosomal RNA small subunit methyltransferase B [Megasphaera
           micronuciformis F0359]
 gi|310620619|gb|EFQ04189.1| ribosomal RNA small subunit methyltransferase B [Megasphaera
           micronuciformis F0359]
          Length = 441

 Score =  264 bits (674), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 110/461 (23%), Positives = 186/461 (40%), Gaps = 44/461 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  + H L  V +       ++        F   + RD+     +V  TLR L  +D
Sbjct: 1   MNVREAAFHSLIAVCKDGAYSNIVVSKIIQKEKF---TDRDRRFYTELVYGTLRSLNYVD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            ++  +              +LR+ + Q+ ++D V   A  + AV+ A+R   N   AK 
Sbjct: 58  YIIGILSSRKKNSLDPVCLAVLRMGLYQLFFMDKVPPSAACNEAVKLARRF-GNEGMAKF 116

Query: 124 VNSILRR---------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACIS 174
           VN++LR          +       +  ++       W  E+    +G++  + +     +
Sbjct: 117 VNALLRNSLRQKERLAIPTFDENPVLHLSLTWHQQSWLIEKWITEFGRDHTVTLCRYFDT 176

Query: 175 PLYIDLTVKF---DIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWV 225
              + +       D E     L+   +P                  I  L   A+G+  +
Sbjct: 177 VPELCIRANTERIDREGLMKLLSEKGIPCRPAEHAPDGIYAEKNPGIHKLTEIADGLGLI 236

Query: 226 QDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCN 282
           QD  + +   +        + D+CAAPGGKT  L   G K     A D+ + +L+ +  N
Sbjct: 237 QDEPSQLVAAIADPQEKTVIFDVCAAPGGKTTHLATLGTKSSTVYAFDIYEHKLKLIEDN 296

Query: 283 LDRLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKS 340
           ++RL L        D            D VLVDAPCS  G +R  PD+ W +  +D+   
Sbjct: 297 VNRLGLKNVRTRLQDGTSVGEIYPEKADCVLVDAPCSGLGILRHKPDLRWRKTVEDLTVF 356

Query: 341 ACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKS 400
              Q+K+L      VKPGG +V+S C++++ ++E++V     S     E+VP+ +A+  S
Sbjct: 357 PPLQKKILESAAKCVKPGGTLVYSTCTMNRAENEDIVNAFRISHK-DFEVVPVGNAFGFS 415

Query: 401 IDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            D         ++ I P           G+DGFF   LRR 
Sbjct: 416 KDSD-------YLSILPQD--------DGLDGFFIAKLRRK 441


>gi|300718674|ref|YP_003743477.1| 16S rRNA methyltransferase B [Erwinia billingiae Eb661]
 gi|299064510|emb|CAX61630.1| 16S rRNA methyltransferase B [Erwinia billingiae Eb661]
          Length = 429

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 116/456 (25%), Positives = 213/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++  +  V+ +  SL+ +L      +A + ++++D  L++ +    LR L
Sbjct: 1   MKKNTNLRSIAAQTIEKVVEQGQSLSNVLP-----AAQKSVAEKDAALLQELCYGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++ ++  ++   +  K+ ++  L+ V + Q+++  +  +A +   VE A   K  + F
Sbjct: 56  PQLEWIIGQLMERPMTGKQRTIHFLVMVGLYQLIFTRIPAHAALAETVEGASSLKR-QQF 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGK-ERVLAISDACISPL 176
             L+N +    +R   E ++ +       +  +W  ERL+  +      +  ++    P+
Sbjct: 115 KGLINGVLRQFQRKQDELVQQMNVGDQKYLHSKWLLERLKRAWPNNWEAIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +       + W   L           L       E P  +  LPGF +G   VQDAS
Sbjct: 175 WLRVNRQHHSRDAWLKLLQEAGKEAEPHPLHADALRLETPCPVSQLPGFDQGWVTVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N  S+LDLCAAPGGKT  ++ +  +  V A+D+ ++RL ++  NL RL+
Sbjct: 235 AQGCVALLDPQNGESILDLCAAPGGKTTHILEAAPQATVLAVDIDEQRLARINENLLRLN 294

Query: 288 LYAEDIIEMDAF---DYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + AE +   D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MTAE-VKVGDGCLPETWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           +++L      +KPGG ++++ CS+  +++   V   L      +     ++ +       
Sbjct: 354 QQILDAIWPHLKPGGTLLYATCSILPEENHLQVAAFLERHEDAMLSDTGDANHP------ 407

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                   +++ P             DGFF   L +
Sbjct: 408 -------GLQVFP--------APQDGDGFFYAKLLK 428


>gi|168207268|ref|ZP_02633273.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens E str. JGS1987]
 gi|169342659|ref|ZP_02629420.2| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens C str. JGS1495]
 gi|169299165|gb|EDS81235.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens C str. JGS1495]
 gi|170661376|gb|EDT14059.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens E str. JGS1987]
          Length = 442

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/459 (23%), Positives = 200/459 (43%), Gaps = 42/459 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR +   +L  V+         ++ ++  +    +  +D+ L+  +V  T+++   ID
Sbjct: 1   MNARKIIVEILDNVLLNGAYSNIEINKQFASN---DIDPKDKGLITEVVYGTIKYKKMID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +L   +   + +   S+  +LR ++ Q+ +LD V  YA+V+ AV   K      + AK 
Sbjct: 58  IILSSFVA-DIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKET--EPNLAKF 114

Query: 124 VNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR   R + +  +                 W  E     YGKE  L I     +  
Sbjct: 115 VNGVLRNYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKEYALRILRGLNTIP 174

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWVQD 227
           Y+ + V     D +    +L                 + +   +I     + EG+  VQD
Sbjct: 175 YVTVRVNTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            SA +   LF    +  V+DLC+APG K   +   +++  KV A D+   +L  ++ N+D
Sbjct: 235 ESAMLVAPLFDLKGDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLALIKENID 294

Query: 285 RLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL L   ++   DA     K     D VL+D PCS  G IR+ P++ W +  +D+ +   
Sbjct: 295 RLGLTNVEVELGDATKINSKYINWADRVLLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVK 354

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+++L    ++++ GG +V+S C+L+K+++EEV+   +  +             +    
Sbjct: 355 VQKEILKNAWNYLREGGELVYSTCTLNKKENEEVIDWFVERNSDCEV-----EKVFLGKA 409

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +  +  G + I P+           MDGFF   L++ 
Sbjct: 410 DNVVYNDNGSVTILPNKY---------MDGFFIAKLKKK 439


>gi|332090533|gb|EGI95631.1| ribosomal RNA small subunit methyltransferase B [Shigella boydii
           3594-74]
          Length = 454

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 116/456 (25%), Positives = 210/456 (46%), Gaps = 46/456 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
              N R +++  +  V+ +  SL+ +L         + +S +D+ L++ +    LR L +
Sbjct: 28  KQRNLRSMAAQAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTLSQ 82

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           +D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +    
Sbjct: 83  LDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-LKG 141

Query: 123 LVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYID 179
           L+N +LR+  R++ E            + P W  +RL+  Y  E+  +I +A      + 
Sbjct: 142 LINGVLRQFQRQQEELLAKFNASDARYLHPSWLLKRLQKAYP-EQWQSIVEANNQRPPMW 200

Query: 180 LTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASA 230
           L V       ++W   L+   +                P  + +LPGF +G   VQDASA
Sbjct: 201 LRVNRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDASA 260

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHL 288
              +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL +
Sbjct: 261 QGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRLGM 320

Query: 289 YAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
            A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q 
Sbjct: 321 KAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQLQS 379

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++  
Sbjct: 380 EILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------ELCE 425

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +PE          ++    +   DGFF   L + 
Sbjct: 426 TGTPE-------QPGKQNLPGAEEGDGFFYAKLIKK 454


>gi|228909690|ref|ZP_04073513.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis IBL 200]
 gi|228849979|gb|EEM94810.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis IBL 200]
          Length = 429

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 197/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAIATSHPVWLVQEWTSAYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNE 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GEAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFSNETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQLAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V+ K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIDKFLKEHP---EFEWDTTIKERMPEKLSPYINEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|229111336|ref|ZP_04240889.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           Rock1-15]
 gi|228672112|gb|EEL27403.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           Rock1-15]
          Length = 429

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 198/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAITTSHPVWLVQEWTSEYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNT 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFSNETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQIAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V++K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMPEKLTPYIDEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|319899453|ref|YP_004159550.1| SUN-family protein [Bartonella clarridgeiae 73]
 gi|319403421|emb|CBI76989.1| SUN-family protein [Bartonella clarridgeiae 73]
          Length = 455

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 191/444 (43%), Positives = 262/444 (59%), Gaps = 9/444 (2%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
            G+  R V   LL  V+ K   L+ L D EYG   +  LS RD++L RAI+   LR   +
Sbjct: 15  PGLVVRQVCVRLLGAVLDKHTPLSGLTDNEYGHPQYLGLSYRDRLLCRAILGAALRHRSQ 74

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           I   L   L   LP + +SL  LL +S+ QILYLDV D+A +DLAV  AK D   R F+ 
Sbjct: 75  ITVALSRFLTRPLPSQAFSLHHLLHISITQILYLDVPDHAAIDLAVRVAKIDPRMRRFSG 134

Query: 123 LVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV 182
           LVN+ILR  +RE   L  +   I  IP WF+  L + YG E+   I         +DLTV
Sbjct: 135 LVNAILRNFAREAAILRVQTPTIKAIPTWFERLLVSTYGAEKADQIVAIQSIIPPLDLTV 194

Query: 183 KFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNN 242
           K D   WA +L  ++LP G +RL     SI  LPG+AEG WWVQD +A++P  L G ++ 
Sbjct: 195 KSDSAGWAKQLGGIVLPNGSVRLVSSAYSITDLPGYAEGAWWVQDVAAALPACLLGNIHG 254

Query: 243 LSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC 302
             V DLCA+PGGKTAQL++ GA VTA+D+S  RL++L+ N+DRL+         D   + 
Sbjct: 255 KKVADLCASPGGKTAQLVLQGADVTAIDISANRLKRLKENMDRLNFS-VRYWLGDVRQFH 313

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
           P +LFDAVL+DAPCSSTGTIRRHPD+LW +  DD+ K A  Q  LLL  I+ +K  G ++
Sbjct: 314 PDQLFDAVLLDAPCSSTGTIRRHPDILWIKTMDDVTKLAEMQYDLLLAAIALLKKNGRII 373

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           FSNCSL +++ E++V+K+L +    + L P+ +   +   MA  LS +G++R  P     
Sbjct: 374 FSNCSLAREEGEDLVEKILSTRH-DIVLEPILAE--EMGAMAHLLSIKGFLRTIPSDFCD 430

Query: 423 IDGVSS-----GMDGFFAVALRRL 441
            +  +      GMDGFFA   R++
Sbjct: 431 ENFNTEEKLFLGMDGFFAARFRKV 454


>gi|332996759|gb|EGK16384.1| ribosomal RNA small subunit methyltransferase B [Shigella flexneri
           K-272]
          Length = 429

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 118/458 (25%), Positives = 213/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++H +  V+ +  SL+ +L         + +S +D+ L++ +    LR L
Sbjct: 1   MKKQRNLRSMAAHAVEQVVEQGQSLSNILP-----PLQQKVSDKDKALLQELCFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
            ++D +++ ++   +  K+ ++  L+ V + Q+LY  +  +A +   VE A   K  +  
Sbjct: 56  SQLDWLINKLMARPMTGKQRTVHYLIMVGLYQLLYTRIPPHAALAETVEGAIAIKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +LR+  R + E            + P W  +RL+  Y  E+  +I++A      
Sbjct: 115 KGLINGVLRQFQRRQEELLAEFNTRDARYLHPSWLLKRLQKAYP-EQWQSIAEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L +       ++W   L+   +                P  + +LPGF +G   VQDA
Sbjct: 174 MWLRINRTHHSRDSWLALLDEAGMKGFPHADYPDAVRLETPAPVHALPGFEDGWVTVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   +      N   +LDLCAAPGGKT     +   A+V A+D+ ++RL ++  NL RL
Sbjct: 234 SAQGCMTWLAPQNGEHILDLCAAPGGKTTHILEVAPEAQVVAVDIDEQRLSRVYDNLKRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            + A  + + D      +C ++ FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 294 GMKAT-VKQGDGRYPSQWCGEQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIPELAQL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q ++L      +K GG +V++ CS+  +++   ++  L+ +                 ++
Sbjct: 353 QSEILDAIWPHLKSGGTLVYATCSVLPEENSLQIKAFLQRTADA--------------EL 398

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
               +PE          ++    +   DGFF   L + 
Sbjct: 399 CETGTPE-------QPGKQNQPGAEEGDGFFYAKLIKK 429


>gi|228940953|ref|ZP_04103512.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228973882|ref|ZP_04134458.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980472|ref|ZP_04140782.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis Bt407]
 gi|228779292|gb|EEM27549.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis Bt407]
 gi|228785907|gb|EEM33910.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818789|gb|EEM64855.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar berliner ATCC 10792]
          Length = 429

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 197/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAIATSHPVWLVQEWTSAYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNT 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQLAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V+ K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIDKFLKEHP---EFEWDTTIKERMPEKLSPYINEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|28899818|ref|NP_799423.1| Sun protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|260362016|ref|ZP_05775021.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus K5030]
 gi|260876497|ref|ZP_05888852.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AN-5034]
 gi|260897446|ref|ZP_05905942.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus Peru-466]
 gi|46396865|sp|Q87KD3|RSMB_VIBPA RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|28808070|dbj|BAC61307.1| Sun protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|308087890|gb|EFO37585.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus Peru-466]
 gi|308090396|gb|EFO40091.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AN-5034]
 gi|308114191|gb|EFO51731.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus K5030]
          Length = 427

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 124/452 (27%), Positives = 209/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGKERVLAIS-DACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L++ Y ++    +  +   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQDAYPQQWESIVDANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAAPCDVMKLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLTK 424


>gi|313894854|ref|ZP_07828414.1| ribosomal RNA small subunit methyltransferase B [Selenomonas sp.
           oral taxon 137 str. F0430]
 gi|312976535|gb|EFR41990.1| ribosomal RNA small subunit methyltransferase B [Selenomonas sp.
           oral taxon 137 str. F0430]
          Length = 451

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/458 (24%), Positives = 193/458 (42%), Gaps = 41/458 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
             R ++  +L+ V          L      +    L  RD+  +  +V  T++    +D 
Sbjct: 13  PVRELAMQVLTEVHVDGAYANVALVRAMRAAK---LPDRDRRFLTELVYGTVKAGDTLDY 69

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           +L   L     R K  +++LLR+ + QI ++D V   A  + AVE AK+    R     V
Sbjct: 70  ILAKYLRDGKARIKPQIRELLRLGIYQIFFMDKVPASAACNTAVELAKKH-GKRGADSFV 128

Query: 125 NSI-------LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N++         R +       + +A  +  P W   R  + YG +R   +         
Sbjct: 129 NAVLRTAVREPERAAIPAGRSARLLALRAQHPFWMVNRWVSLYGYDRAEELCRCNNERAP 188

Query: 178 IDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWVQDA 228
           + L V     D E    KL A               +     ++ +L    EG+  VQD 
Sbjct: 189 LSLRVNTLRIDREGLLEKLAAAGAQARPSATVPDGIVVTSHGTLDALAPLREGLCQVQDE 248

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDR 285
           S+ +   + G    ++V+D CAAPGGKT      + +  K+ A DV + ++ ++  N  R
Sbjct: 249 SSMLVAHVLGAAPGMTVIDACAAPGGKTTHIAQRMENRGKIYAFDVYEGKIARIENNARR 308

Query: 286 LHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L +   +   +DA +   +     D VL+DAPCS  G +RR PD  W R  +++      
Sbjct: 309 LGIDIIETWMLDAREIGARCAGTADRVLIDAPCSGFGVLRRKPDARWRRKPEELGALPKL 368

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L    + V+PGG +V+S C+++  ++E VVQ+ L   P  V              +
Sbjct: 369 QQEILAGAAAAVRPGGALVYSTCTMETAENEGVVQRFLELHPEFV-------LERAGAFL 421

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            +  + +  ++I P           G DGFF   ++RL
Sbjct: 422 PVQQTEDAMVQIFP--------TEDGGDGFFIARMKRL 451


>gi|229129141|ref|ZP_04258114.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           BDRD-Cer4]
 gi|228654378|gb|EEL10243.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           BDRD-Cer4]
          Length = 429

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 199/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAITTSHPVWLVQEWTSEYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A +       ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKLGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNT 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQIAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V++K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMPEKLTPYIDEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|18310723|ref|NP_562657.1| RNA-binding Sun protein [Clostridium perfringens str. 13]
 gi|18145404|dbj|BAB81447.1| probable RNA-binding Sun protein [Clostridium perfringens str. 13]
          Length = 442

 Score =  264 bits (673), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 108/459 (23%), Positives = 200/459 (43%), Gaps = 42/459 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR +   +L  V+         ++ ++  +    +  +D+ L+  +V  T+++   ID
Sbjct: 1   MNARKIIVEILDNVLLNGAYSNIEINKQFASN---DIDPKDKGLITEVVYGTIKYKKMID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +L   +   + +   S+  +LR ++ Q+ +LD V  YA+V+ AV   K      + AK 
Sbjct: 58  IILSSFVA-DIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKET--EPNLAKF 114

Query: 124 VNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           +N +LR   R + +  +                 W  E     YGKE  L I     +  
Sbjct: 115 INGVLRNYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKEDALRILRGLNTVP 174

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWVQD 227
           Y+ + V     D +    +L                 + +   +I     + EG+  VQD
Sbjct: 175 YVTVRVNTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            SA +   LF    +  V+DLC+APG K   +   +++  KV A D+   +L  ++ N+D
Sbjct: 235 ESAMLVAPLFDLKGDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLALIKENID 294

Query: 285 RLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL L   ++   DA     K     D +L+D PCS  G IR+ P++ W +  +D+ +   
Sbjct: 295 RLGLTNVEVELGDATKINSKYINWADRILLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVK 354

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+++L    ++++ GG +V+S C+L+K+++EEV+   +  +             +    
Sbjct: 355 VQKEILKNAWNYLREGGELVYSTCTLNKKENEEVIDWFVERNSDCEV-----EKVFLGKA 409

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +  +  G + I P+           MDGFF   L++ 
Sbjct: 410 DNVVYNDNGSVTILPNKY---------MDGFFIAKLKKK 439


>gi|114561210|ref|YP_748723.1| sun protein [Shewanella frigidimarina NCIMB 400]
 gi|114332503|gb|ABI69885.1| sun protein [Shewanella frigidimarina NCIMB 400]
          Length = 427

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 125/450 (27%), Positives = 201/450 (44%), Gaps = 35/450 (7%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++  +  V+ K ISL+  L  +         + +D+ L+  +    +R LP++D
Sbjct: 1   MNVRALAAKAIYEVLEKGISLSVALPDQQQHLQ----NGKDKALLAELCYGVMRQLPQLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
             +   L      K+  L QLL V   Q+ +  +  +A +    E A R        K+V
Sbjct: 57  KCVSDCLAKPFKGKQRILHQLLIVGCYQLYFTRIPAHAAISETAE-ACRQLRFDGLVKVV 115

Query: 125 NSILRRVSREKIELLQRIAG-ISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVK 183
           N +LR + R+  EL           P WF + L+  Y       I  +   P       +
Sbjct: 116 NGVLRNIQRQDSELNTDSDTLRFNTPAWFIKHLQQAYPDNWQDIIEQSHQRPPMWLRNNQ 175

Query: 184 FD-------IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQL 236
                         H ++A    +    L E  + + +LP F EG   VQD +A     L
Sbjct: 176 QSQTCDAYLAALAQHDISAQAGSSPNAILLESAKDVAALPDFMEGAASVQDGAAQWAATL 235

Query: 237 FGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA--ED 292
                +  VLD CAAPGGK+     +     + A+D  ++RL +++ NLDRLHL A    
Sbjct: 236 LAPTADELVLDACAAPGGKSCHLLELAPTINLVAVDFDQKRLARVQQNLDRLHLKAQLIH 295

Query: 293 IIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGI 352
               D   +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q+++L    
Sbjct: 296 GDAADIPSWWQGQQFDRILLDAPCSATGVIRRHPDIKWLRKNSDIEELANLQKQILDHCW 355

Query: 353 SFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGW 412
            ++KPGG ++++ CS+  Q++ + V++ L  +     LVP+        +    +S  GW
Sbjct: 356 QWLKPGGTLLYATCSILPQENSQQVEQFLART-ADASLVPI--------EQQAHISDIGW 406

Query: 413 IRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
            +I P            MDGF+   L + I
Sbjct: 407 -QILPG--------QDNMDGFYYARLVKAI 427


>gi|85858797|ref|YP_460999.1| 16S rRNA m(5)C 967 methyltransferase [Syntrophus aciditrophicus SB]
 gi|85721888|gb|ABC76831.1| 16S rRNA m(5)C 967 methyltransferase [Syntrophus aciditrophicus SB]
          Length = 471

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 105/464 (22%), Positives = 197/464 (42%), Gaps = 41/464 (8%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
            ++ R ++  +L  +         LLD    D      S  D+ L+ ++V  TLR   R+
Sbjct: 21  KISPRSLAVEILDRIDTTGAFAEPLLDAFLRDHLLD--SAPDRHLLTSLVYGTLRMRGRL 78

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENR---- 118
           D ++  +        +  ++ +LR ++ Q L++  +  +A+VD AVE AK     R    
Sbjct: 79  DWIIQQLYQGRFSSMQGGIRNILRTALYQFLFMERIPAFALVDEAVELAKLRYPGREKLV 138

Query: 119 -----HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACI 173
                +  + V++        +   ++ IA +   P W   R  + YG ER  ++  A  
Sbjct: 139 NALLRNAVRKVSANELSYPDFQKTPVEHIAVMHSHPPWLVRRWLSVYGTERCRSLCMANN 198

Query: 174 SPLYIDLTVK---FDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGF-------AEGVW 223
               + + V     D  T    L                  I   P          EG++
Sbjct: 199 QVPPVAIRVNSLKADRSTLKEILEHEGFTVSESSFSPDALLITDPPRHLRLTSTSREGLF 258

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLR 280
            +QD ++ +  +L       ++LD+C   G KT  L   + +  ++ A+D+   +LE L 
Sbjct: 259 ILQDEASQLIGRLVAPAAGEAILDVCCGTGVKTTHLASLMSNQGRILAVDLYPAKLEALN 318

Query: 281 CNLDRLHLYAEDIIEMDAFDYCPK----KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDD 336
               R+ +   +I + DA     +     +FD +LVDAPCS  GT+RR+P++ W      
Sbjct: 319 RLSSRMGISNIEIRQADASTMEDETAFRNMFDRILVDAPCSGLGTLRRNPEIKWRLQPRA 378

Query: 337 IVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSA 396
           +   +  Q ++L +  +F+  GG +V+S C++  +++E ++ K L       ++   +++
Sbjct: 379 LPSYSRLQEQILNRAAAFLHRGGCLVYSTCTILPEENELLIGKFLSRHDEFRQIRLSDAS 438

Query: 397 YWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
           +         +   G+ R  PD        +SGMDGFFA  L +
Sbjct: 439 FA----YPTLVDENGFFRTAPD--------TSGMDGFFAALLTK 470


>gi|90406716|ref|ZP_01214909.1| sun protein [Psychromonas sp. CNPT3]
 gi|90312169|gb|EAS40261.1| sun protein [Psychromonas sp. CNPT3]
          Length = 434

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 120/456 (26%), Positives = 213/456 (46%), Gaps = 44/456 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R +++ +L+ V+ +  SL+  L +       + L+ +D+ L++ +    LR LPR+D
Sbjct: 1   MNVRALAAQVLNLVVEQGQSLSQALPVL-----QKDLTPKDKALLQVLCYGVLRTLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
                ++   L  K+     L+ V + Q+LY  +  +A V   V  AK   + +    +V
Sbjct: 56  FFCRSLMQKPLKGKQRVFHFLILVGIYQLLYTRIPSHAAVGETVNGAKALNK-QALKGMV 114

Query: 125 NSILRRVSREKIELLQRIAGI----SIIPEWFKERLENFYGKERV--LAISDACISPLYI 178
           N +LR   RE+  L+++           P W  +RL++ YGKE+   + + +   +P+++
Sbjct: 115 NGVLRNFLREQEALIEKADQQDTLLYCHPGWLVKRLQSAYGKEKAASIMLENNQQAPMWL 174

Query: 179 DLTV-KFDIETWAHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDAS 229
            +     D++++   L         A+          +    +  LPGF +G   VQD +
Sbjct: 175 RVNALHHDVKSYQALLTEKDLGSRLALDSENKNALCLDKATDVYQLPGFEDGWVSVQDGA 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA---KVTALDVSKRRLEKLRCNLDRL 286
           A +            VLD CAAPGGKT   +       ++ A+D   +RL ++R NL+RL
Sbjct: 235 AQLAAHYLDAQPGDLVLDACAAPGGKTVHSLERQPKIAQMVAVDADDKRLVRVRENLERL 294

Query: 287 HLYAEDII--EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           +L A  I         +   + FD +L DAPCS+TG IRRHPD+ W R   DI +    Q
Sbjct: 295 NLTATVIHGDASTPDVWWKGEKFDRILCDAPCSATGVIRRHPDIRWLRRDSDIKELVSLQ 354

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           + +L      +K GGI++++ CS+   +++  ++  L +     +LVPL+  Y  +    
Sbjct: 355 KSILNALWDKLKAGGILLYATCSILPDENDLQIKAFLETH-ADAKLVPLSKQYASTTV-- 411

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                    ++ P+           MDGF+   L++
Sbjct: 412 -------GRQLLPND--------DTMDGFYYAKLQK 432


>gi|229541137|ref|ZP_04430197.1| sun protein [Bacillus coagulans 36D1]
 gi|229325557|gb|EEN91232.1| sun protein [Bacillus coagulans 36D1]
          Length = 447

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 123/466 (26%), Positives = 203/466 (43%), Gaps = 46/466 (9%)

Query: 1   MKS-GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           M     N R  +  LL  V +       LLD       F      D+ L+  I   TL+ 
Sbjct: 1   MSKERKNVREAALELLEAVEKNESYSNLLLDRYIEKYRFHG---PDRALLTEITYGTLQR 57

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENR 118
              +D  L   L   +      ++ LLR+S+ Q++YLD + D A++  AVE AK+ + +R
Sbjct: 58  KQTLDYFLAPFLRKKIEN---WVRILLRLSLYQMVYLDKIPDRAIIFEAVEIAKK-RGHR 113

Query: 119 HFAKLVNSILR-------RVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
             + +VN +LR       R  +E  + L+R++  +  P W   R    YG +    + +A
Sbjct: 114 GISGIVNGVLRAIQRGGLRSLKEIEDPLERLSVATSHPHWLVARWAEAYGYKTTKEMCEA 173

Query: 172 CISPLYIDLTVKFDI---ETWAHKLNAVMLPTGGIRLKE-----LPESIVSLPGFAEGVW 223
            + P      V  +    +    KL           +          ++     F EG++
Sbjct: 174 NLIPPLQTARVNLNRASVDEVIEKLEREGFTVERSPVIPEAVRSRKGNLARSACFKEGLF 233

Query: 224 WVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLR 280
            +QD S+              +LD CAAPGGKT  +        +V ALD+   +++ ++
Sbjct: 234 TIQDESSMAVAYALCIQEGQRILDACAAPGGKTTHIAEKLEGTGEVVALDLHPHKVKLVQ 293

Query: 281 CNLDRLH---LYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
            N +RL    + A  +   DA     K  FD +LVDAPC+  G +RR PD+ + +  DDI
Sbjct: 294 ENAERLGTGQVEAIAMDSRDAGARFEKNTFDRILVDAPCTGFGVLRRKPDIKYAKTVDDI 353

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
                 Q  +L      +KP GI+VFS C++D++++E  ++  L+  P   E  PL+   
Sbjct: 354 HALKQVQLSILSGVSELLKPDGILVFSTCTVDREENEGTIETFLQEHP-EFEPYPLH--- 409

Query: 398 WKSIDMAMALSPEGW-IRITPDMLEKIDGVSSGMDGFFAVALRRLI 442
              +  AM    +G+ ++I P           G DGFF  ++R+  
Sbjct: 410 ---VPEAMESCVDGYRMQIFPQDF--------GGDGFFIASIRKKA 444


>gi|313901450|ref|ZP_07834907.1| sun protein [Thermaerobacter subterraneus DSM 13965]
 gi|313468278|gb|EFR63735.1| sun protein [Thermaerobacter subterraneus DSM 13965]
          Length = 488

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 108/442 (24%), Positives = 172/442 (38%), Gaps = 38/442 (8%)

Query: 24  SLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPRKKYSLQ 83
            +   L      S    L  R++ L   +     R    +D  L         R    ++
Sbjct: 58  YVDQALARLLEGS---GLPARERALATELAYGVARRQGSLDWALARWARRPPERLDPPVR 114

Query: 84  QLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSREKIELL--- 139
             LR+   Q+ +LD + D+A V  +VE  +R     + A  VN++LRR +R         
Sbjct: 115 VALRLGAYQLWHLDRIPDHAAVAESVELVRRH-GPGYAAGFVNAVLRRAARHGFPHEAVP 173

Query: 140 -------QRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIET---- 188
                    +A     P W   R     G E    + +A      +   V          
Sbjct: 174 GAAEDLETHLALTLAHPRWLVRRWLERLGPEETRRLLEANNRIPPLSARVNMLRADPRSL 233

Query: 189 ----WAHKLNAVMLPTGGIRLKELPE-SIVSLPGFAEGVWWVQDASASIPVQLFGTLNNL 243
                A  +           L+     S   L  F +G    QD S+ + V +       
Sbjct: 234 AAALAAQGVAVEPGRFLPEALRLGHGVSPAELEAFQQGALTWQDESSMLAVHVLDPRPGQ 293

Query: 244 SVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
            VLD+ AAPGGK+  +   +    +V A DV   RLEK+R    RL L + + + +D   
Sbjct: 294 LVLDVAAAPGGKSTHMAERMGDRGRVVACDVDPGRLEKVRAAARRLGLRSVEPLALDGRL 353

Query: 301 YCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPG 358
              +     D VL D PCS  G I R PD+ W +  +D+   A  Q +LL    + +KPG
Sbjct: 354 LPERFAGQADRVLADVPCSGLGVIARRPDLRWRKTPEDLKALAALQGELLRAAAACLKPG 413

Query: 359 GIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPD 418
           G++V+S C+ + +++++VV+  LR        V L       +      +  GW+++ P 
Sbjct: 414 GVLVYSTCTTEPEENQQVVEGFLREGGDRFAAVDLRPRLPAPLRDEPG-TERGWLQLWPH 472

Query: 419 MLEKIDGVSSGMDGFFAVALRR 440
                     G+DGFF   L+R
Sbjct: 473 --------RHGVDGFFIACLQR 486


>gi|168210626|ref|ZP_02636251.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens B str. ATCC 3626]
 gi|168214218|ref|ZP_02639843.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens CPE str. F4969]
 gi|168217028|ref|ZP_02642653.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens NCTC 8239]
 gi|182625836|ref|ZP_02953602.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens D str. JGS1721]
 gi|170711319|gb|EDT23501.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens B str. ATCC 3626]
 gi|170714316|gb|EDT26498.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens CPE str. F4969]
 gi|177908870|gb|EDT71362.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens D str. JGS1721]
 gi|182380885|gb|EDT78364.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens NCTC 8239]
          Length = 442

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 110/459 (23%), Positives = 200/459 (43%), Gaps = 42/459 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR +   +L  V+         ++ ++  +    +  +D+ L+  +V  T+++   ID
Sbjct: 1   MNARKIIVEILDNVLLNGAYSNIEINKQFASN---DIDPKDKGLITEVVYGTIKYKKMID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +L   +   + +   S+  +LR ++ Q+ +LD V  YA+V+ AV   K      + AK 
Sbjct: 58  IILSSFVA-DIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKET--EPNLAKF 114

Query: 124 VNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR   R + +  +                 W  E     YGKE  L I     +  
Sbjct: 115 VNGVLRNYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKEDALRILRGLNTVP 174

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWVQD 227
           Y+ + V     D +    +L                 + +   +I     + EG+  VQD
Sbjct: 175 YVTVRVNTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            SA +   LF    +  V+DLC+APG K   +   +++  KV A D+   +L  ++ N+D
Sbjct: 235 ESAMLVAPLFDLKGDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLALIKENID 294

Query: 285 RLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL L   ++   DA     K     D VL+D PCS  G IR+ P++ W +  +D+ +   
Sbjct: 295 RLGLTNVEVELGDATKINSKYINWADRVLLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVK 354

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+++L    ++++ GG +V+S C+L+K+++EEV+   +  +             +    
Sbjct: 355 VQKEILKNAWNYLREGGELVYSTCTLNKKENEEVIDWFVERNSDCEV-----EKVFLGKA 409

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +  +  G + I P+           MDGFF   L++ 
Sbjct: 410 DNVVYNDNGSVTILPNKY---------MDGFFIAKLKKK 439


>gi|228960081|ref|ZP_04121745.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|229047552|ref|ZP_04193142.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           AH676]
 gi|229146436|ref|ZP_04274807.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           BDRD-ST24]
 gi|229152064|ref|ZP_04280259.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           m1550]
 gi|229192034|ref|ZP_04319004.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           ATCC 10876]
 gi|228591585|gb|EEK49434.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           ATCC 10876]
 gi|228631413|gb|EEK88047.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           m1550]
 gi|228637069|gb|EEK93528.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           BDRD-ST24]
 gi|228723799|gb|EEL75154.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           AH676]
 gi|228799597|gb|EEM46550.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar pakistani str. T13001]
          Length = 429

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 198/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAITTSHPVWLVQEWTSEYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNT 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQIAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V++K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMPEKLTPYIDEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|228954142|ref|ZP_04116170.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|229071363|ref|ZP_04204586.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           F65185]
 gi|229081120|ref|ZP_04213630.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           Rock4-2]
 gi|228702164|gb|EEL54640.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           Rock4-2]
 gi|228711817|gb|EEL63769.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           F65185]
 gi|228805462|gb|EEM52053.1| Ribosomal RNA small subunit methyltransferase B [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 429

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 198/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     SA   + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKSA---IDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAITTSHPVWLVQEWTSEYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKSGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNT 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKT  +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GDAVLDSCAAPGGKTTHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQIAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V++K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMPEKLTPYIDEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|186684748|ref|YP_001867944.1| sun protein [Nostoc punctiforme PCC 73102]
 gi|186467200|gb|ACC83001.1| sun protein [Nostoc punctiforme PCC 73102]
          Length = 487

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 126/498 (25%), Positives = 195/498 (39%), Gaps = 79/498 (15%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
            N R ++   L  V  K       LD          L  RD+ LV  +V  ++R    +D
Sbjct: 2   TNPRQLAFIALRDV-HKGAYADVALDRVLQKV---NLPDRDRRLVTELVYGSVRRQRTLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYL-DVADYAVVDLAVEQAKRDKENRHFAKL 123
            ++D    +   ++   L+ +L +   Q+ Y   +   A V+  V+ AK +         
Sbjct: 58  TLIDQFAKNKSHQQPQDLRTILHLGFYQLRYQERIPASAAVNTTVQLAKEN-GFSGLTGF 116

Query: 124 VNSILRRVSREKIELLQRIAG--------------------------------------- 144
           VN +LR+  R+  E   R AG                                       
Sbjct: 117 VNGLLRQYLRKAGEQGGRGAGGQRSRGAEEKDSLLVPVPQPPVPSTQAPVLNFDPLQLPE 176

Query: 145 --------ISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTV---KFDIETWAHKL 193
                   +   P+W  +      G      + +       IDL +      IE     L
Sbjct: 177 NPVERLGILHSFPDWIIQVWLEQLGLTETEQLCEWMNQSPTIDLRINPLCTSIEEVEAAL 236

Query: 194 NAVM-------LPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVL 246
            +V             +R      SI  LPGF EG W VQDASA +   L        V+
Sbjct: 237 QSVGLLVRRIPDLPQALRFMGNTGSIQKLPGFKEGWWTVQDASAQLVSHLLDPQPGEVVI 296

Query: 247 DLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYC- 302
           D+CAAPGGKT  +   +    K+ A D +  RL KL+ N  RL+L +  I   D+     
Sbjct: 297 DVCAAPGGKTTHIAELMADSGKIWACDRTASRLRKLQENSQRLNLQSIQIYTGDSRHSNQ 356

Query: 303 PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVV 362
            +   D VL+DAPCS  GT+ RH D  W +  + + + +  Q++LL    +FVK GG++V
Sbjct: 357 FQNTADRVLLDAPCSGLGTMHRHADARWRQTPESVRELSVLQKELLTHTSTFVKAGGVLV 416

Query: 363 FSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEK 422
           ++ C+L   ++EEV+   L  SP       +       +  +   +P+GW ++ P     
Sbjct: 417 YATCTLHPAENEEVISAFLAESPHWQ----IEPPRGIELAASAYSTPQGWFKVWPH---- 468

Query: 423 IDGVSSGMDGFFAVALRR 440
                  MDGF  V LR+
Sbjct: 469 ----RQDMDGFLMVRLRK 482


>gi|167768546|ref|ZP_02440599.1| hypothetical protein CLOSS21_03105 [Clostridium sp. SS2/1]
 gi|167710070|gb|EDS20649.1| hypothetical protein CLOSS21_03105 [Clostridium sp. SS2/1]
 gi|291560508|emb|CBL39308.1| ribosomal RNA small subunit methyltransferase RsmB
           [butyrate-producing bacterium SSC/2]
          Length = 447

 Score =  263 bits (672), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 114/460 (24%), Positives = 195/460 (42%), Gaps = 39/460 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R  +  +L  V +K       +        F    +RD+     +V  TL     ID 
Sbjct: 3   NPRECALDVLIKVDKKEELSHIAISNVLEKYQFS--EKRDRAFFTRLVEGTLERQITIDY 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           V D    + + + K  ++ LLR+ + QILY+D V D A  + AV+ AK+ +     +  V
Sbjct: 61  VADQFSKTKIRKCKPLIRALLRMGIYQILYMDQVPDSAACNEAVKLAKK-RGFSRLSGFV 119

Query: 125 NSILRRVSREKIELLQ---------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           N +LR +SR+K E+            ++    IPEW  +  +  Y  E V  I  + +  
Sbjct: 120 NGVLRNISRKKDEIQYPSREKNLETYLSVAYSIPEWIIKFFQKTYDNETVEKIIASYLEE 179

Query: 176 LYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKELPESIVS------LPGFAEGVWWVQ 226
               L         E    +L A  +      L E    I        L  F EG  +VQ
Sbjct: 180 RKTTLCCLISKGGKEAVRKELEAEGVTVEDGSLIENAVKISDYDFLYRLKAFREGSCYVQ 239

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNL 283
           D S+ +  +L        V+DLC+APGGK+  +        +V + D+++ + + +  N+
Sbjct: 240 DESSMLCAKLASVQKEQFVMDLCSAPGGKSLYVADQLKGSGRVLSRDLTEYKTDLIEDNI 299

Query: 284 DRLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           DR+     +    DA     +     D V+ D PCS  G + +  D+ +    + +    
Sbjct: 300 DRVGFTNMESEVFDARVLDEEHIEAADVVIADVPCSGLGIMGKKNDIKYHISEEGMKDLV 359

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             QR++L   + +VK GG +++S C+++  ++EE  + +L       E V +     K  
Sbjct: 360 KLQREILANAVQYVKHGGTLIYSTCTINPAENEENFRWILDHF--DFEAVDITKELPK-- 415

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           D+ +  + EG+I++ P +           DGFF   LRR 
Sbjct: 416 DLKIETAQEGFIQLLPGI--------HPCDGFFIGKLRRK 447


>gi|269967001|ref|ZP_06181071.1| sun protein [Vibrio alginolyticus 40B]
 gi|269828395|gb|EEZ82659.1| sun protein [Vibrio alginolyticus 40B]
          Length = 427

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 124/452 (27%), Positives = 208/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGKERVLAIS-DACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y ++    +  +   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVDANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAAPCDVMKLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLTK 424


>gi|229180141|ref|ZP_04307485.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           172560W]
 gi|228603350|gb|EEK60827.1| Ribosomal RNA small subunit methyltransferase B [Bacillus cereus
           172560W]
          Length = 429

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 112/447 (25%), Positives = 198/447 (44%), Gaps = 40/447 (8%)

Query: 18  VMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAVLDFVLISSLPR 77
           + +       LL+     S    + ++D  L+  IV  T++    +D  L   L   +  
Sbjct: 1   MEKSGAYSNLLLNNLIEKS---TIDRKDIGLLTEIVYGTIQRRDTLDYYLQPFLKKKVE- 56

Query: 78  KKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVNSILRRVSRE-- 134
               ++ LLR+S+ Q++YLD V + A +  AVE AKR + ++  A +VN +LR + RE  
Sbjct: 57  --AWVRVLLRLSLYQMIYLDRVPERAAIHEAVEIAKR-RGHKGIAGMVNGVLRSIQREGV 113

Query: 135 -----KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFDIETW 189
                  + ++R+A  +  P W  +   + YG E    + +  + P      V  D  T 
Sbjct: 114 PSVDEIKDPVERLAIATSHPVWLVQEWTSAYGLETAEKMCEVNMLPPVPTARVNVDKVTV 173

Query: 190 AHKLN--------AVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLN 241
              +         A         ++    ++     F +G   +QD S+ +  +      
Sbjct: 174 EEAIELLASEGIEAKRGDLSDDAIQIERGNVAHTEAFKKGFLSIQDESSMLVARALEPNT 233

Query: 242 NLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD- 297
             +VLD CAAPGGKTA +        KV +LD+   ++  ++   +RL L   +   +D 
Sbjct: 234 GDAVLDSCAAPGGKTAHIAERLKGTGKVMSLDLHAHKVRLIKQQAERLGLENVETKALDA 293

Query: 298 --AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFV 355
               ++   + FD +LVDAPCS  G IRR PD+   +D  D  + +  Q  +L +    +
Sbjct: 294 RKVQEHFANETFDKILVDAPCSGFGVIRRKPDIKLGKDKGDSERLSTIQIAILEKIAPLL 353

Query: 356 KPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRI 415
           K GG +V+S C+++K ++E+V++K L+  P   E     +   +  +       EG ++I
Sbjct: 354 KQGGRLVYSTCTIEKIENEQVIEKFLQEHP---EFEWDTTLKERMPEKLTPYIDEGQVQI 410

Query: 416 TPDMLEKIDGVSSGMDGFFAVALRRLI 442
            P             DGF+   LR+ +
Sbjct: 411 LPHYFA--------TDGFYIACLRKKV 429


>gi|16803862|ref|NP_465347.1| hypothetical protein lmo1822 [Listeria monocytogenes EGD-e]
 gi|224501376|ref|ZP_03669683.1| hypothetical protein LmonFR_02455 [Listeria monocytogenes FSL
           R2-561]
 gi|254829183|ref|ZP_05233870.1| sun protein [Listeria monocytogenes FSL N3-165]
 gi|254831576|ref|ZP_05236231.1| hypothetical protein Lmon1_09493 [Listeria monocytogenes 10403S]
 gi|16411276|emb|CAC99900.1| lmo1822 [Listeria monocytogenes EGD-e]
 gi|258601593|gb|EEW14918.1| sun protein [Listeria monocytogenes FSL N3-165]
          Length = 444

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 207/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ YLD V ++A+++ A + AK    ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTYLDKVPEHAILNEAGDIAKNM-GHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWADQYGIEQLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        E        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDE 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-DFTLEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + +I++ P  +        G DGFF  +LR++
Sbjct: 408 VLPEKLAQIKKDDFIQLLPTDI--------GSDGFFVSSLRKV 442


>gi|308188325|ref|YP_003932456.1| ribosomal RNA small subunit methyltransferase B [Pantoea vagans
           C9-1]
 gi|308058835|gb|ADO11007.1| Ribosomal RNA small subunit methyltransferase B [Pantoea vagans
           C9-1]
          Length = 433

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 125/458 (27%), Positives = 211/458 (46%), Gaps = 46/458 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   +N R +S+ L+  V+ K  SL   L      +A + LS +D  LV+ I    LR L
Sbjct: 1   MTKSINLRSLSAQLIERVVDKGESLNTALP-----AAQKKLSDKDSALVQEICFGVLRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+  L  L+ V + Q+ Y  V  +A +   V  A+  K     
Sbjct: 56  PQLEALIGRLMERPLTGKQRVLHYLIMVGLYQLEYTRVPAHAALAETVAGAEVLKRT-SL 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +    +R   E +  +Q      + P W  +RL++ + ++    +  +    P+
Sbjct: 115 KGLLNGVLRQFQRQREELLASIQDGPQRYLHPGWLLKRLQHAWPEQWQQIVEANNLRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +     + + W   L  +                  P  +  LPGF +G   VQD S
Sbjct: 175 WLRVNRQHHNRDAWLAMLVEIDRNAQPADDVPDALRLDAPAPVSQLPGFDQGWVTVQDLS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A     L    N   +LDLCAAPGGKT     I   A+V A+DV  +RL+++  NL RL 
Sbjct: 235 AQRCALLLEPQNGEQILDLCAAPGGKTTHILEIAPEAEVMAVDVDAQRLKRVEENLQRLG 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A D+ + D      +C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 MKA-DVKQGDGRTPQQWCGDRQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAKLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRS-SPIPVELVPLNSAYWKSIDM 403
            ++L      +KPGG ++++ CS+  +++ + ++  L+       E              
Sbjct: 354 SEILDAIWPHLKPGGTLIYATCSILPEENHQQIEAFLQRQHDAQAE-------------- 399

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ++  +P   +++ P         + G DGFF   L + 
Sbjct: 400 SLRGAPANGLQVFPQ--------AEGGDGFFYAKLIKK 429


>gi|239626556|ref|ZP_04669587.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47_FAA]
 gi|239516702|gb|EEQ56568.1| conserved hypothetical protein [Clostridiales bacterium 1_7_47FAA]
          Length = 447

 Score =  263 bits (671), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 112/454 (24%), Positives = 195/454 (42%), Gaps = 31/454 (6%)

Query: 4   GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRI 63
           GM  R +   +LS V+ K   +  +L+       ++ L + D+  +  +   TL +L +I
Sbjct: 9   GMENRGIVLDILSEVLDKGSFVHLVLNQALQ--KYQYLDKSDRAFITRVTEGTLEYLLQI 66

Query: 64  DAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAK 122
           D +++    +   + K  ++ LLR+SV QILY+D V D AV + AV+ A + +       
Sbjct: 67  DHIINKYSRTKTDKMKPLIRNLLRMSVYQILYMDRVPDSAVCNEAVKLAVKRRFT-GLKG 125

Query: 123 LVNSILRRVSREKIE-LLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLT 181
            VN +LR +SREK   +    +    IP+W  +  E  YG  +   I+ + +      + 
Sbjct: 126 FVNGVLRTISREKASLVFDSPSLAYSIPQWMYDMWEKEYGSAKAEMIAASFLEDRPTWVR 185

Query: 182 VKFD---IETWAHKLNAVMLPTGGIRLKELPESIV------SLPGFAEGVWWVQDASASI 232
                   E     L++  +    +       +I        L  F  G   VQDA+++ 
Sbjct: 186 CNLSRALREAILKSLDSQGVMVKELDCLPSVLAISGYDYMEGLECFQNGWIQVQDATSAF 245

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRLHLY 289
             +L        ++D+CAAPGGK+      +     V A D+S ++   +  N+ R    
Sbjct: 246 VGELADPKEGDYIIDVCAAPGGKSLHLADKMKGTGMVEARDLSYQKTALIEENVARSGAA 305

Query: 290 AEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKL 347
               +  DA        +  D V+ D PCS  G I + PD+ +    D + + +  QR +
Sbjct: 306 NIKAVVWDALVPDEDAREKADIVIADLPCSGLGIIGKKPDIKYNMTMDKMRELSRLQRDI 365

Query: 348 LLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMAL 407
           L     +VKPGG +V+S C++D  ++E     +  + P    L P++ +     D     
Sbjct: 366 LSVVWQYVKPGGTLVYSTCTIDPMENEGNAMWLSENFP----LEPVDLSGRLGEDFDEPS 421

Query: 408 SPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +G I+  P +           DGFF    RR+
Sbjct: 422 LKDGRIQFLPGI--------HPFDGFFISVFRRV 447


>gi|312113148|ref|YP_004010744.1| sun protein [Rhodomicrobium vannielii ATCC 17100]
 gi|311218277|gb|ADP69645.1| sun protein [Rhodomicrobium vannielii ATCC 17100]
          Length = 425

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 160/436 (36%), Positives = 242/436 (55%), Gaps = 13/436 (2%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           AR ++  LL  V+    S            AF  +  RD+   RAI  + LR L +++ +
Sbjct: 2   ARRLAVFLLKSVLHDHQSFDEAFAGSSARDAFAAMESRDRAFARAIATIALRRLGQVEDM 61

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVNS 126
           L   L   L    +  + +L     Q+ ++DVA +A + LAVEQAK  + +RH   L+N+
Sbjct: 62  LARFLEKPLAADAFEARAILIAGATQLAFMDVAPHAAIGLAVEQAKASRFSRHLGGLINA 121

Query: 127 ILRRVSREKIEL-LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDLTVKFD 185
           +LRRV+  K  +  ++ A +   P W  ER    YG+     I+ A +    +DL+VK D
Sbjct: 122 VLRRVNENKAAILSEQDAAVLNTPAWLWERWVAAYGEATAREITGAHLEEPPLDLSVKAD 181

Query: 186 IETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSV 245
             TWA KL   +LP G +RL      +  + G+AEG WWVQDA+A+IP  L G +    V
Sbjct: 182 AATWAAKLEGEVLPWGSVRLSH-KGRVEEIEGYAEGAWWVQDAAAAIPALLLGDIAGKRV 240

Query: 246 LDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKK 305
            DLCAAPGGKTAQL  +GA+VT++D+S  RL +L  N  RL L   +I++ +  D+ PK 
Sbjct: 241 ADLCAAPGGKTAQLAAAGAQVTSVDISASRLRRLGENAARLGLS-VEIVKANVGDWQPKD 299

Query: 306 LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSN 365
            F+A+L+DAPCS+TGTIRR+PD+ + +  +DI   A  Q++LL   ++ + PGG +VF+ 
Sbjct: 300 CFEAILLDAPCSATGTIRRNPDIAYLKTAEDIAALARVQKRLLAHALTLLAPGGTLVFAT 359

Query: 366 CSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDG 425
           CSL+ ++ E  +  +L      V L+P+++A          ++P G +R  P        
Sbjct: 360 CSLEPEEGEAQIAALLADR-ADVRLLPVDAAALNLP--PEVVTPNGCLRTLP-------F 409

Query: 426 VSSGMDGFFAVALRRL 441
            + GMDGFFA  L R+
Sbjct: 410 HAGGMDGFFAARLTRI 425


>gi|269962646|ref|ZP_06176991.1| sun protein [Vibrio harveyi 1DA3]
 gi|269832569|gb|EEZ86683.1| sun protein [Vibrio harveyi 1DA3]
          Length = 427

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 125/453 (27%), Positives = 210/453 (46%), Gaps = 44/453 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y  +   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPEQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLTLLKNENIDSTPHTQAMDALKLAAPCDVMKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +    +LV  +              
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLART-ANAQLVDSDPEQP---------- 403

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                +I P            MDGF+   L + 
Sbjct: 404 ---GRQILPG--------EEDMDGFYYAVLTKK 425


>gi|110800441|ref|YP_696427.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens ATCC 13124]
 gi|110675088|gb|ABG84075.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens ATCC 13124]
          Length = 442

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 110/459 (23%), Positives = 200/459 (43%), Gaps = 42/459 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR +   +L  V+         ++ ++  +    +  +D+ L+  +V  T+++   ID
Sbjct: 1   MNARKIIVEILDNVLLNGAYSNIEINKQFASN---DIDPKDKGLITEVVYGTIKYKKMID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +L   +   + +   S+  +LR ++ Q+ +LD V  YA+V+ AV   K      + AK 
Sbjct: 58  IILSSFVA-DIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKET--EPNLAKF 114

Query: 124 VNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR   R + +  +                 W  E     YGKE  L I     +  
Sbjct: 115 VNGVLRNYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKEDALRILRGLNTVP 174

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWVQD 227
           Y+ + V     D +    +L                 + +   +I     + EG+  VQD
Sbjct: 175 YVTVRVNTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            SA +   LF    +  V+DLC+APG K   +   +++  KV A D+   +L  ++ N+D
Sbjct: 235 ESAMLVAPLFDLRGDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLALIKENID 294

Query: 285 RLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL L   ++   DA     K     D VL+D PCS  G IR+ P++ W +  +D+ +   
Sbjct: 295 RLGLTNVEVELGDATKINSKYINWADRVLLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVK 354

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+++L    ++++ GG +V+S C+L+K+++EEV+   +  +             +    
Sbjct: 355 VQKEILKNAWNYLREGGELVYSTCTLNKKENEEVIDWFVERNSDCEV-----EKVFLGKA 409

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +  +  G + I P+           MDGFF   L++ 
Sbjct: 410 DNVVYNDNGSVTILPNKY---------MDGFFIAKLKKK 439


>gi|300721396|ref|YP_003710667.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Xenorhabdus
           nematophila ATCC 19061]
 gi|297627884|emb|CBJ88430.1| 16S rRNA m5C967 methyltransferase,
           S-adenosyl-L-methionine-dependent [Xenorhabdus
           nematophila ATCC 19061]
          Length = 437

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 113/456 (24%), Positives = 210/456 (46%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  ++ V+ +  SL+ ++         + +S +D+ L++ +    +R L
Sbjct: 1   MKNTYNLRSIAAKAITQVLEQGQSLSSVIPEL-----QQRVSDKDKALLQELCFGVMRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+     L+ V + Q+ Y  +  +A +   V  A   K  +  
Sbjct: 56  PQLEWFMSQLMAKPLKGKQRIFHYLIMVGLYQLTYTRIPAHAALAETVNGAINLKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +    +R  +E +E   +     + P+W +ER++  Y +     I  +    P+
Sbjct: 115 KGLINGVLRQFQRQQQELVERSNKHINQHLHPKWLQERIQKSYPQNWQTIIDANNQKPPM 174

Query: 177 YIDLTV-KFDIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVWWVQDAS 229
           ++ +         +   L    +                P  + SLPGF +G   +QD S
Sbjct: 175 WLRVNQLHHTANEYLSLLENANIEAELDTKHPNAIRLLNPCPVHSLPGFNQGWVTIQDRS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLH 287
           A    +L    N   +LDLCAAPGGKT     I   +KV A+D+ ++RL++++ NL RL+
Sbjct: 235 AQGCAELLTPCNGEFILDLCAAPGGKTTHILEIAPKSKVLAIDIDEQRLKRVKENLQRLN 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A  +   D     ++   + FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q
Sbjct: 295 LHAV-VKTGDGRLPHEWAAGEQFDRILLDAPCSATGVIRRHPDIKWLRRNEDIDQLVTLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            ++L     ++K  G +V++ CS+  Q++ E ++  L+     V     +     +    
Sbjct: 354 SEILDAIWPYLKKNGTLVYATCSILPQENSEQIKAFLKRHTDAVLSETGSLEKPGT---- 409

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                    +I P++         G DGFF   L +
Sbjct: 410 ---------QIIPEV--------EGGDGFFYARLIK 428


>gi|91226301|ref|ZP_01261141.1| Sun protein [Vibrio alginolyticus 12G01]
 gi|91189312|gb|EAS75591.1| Sun protein [Vibrio alginolyticus 12G01]
          Length = 427

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 124/452 (27%), Positives = 208/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGKERVLAIS-DACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y ++    +  +   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVDANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAAPCDVMKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLTK 424


>gi|289435165|ref|YP_003465037.1| sun protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
 gi|289171409|emb|CBH27953.1| sun protein [Listeria seeligeri serovar 1/2b str. SLCC3954]
          Length = 446

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 121/467 (25%), Positives = 206/467 (44%), Gaps = 44/467 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++         LL   D+ L+  +V  T +  
Sbjct: 1   MKKQKTVREIALELIIKIENNQSYSHLLINDALKKQKLNLL---DKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +++IA  + +P W  +R    YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDLIQDPVEKIAVETSLPVWLAKRWAKQYGNEQLREIGMAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNA-----VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN               L     S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRTEQLIKELNDQGITVTRNEFIDEALIVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLATYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDH 293

Query: 282 NLDRLHLYAEDIIEMDA---FDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTANTMFAPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFALEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
              +    +  + ++++ P  +        G DGFF  +LR++  P+
Sbjct: 408 ALPEKLAHIKKDDFVQLLPTDI--------GSDGFFVSSLRKVS-PE 445


>gi|294638022|ref|ZP_06716282.1| ribosomal RNA small subunit methyltransferase B [Edwardsiella tarda
           ATCC 23685]
 gi|291088814|gb|EFE21375.1| ribosomal RNA small subunit methyltransferase B [Edwardsiella tarda
           ATCC 23685]
          Length = 430

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 127/457 (27%), Positives = 218/457 (47%), Gaps = 45/457 (9%)

Query: 1   MKS-GMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRF 59
           MK+   N R +++  LS V+ +  SL+ +L      SA + LS++D+ L++ +   TLR 
Sbjct: 1   MKTTSYNLRAIAARTLSAVLDQGQSLSSVLP-----SAAQSLSEKDRALLQELCFGTLRV 55

Query: 60  LPRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRH 119
           LP+++ +L  ++  +L  K+  L  LL V + Q++Y  +  +A +   V+ A   K  + 
Sbjct: 56  LPQLEWILQQLMAKALTGKQRPLHYLLMVGLYQLVYTRIPPHAALAETVDGATALKRPQ- 114

Query: 120 FAKLVNSILRRVSREKIE---LLQRIAGISIIPEWFKERLENFYGKER-VLAISDACISP 175
              L+N +LR+  R++       Q+ A   + P W  +RL++ Y ++   +  ++    P
Sbjct: 115 LKGLINGVLRQFQRQQEALLLQSQQHASHWLHPSWLLKRLQHAYPEQWPAIVEANNQRPP 174

Query: 176 LYIDLTV-KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           +++ +       + +   L    +               + + +  LPGF  G   VQDA
Sbjct: 175 MWLRVNRRHHTRDAYLTLLQQAGIEAVAHDHFPDAIRLLVAQPVTRLPGFEHGWVTVQDA 234

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   V L    +   +LDLC APGGKT  ++     A+V A+D  ++RL+++R NL RL
Sbjct: 235 SAQHCVDLLDPHDGEQILDLCCAPGGKTTHILEAAPKAQVLAVDADEQRLKRVRENLQRL 294

Query: 287 HLYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
              AE +   D      +   + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  
Sbjct: 295 QQQAE-VRCGDGRTPDAWANGRQFDRILLDAPCSATGVIRRHPDIKWLRRDSDIAELAAL 353

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR++L      +KPGG++V++ CS+  Q++ E +   L                      
Sbjct: 354 QREILEAVWPLLKPGGVMVYATCSVLPQENREQILAFLAHHDDARL-------------A 400

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
               + +  ++  P         S G DGFF   L +
Sbjct: 401 ETGDAQQPGLQYLPQ--------SEGGDGFFYAKLIK 429


>gi|261823202|ref|YP_003261308.1| 16S rRNA methyltransferase B [Pectobacterium wasabiae WPP163]
 gi|261607215|gb|ACX89701.1| sun protein [Pectobacterium wasabiae WPP163]
          Length = 429

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 127/456 (27%), Positives = 217/456 (47%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +   D     +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVHQRD-----VSDKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R++ EL+QR A      + P W   R+E+ Y       +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQEELMQREATNSSHYLHPSWLLARIEHAYPDHWQSVVDANNQRPPM 174

Query: 177 YIDLTVKFDIETWAHKLNAVMLPTGGIRLKEL-------PESIVSLPGFAEGVWWVQDAS 229
           ++ +      +     L A                    P ++  LPGFA+G   +QDAS
Sbjct: 175 WLRVNRLHHTQEAYLDLLAQEGIEAFAHPDYADAIRLASPCAVDLLPGFAQGWATIQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V      +   +LDLCAAPGGKT  ++     + V A+D+ + RL ++R NL RL 
Sbjct: 235 AQGCVYWLEPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDIDETRLGRVRENLLRLQ 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI +    Q
Sbjct: 295 MHAE-VKQGDGRYPDSWCAGRMFDRILLDAPCSATGVIRRHPDIKWLRRDRDIEELVALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           ++++      +KPGG +V++ CS+  Q++ + V   L        LV   ++        
Sbjct: 354 KEIIDAIWPHLKPGGTMVYATCSILPQENAQQVTDFLSRH-ADATLVDTGTSEIPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                   I++ P         + G DGFF   L +
Sbjct: 409 --------IQMLPH--------ADGGDGFFYAKLVK 428


>gi|153834294|ref|ZP_01986961.1| ribosomal RNA small subunit methyltransferase B [Vibrio harveyi
           HY01]
 gi|148869302|gb|EDL68316.1| ribosomal RNA small subunit methyltransferase B [Vibrio harveyi
           HY01]
          Length = 427

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 125/453 (27%), Positives = 210/453 (46%), Gaps = 44/453 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y  +   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPEQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQYHTRDEYLALLKNENIDSTPHTQAMDALKLAAPCDVMKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARHPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +    +LV  +              
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLART-ANAQLVDSDP------------- 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            +   +I P            MDGF+   L + 
Sbjct: 401 KQPGRQILPG--------EEDMDGFYYAVLTKK 425


>gi|50122921|ref|YP_052088.1| 16S rRNA methyltransferase B [Pectobacterium atrosepticum SCRI1043]
 gi|81643776|sp|Q6D000|RSMB_ERWCT RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|49613447|emb|CAG76898.1| Sun protein [Pectobacterium atrosepticum SCRI1043]
          Length = 429

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 124/457 (27%), Positives = 210/457 (45%), Gaps = 46/457 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +   D     +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPIHQRD-----VSDKDRALLQELCFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLHYTRIPPHAALAETVEGAVALKRPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +    +R   E ++     +   + P W   R+E+ Y       I +A      
Sbjct: 115 KGLINGVLRQFQRQQEELLQREATHSSHYLHPSWLLARIEHAYPNNW-RGIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           + L V       E + + L    +                P ++  LPGF++G   VQDA
Sbjct: 174 MWLRVNRLHHTREAYLNLLMQGGIEAFPHTEYSDAIRLASPCAVDQLPGFSQGWATVQDA 233

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRL 286
           SA   V      +   +LDLCAAPGGKT  ++     + V A+DV + RL +++ NL RL
Sbjct: 234 SAQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDVDETRLGRVKENLLRL 293

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI +    
Sbjct: 294 QMHAE-VKQGDGRYPDSWCEARVFDRILLDAPCSATGVIRRHPDIKWLRRDRDIEELVAL 352

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L      +K GG +V++ CS+  Q++ + V   L        LV   ++       
Sbjct: 353 QKEILDAIWPHLKTGGTMVYATCSILPQENTQQVTGFLSRHADAA-LVDTGTSEIPG--- 408

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                    I+I P         +   DGFF   L +
Sbjct: 409 ---------IQILPH--------ADSGDGFFYAKLVK 428


>gi|47096543|ref|ZP_00234133.1| sun protein [Listeria monocytogenes str. 1/2a F6854]
 gi|254899481|ref|ZP_05259405.1| hypothetical protein LmonJ_06694 [Listeria monocytogenes J0161]
 gi|254912380|ref|ZP_05262392.1| sun protein [Listeria monocytogenes J2818]
 gi|254936707|ref|ZP_05268404.1| sun protein [Listeria monocytogenes F6900]
 gi|47015075|gb|EAL06018.1| sun protein [Listeria monocytogenes str. 1/2a F6854]
 gi|258609304|gb|EEW21912.1| sun protein [Listeria monocytogenes F6900]
 gi|293590362|gb|EFF98696.1| sun protein [Listeria monocytogenes J2818]
          Length = 444

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 207/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ YLD V ++A+++ A + AK    ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTYLDKVPEHAILNEAGDIAKNM-GHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWADQYGIEQLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        E        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDE 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLTILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-DFTLEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + +I++ P  +        G DGFF  +LR++
Sbjct: 408 VLPEKLAQIKKDDFIQLLPTDI--------GSDGFFVSSLRKV 442


>gi|37528514|ref|NP_931859.1| 16S rRNA methyltransferase B [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|46396778|sp|Q7MYI0|RSMB_PHOLL RecName: Full=Ribosomal RNA small subunit methyltransferase B;
           AltName: Full=16S rRNA m5C967 methyltransferase;
           AltName: Full=rRNA (cytosine-C(5)-)-methyltransferase
           rsmB
 gi|36787952|emb|CAE17069.1| RsmB protein (SUN/FMU protein), 16S RNA m5C967 methyltransferase
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 429

 Score =  263 bits (671), Expect = 5e-68,   Method: Composition-based stats.
 Identities = 111/455 (24%), Positives = 211/455 (46%), Gaps = 42/455 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  ++ V+ +  SL+ +L         + ++ +D+ L++ +    LR L
Sbjct: 1   MKNTYNLRSITAKAINQVLDQGQSLSTVLPKL-----QQNITDKDKPLLQELSFGVLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAK--RDKENR 118
           P+++ ++  +++  L  K+  L  LL V + Q+ Y  +  +A +   V  A   +  + +
Sbjct: 56  PQLEWIIGQLMVKPLKGKQRILHYLLMVGIYQLAYTRIPAHAALAETVNGAVTLKHSQLK 115

Query: 119 HFAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISP-LY 177
                V    +R   + +E  Q  +   + PEW   R++  Y ++    I+     P ++
Sbjct: 116 GLINGVLRQFQRQQLQLMECTQNNSSHHLHPEWLLTRIQKAYPQQWQQLINANNKKPPMW 175

Query: 178 IDLT-VKFDIETWAHKLNAVMLPTGGIR------LKELPESIVSLPGFAEGVWWVQDASA 230
           + +  +    + +   L    +                P  +  LPGF +G   VQD SA
Sbjct: 176 LRVNRIYHSRDEYLTLLRKSGIDAEPAPKSPSAIRIISPCPVTILPGFDKGWVTVQDLSA 235

Query: 231 SIPVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHL 288
              V+L   +N   +LDLCAAPGGKT     I   ++V A+D+ ++R+++++ NL RL+ 
Sbjct: 236 QECVELLKPINGEKILDLCAAPGGKTTYILEIAPESQVVAVDIDEQRIKRVKENLKRLNC 295

Query: 289 YAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           +A  +   D      +   + FD +L+DAPCS+TG IRRHPD+ W R  +DI +    Q 
Sbjct: 296 HAT-VKTGDGRHPEHWAENQQFDRILLDAPCSATGVIRRHPDIKWLRREEDIAQLVQLQS 354

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAM 405
           ++L     ++K  G +V++ CS+   ++ + +   L+           + A     +   
Sbjct: 355 EILDAIWPYLKKSGTLVYATCSILPDENCQQISSFLKRH---------SDAKLAGTETND 405

Query: 406 ALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            L      +I P++        +G DGFF   L +
Sbjct: 406 CLGK----QIIPEL--------NGGDGFFYARLTK 428


>gi|302874750|ref|YP_003843383.1| sun protein [Clostridium cellulovorans 743B]
 gi|307690635|ref|ZP_07633081.1| sun protein [Clostridium cellulovorans 743B]
 gi|302577607|gb|ADL51619.1| sun protein [Clostridium cellulovorans 743B]
          Length = 443

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 104/458 (22%), Positives = 192/458 (41%), Gaps = 40/458 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R  +  +L+ V  +R     +++ E   S    +   D+ LV  IV  T+++   ID 
Sbjct: 3   NPRETAVIILNKVFNERGYSNIIINKELNKSNLENI---DKALVTEIVYGTIQYKYTIDK 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++D  +          +  +LR ++ QI YLD +  +AVV+ AVE +K+       +K +
Sbjct: 60  IIDHFVGRGTSSVDKKVVNILRSAIYQIRYLDKIPSFAVVNEAVELSKK-LSTVTSSKFI 118

Query: 125 NSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N +LR   R+  E            +       W  ++  + YG      I         
Sbjct: 119 NGVLRNYIRKTNENFYNKNNLVDRLSFEYSFEPWMVKKFISQYGNNIAEKILKGLNERPS 178

Query: 178 IDLTVK---FDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDA 228
           I + V       +    +L A+        +          +SI + P F +G   VQD 
Sbjct: 179 ITVRVNSLKTTFDEAYEELEALGYSVEEGVIAPEAIRILKGKSIENNPLFIKGSITVQDE 238

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           SA I         +  + D+C+APGGKT  +       +K+ A D+   +L+ +  N+ R
Sbjct: 239 SAMIVASALEPSKDDVIFDMCSAPGGKTTHIAELSEDKSKIKAFDIFDHKLKLIEENIKR 298

Query: 286 LHLYAEDIIEMDAFDYC--PKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
           L + + +    DA  +        D VL+D PCS  G +R+ P++ +T++  D+ +    
Sbjct: 299 LGITSIETEIKDASIHDVLLDDSADKVLIDVPCSGLGIMRKKPEIKYTKNEKDLKELVKI 358

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           QR ++     +V+ GG++V+S C+L+ ++++E ++  L      +               
Sbjct: 359 QRDIMRNAAKYVRKGGVLVYSTCTLNLEENQENIRWFLDRHEDFMV-----EKVDFGKGE 413

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            +    +  + I P+           MDGFF   L+R+
Sbjct: 414 NLIYGKDNTLTILPNKY---------MDGFFIAKLKRI 442


>gi|293374996|ref|ZP_06621291.1| ribosomal RNA small subunit methyltransferase B [Turicibacter
           sanguinis PC909]
 gi|325843368|ref|ZP_08167951.1| ribosomal RNA small subunit methyltransferase B [Turicibacter sp.
           HGF1]
 gi|292646406|gb|EFF64421.1| ribosomal RNA small subunit methyltransferase B [Turicibacter
           sanguinis PC909]
 gi|325489397|gb|EGC91770.1| ribosomal RNA small subunit methyltransferase B [Turicibacter sp.
           HGF1]
          Length = 444

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 111/457 (24%), Positives = 208/457 (45%), Gaps = 40/457 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR ++   L+ ++         L+ +   S    L+ +D+  +  +V  TL+    ++ 
Sbjct: 3   NARELALQTLTDILINGAYSNHALNEQIEKS---DLTIQDKNFMTELVYGTLQHQQLLNF 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
                    +      ++ L+++++ QILYLD V ++A +  AV  AK+ +  +   KLV
Sbjct: 60  YATPFFNGKVKG---WIRILIQMTLYQILYLDSVPEHAAISEAVNIAKK-RGGQFNGKLV 115

Query: 125 NSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
           N+ILR + R  +  LQ I       A  +  P W  +     +G E+   +++A    + 
Sbjct: 116 NAILREMMRNPLSNLQEIEDDAERLATKTSHPLWLIKLWIKQFGMEKTEQMANANNERVN 175

Query: 178 IDLTVKFDIETWAHKLNAVMLPTGGIR--------LKELPESIVSLPGFAEGVWWVQDAS 229
           + + V     T       +       R        L     +++    F +G ++VQD S
Sbjct: 176 VTIRVNGVKGTKEELKQKLEEEGIQCRDGFLSPDALVITKGNVIKTKAFEQGWFYVQDES 235

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNLDRL 286
           + +  +     ++  VLD C+APGGKT     ++     V A D+   +++ +  N+ RL
Sbjct: 236 SMLVARALKPKHHTKVLDTCSAPGGKTTHVAEMMRQTGMVYAHDIYPHKIKLIEDNVKRL 295

Query: 287 HLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACF 343
            L    +   DA       P + FD+VLVDAPCS  G +RRHP+V  T+  +D+      
Sbjct: 296 GLKNVVVNLQDATKLTECYPSESFDSVLVDAPCSGLGILRRHPEVKITKKPEDLDGVMAI 355

Query: 344 QRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDM 403
           Q+++L    S VK GG +++S C++++++++++V+  LR  P       L     + ++ 
Sbjct: 356 QKEILKTVASLVKYGGTLLYSTCTVNRKENDKMVEWFLREHPEFKLDQTLVERLPEVLNE 415

Query: 404 AMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
             +    G +++ P   +         DGFF   L+R
Sbjct: 416 QAST---GMVQLFPGDYQ--------TDGFFIACLKR 441


>gi|315303726|ref|ZP_07874237.1| ribosomal RNA small subunit methyltransferase B [Listeria ivanovii
           FSL F6-596]
 gi|313627903|gb|EFR96525.1| ribosomal RNA small subunit methyltransferase B [Listeria ivanovii
           FSL F6-596]
          Length = 446

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 120/467 (25%), Positives = 205/467 (43%), Gaps = 44/467 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVREIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +++IA  + +P W   R    YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDLIEDPVKKIAVETSLPYWLARRWAEQYGIEQLREIGMAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNA-----VMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN               L     S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRTEQLIKELNDQGITVTRNEFIDEALIVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFRLEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
                   +  + ++++ P  +        G DGFF  +LR++  P+
Sbjct: 408 ALPAKLAHIKKDDFVQLLPTDI--------GSDGFFVSSLRKVS-PE 445


>gi|284802268|ref|YP_003414133.1| hypothetical protein LM5578_2024 [Listeria monocytogenes 08-5578]
 gi|284995410|ref|YP_003417178.1| hypothetical protein LM5923_1975 [Listeria monocytogenes 08-5923]
 gi|284057830|gb|ADB68771.1| hypothetical protein LM5578_2024 [Listeria monocytogenes 08-5578]
 gi|284060877|gb|ADB71816.1| hypothetical protein LM5923_1975 [Listeria monocytogenes 08-5923]
          Length = 444

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 207/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ YLD V ++A+++ A + AK    ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTYLDKVPEHAILNEAGDIAKNM-GHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWADQYGIEQLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        E        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDE 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFTLEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + +I++ P  +        G DGFF  +LR++
Sbjct: 408 VLPEKLAQIKKDDFIQLLPTDI--------GSDGFFVSSLRKV 442


>gi|89074758|ref|ZP_01161216.1| Putative Sun protein [Photobacterium sp. SKA34]
 gi|89049522|gb|EAR55083.1| Putative Sun protein [Photobacterium sp. SKA34]
          Length = 426

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 122/452 (26%), Positives = 213/452 (47%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L      +A + + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRATAAKVIYQVVDQGQSLSAALP-----AAQQDIRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    L+
Sbjct: 56  SITQALMDKPLKGKQRVFHHLILVGLYQLGYMRIPAHAAVAETVNATKTLKKPQ-LRGLI 114

Query: 125 NSILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGKERV-LAISDACISPLYID 179
           N+ILR   R++     + +   AG    P W  + L+  Y ++   +  ++   +P+++ 
Sbjct: 115 NAILRNYQRQQETLDAQAISHDAGKYGHPSWLLKLLKESYPEQFADICEANNTKAPMWLR 174

Query: 180 LTVKFD-IETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDASASI 232
           +  + +  + +   L+A  + T              P  +  LPGF++G   VQDA+A +
Sbjct: 175 VNRQHNTRDAYRALLDAEDIATELHPQAADALRLVSPCDVTQLPGFSDGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVS--GAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            V       +  +LD CAAPGGKTA ++      KV A+D  + RL+++  NL RL+L A
Sbjct: 235 AVDYLQPKADELILDCCAAPGGKTAHIMEHVPSTKVVAIDCDENRLKRVHENLARLNLDA 294

Query: 291 E--DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                       +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q ++ 
Sbjct: 295 TVLCADARYPEQWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALATLQAEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q++ + V+  L  +P  V L+  + A            
Sbjct: 355 DAMWLQLKPGGTLVYATCSITPQENCDQVKAFLARTPN-VTLIGSDPAKP---------- 403

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 404 ---GRQILPG--------EESMDGFYYAVLTK 424


>gi|156972728|ref|YP_001443635.1| cytosine-C5-methylase [Vibrio harveyi ATCC BAA-1116]
 gi|156524322|gb|ABU69408.1| hypothetical protein VIBHAR_00393 [Vibrio harveyi ATCC BAA-1116]
          Length = 427

 Score =  262 bits (670), Expect = 6e-68,   Method: Composition-based stats.
 Identities = 125/453 (27%), Positives = 210/453 (46%), Gaps = 44/453 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQNVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYG-KERVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y  +   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPEQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTQAMDALKLAAPCDVMKLPGFEKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLEPKDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARHPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +    +LV  +              
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLART-ANTQLVDSDP------------- 400

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
            +   +I P            MDGF+   L + 
Sbjct: 401 KQPGRQILPG--------EEDMDGFYYAVLTKK 425


>gi|254976172|ref|ZP_05272644.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile QCD-66c26]
 gi|255315305|ref|ZP_05356888.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile QCD-76w55]
 gi|255517973|ref|ZP_05385649.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile QCD-97b34]
 gi|255651089|ref|ZP_05397991.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile QCD-37x79]
 gi|260684154|ref|YP_003215439.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile CD196]
 gi|260687813|ref|YP_003218947.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile R20291]
 gi|306520940|ref|ZP_07407287.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile QCD-32g58]
 gi|260210317|emb|CBA64638.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile CD196]
 gi|260213830|emb|CBE05814.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile R20291]
          Length = 441

 Score =  262 bits (670), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 100/460 (21%), Positives = 207/460 (45%), Gaps = 43/460 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M+AR V   +L  + +        ++  + +     +S  D+ L   ++   +     +D
Sbjct: 1   MDAREVGFKVLCDIEKNDNYSNIAINKHFKN---LEISDMDRGLATELIYGVIENKYYLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +++ +    + +    ++  LR+   QIL+LD ++DYA V+  V+ +K+   ++  +  
Sbjct: 58  YIINKLSKIKVKKMSTYVKIFLRMGTYQILFLDSISDYAAVNETVKLSKKY--DKKSSGF 115

Query: 124 VNSILRRVSREKIELLQ--------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +N+ILR   R K  ++          ++       W  +   + +G+E    + +A    
Sbjct: 116 INAILRNEIRAKETIMDITEEDSVKYLSIKYSYNSWIIKNWIDKFGQEFAEDLLEANNEK 175

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPT------GGIRLKELPESIVSLPGFAEGVWWVQ 226
             I +         E    KL+ + +              E  ++I     F  G++ +Q
Sbjct: 176 PSIYIRTNTLKISREELIEKLSEMGIVCLKVPMVEEAIKVEKMKNIEKNELFKAGLFTIQ 235

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ I  ++        VLD+C+APGGK+     L+ +  +V A D+ + +L+ +   +
Sbjct: 236 DISSMIVGKVINPKEGSFVLDVCSAPGGKSTHLATLMNNTGQVVARDIFEHKLKLINSTV 295

Query: 284 DRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           +RL L    +   DA +        FD VL D PCS  G IRR P++ + +  +++    
Sbjct: 296 NRLGLKNVFVERFDASEIDENSISKFDYVLADVPCSGFGIIRRKPEIKY-KKEEELKDIT 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q+K+L     +VK GG +V+S C++   ++  +V   +  +    E VP++     ++
Sbjct: 355 SIQKKILENASKYVKVGGTLVYSTCTIQDVENINIVTSFVEENHN-FEFVPID-----TV 408

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ++ +    +G+++I P++         G+DGFF   L+R+
Sbjct: 409 NVDLDNQDKGYLKIYPNI--------HGIDGFFIAKLKRI 440


>gi|152977800|ref|YP_001343429.1| sun protein [Actinobacillus succinogenes 130Z]
 gi|150839523|gb|ABR73494.1| sun protein [Actinobacillus succinogenes 130Z]
          Length = 462

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 119/464 (25%), Positives = 200/464 (43%), Gaps = 48/464 (10%)

Query: 3   SGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPR 62
             ++ R  ++ ++  V+ +  SL+ L+           L  +D  L++ I     R LPR
Sbjct: 24  KNLSVRAAAAQIILQVLDQGKSLSALIPET-----QLKLKPQDLPLLQEICFGICRVLPR 78

Query: 63  IDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAK 122
           ++ ++  ++   L  K   +  LL V + QILY  +  +A ++  V  AK  K + +F  
Sbjct: 79  LEWIIRLLMDKPLKGKTRIVHCLLLVGLYQILYTRIPQHAAINETVNAAKELKSD-NFRG 137

Query: 123 LVNSILRRVSREKIEL--LQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           L+N +LRR  RE+  +         +  PEW   +L+  Y   R +  ++    P+++ +
Sbjct: 138 LLNGVLRRFLREQESVLATVDKHWQTNHPEWLVNKLKKIYPNWRDIIDANNRKPPMWLRV 197

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVWWVQDASASIPV 234
                      +L A    T              P  +  LP FAEG   VQD  A    
Sbjct: 198 NRIHGSTENYRQLLAENDMTACTDENPHALRLESPMPVQRLPRFAEGWVTVQDVHAQWSG 257

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLHLYAED 292
            L    N   +LD CAAPGGKT  ++    +  V A+DV + RL+++  NL RL+  A  
Sbjct: 258 ILLEPQNGELILDACAAPGGKTTHILEQAPQAKVVAVDVEENRLKRITENLARLNQQAIV 317

Query: 293 II-------------EMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVK 339
           I                          FD +L+DAPCS++G IRRHPD+ W R   DI  
Sbjct: 318 ICGDAARPETWLEQAAQQISGRKSAVQFDRILLDAPCSASGVIRRHPDIKWLRQEQDIAP 377

Query: 340 SACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK 399
               Q ++L    + +KP G+++++ CS+  +++   + + L       +L+PL  +  +
Sbjct: 378 LVDIQYQILTALWATLKPNGVLLYATCSVLPEENGRQIARFLAEH-TDAQLMPLPFSPPQ 436

Query: 400 SIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
            I            +  P          +G DGF+   LR+  Q
Sbjct: 437 EIGH----------QFLP--------TENGGDGFYYAKLRKTAQ 462


>gi|317049808|ref|YP_004117456.1| sun protein [Pantoea sp. At-9b]
 gi|316951425|gb|ADU70900.1| sun protein [Pantoea sp. At-9b]
          Length = 428

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 126/457 (27%), Positives = 211/457 (46%), Gaps = 45/457 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R +++ L+  V+ K  SL+ +L       A + LS +D  L++ +    +R L
Sbjct: 1   MKKNTNLRSLAAQLIERVVDKGESLSAILP-----GAQKSLSDKDGALLQELCFGVMRTL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++A++  ++   L  K+  L  L+ V + Q+LY  V  +A +   V  A+  K   + 
Sbjct: 56  PQLEALISKLMERPLTGKQRVLHYLIMVGLYQLLYTRVPPHAALAETVAGAEVLKR-ANL 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLY 177
             L+N +    +R     +  + +     + P W  +RL+  +  E+   I +A      
Sbjct: 115 KGLLNGVLRQFQRQQEALVAEVDQGTQRHLHPAWLLKRLQTAWP-EQWQQIVEANNQRPP 173

Query: 178 IDLTV---KFDIETWAHKLNAVMLPTGGIRLKELPE-----SIVSLPGFAEGVWWVQDAS 229
           + L V       +TW   L             +        ++  LPGF +G   VQD S
Sbjct: 174 MWLRVNRQHHPRDTWLALLEETEKSAFVGDAPDSLRLEAPTAVGQLPGFDQGWVTVQDLS 233

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK--VTALDVSKRRLEKLRCNLDRLH 287
           A     L    N  S+LDLCAAPGGKT  ++    +  V A+D+ ++RL ++R NL RL 
Sbjct: 234 AQRCALLLEPQNGESILDLCAAPGGKTTHILEIAPQAAVLAVDIDEQRLTRVRENLQRLG 293

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           + A D+ + D      +C  K FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 294 MQA-DVRQGDGRTPAEWCGDKQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELASLQ 352

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           R++L      +K GG ++++ CS+  +++ + +   L + P  +               A
Sbjct: 353 REILHAVWPRLKSGGTLLYATCSVLPEENHQQITAFLATHPDAIAE-------------A 399

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           +    E   ++ P         + G DGFF   L + 
Sbjct: 400 LPHGQENGWQVFP--------ATDGGDGFFYAKLMKK 428


>gi|227328919|ref|ZP_03832943.1| 16S rRNA methyltransferase B [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 429

 Score =  262 bits (669), Expect = 7e-68,   Method: Composition-based stats.
 Identities = 121/456 (26%), Positives = 215/456 (47%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKS  N R +++ ++  V+ +  SL+ LL +       R +S +D+ L++ +    LR L
Sbjct: 1   MKSSYNLRSIAAKVVGQVLDQGQSLSALLPVH-----QREVSDKDRALLQELCFGLLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   L  K+ +L  L+ V + Q+ Y  +  +A +   VE A   K+ +  
Sbjct: 56  PQLEWCIQQLMAKPLTGKQRTLHYLIMVGIYQLQYTRIPPHAALAETVEGAVTLKKPQ-L 114

Query: 121 AKLVNSI---LRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERV-LAISDACISPL 176
             L+N +    +R   E I+     +   + P W   R+E  Y      +  ++    P+
Sbjct: 115 KGLINGVLRQFQRQQEELIQREATHSSHYLHPSWLLARIERAYPNHWQGIVEANNQRPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +    E + + L    +                P ++  LPGF++G   VQDAS
Sbjct: 175 WLRVNRLHHTREAYLNLLVQEGIEAFPHAEYSDAIRLASPCAVDQLPGFSQGWATVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V      +   +LDLCAAPGGKT  ++     + V A+DV + RL +++ NL RL 
Sbjct: 235 AQGCVYWLDPQDGEQILDLCAAPGGKTTHILEAAPKSHVLAVDVDETRLSRVKENLLRLQ 294

Query: 288 LYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           ++AE + + D      +C  ++FD +L+DAPCS+TG IRRHPD+ W R   DI +    Q
Sbjct: 295 MHAE-VKQGDGRYPDSWCEGRVFDRILLDAPCSATGVIRRHPDIKWLRRDRDIEELVALQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           +++L     ++K GG +V++ CS+  Q++ + V   L       +L+   +         
Sbjct: 354 KEILDAIWPYLKTGGTMVYATCSILPQENAQQVTDFLTRH-ADAKLIDTGTREMPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                   I++ P         + G DGFF   L +
Sbjct: 409 --------IQMLPH--------ADGGDGFFYAKLVK 428


>gi|238797213|ref|ZP_04640714.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           mollaretii ATCC 43969]
 gi|238718850|gb|EEQ10665.1| Ribosomal RNA small subunit methyltransferase B [Yersinia
           mollaretii ATCC 43969]
          Length = 431

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 122/456 (26%), Positives = 217/456 (47%), Gaps = 44/456 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK+  N R +++  +S V+ +  SL+ +L   +       +S +D+ L++ +   TLR L
Sbjct: 1   MKNTYNLRSIAAKAISQVLDQGQSLSTVLPGLH-----NSISDKDRALLQELCFGTLRVL 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           P+++  +  ++   +  K+     L+ V + Q++Y  +  +A +   VE A   K  +  
Sbjct: 56  PQLEWCIQQLMARPMTGKQRVFHYLIMVGLYQLIYTRIPHHAALAETVEGATALKRPQ-L 114

Query: 121 AKLVNSILRRVSREKIELLQRIAG---ISIIPEWFKERLENFYGKERVLAIS-DACISPL 176
             L+N +LR+  R+++ELL+R A      + P W   R++  Y  +    +  +    P+
Sbjct: 115 KGLINGVLRQFQRQQVELLERAANNESRYLHPSWLLARIKLAYPDQWQQILDANNQKPPM 174

Query: 177 YIDLT-VKFDIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDAS 229
           ++ +  +      +   L    +      L         P ++ +LPGF  G   VQDAS
Sbjct: 175 WLRVNRLHHTRSEYLELLKQADIDAVPHDLYSDALRLITPCAVSALPGFELGWATVQDAS 234

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIV--SGAKVTALDVSKRRLEKLRCNLDRLH 287
           A   V L    N   +LDLCAAPGGKT  ++     A V A+D+ ++RL++++ NL RL 
Sbjct: 235 AQGCVDLLDPHNGEQILDLCAAPGGKTTHILEAAPKAHVLAVDIDEQRLDRVKENLQRLK 294

Query: 288 LYAEDIIEMD---AFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
           L+A  +   D     D+C  + FD +L+DAPCS+TG IRRHPD+ W R   DI + A  Q
Sbjct: 295 LHAV-VRVGDGRTPEDWCGDQQFDRILLDAPCSATGVIRRHPDIKWLRRDRDIAELAQLQ 353

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
            +++      +K GG++V++ CS+  +++++ +   L+      ELV   +         
Sbjct: 354 SEIIEAIWPKLKKGGVMVYATCSILPEENQQQIAAFLQRH-SEAELVETGTTAVPG---- 408

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                           ++        DGFF   L +
Sbjct: 409 ----------------KQNLPHPEDGDGFFYAKLIK 428


>gi|126700200|ref|YP_001089097.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile 630]
 gi|115251637|emb|CAJ69470.1| Ribosomal RNA small subunit methyltransferase B (rRNA
           (cytosine-C(5)-)-methyltransferase) [Clostridium
           difficile]
          Length = 441

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 100/460 (21%), Positives = 207/460 (45%), Gaps = 43/460 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M+AR V   +L  + +        ++  + +     +S  D+ L   ++   +     +D
Sbjct: 1   MDAREVGFKVLCDIEKNDNYSNIAINKHFKN---LEISDMDRGLATELIYGVIENKYYLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +++ +    + +    ++  LR+   QIL+LD ++DYA V+  V+ +K+   ++  +  
Sbjct: 58  YIINKLSKIKVKKMSTYVKIFLRMGTYQILFLDSISDYAAVNETVKLSKKY--DKKSSGF 115

Query: 124 VNSILRRVSREKIELLQ--------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +N+ILR   R K  ++          ++       W  +   + +G+E    + +A    
Sbjct: 116 INAILRNEIRAKETIMDITEEDSVKYLSIKYSYNSWIIKNWIDKFGQEFAEDLLEANNEK 175

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPT------GGIRLKELPESIVSLPGFAEGVWWVQ 226
             I +         E    KL+ + +              E  ++I     F  G++ +Q
Sbjct: 176 PSIYIRTNTLKISREELIEKLSEMGIVCLKVPMVEEAIKVEKMKNIEKNELFKAGLFTIQ 235

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ I  ++        VLD+C+APGGK+     L+ +  +V A D+ + +L+ +   +
Sbjct: 236 DISSMIVGKVINPKEGSFVLDVCSAPGGKSTHLATLMNNTGQVVARDIFEHKLKLINSTV 295

Query: 284 DRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           +RL L    +   DA +        FD VL D PCS  G IRR P++ + +  +++    
Sbjct: 296 NRLGLKNVFVERFDASEIDENSISKFDYVLADVPCSGFGIIRRKPEIKY-KKEEELKDIT 354

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q+K+L     +VK GG +V+S C++   ++  +V   +  +    E VP++     ++
Sbjct: 355 SIQKKILENASKYVKVGGTLVYSTCTIQDVENINIVTFFVEENHN-FEFVPID-----TV 408

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
           ++ +    +G+++I P++         G+DGFF   L+R+
Sbjct: 409 NVDLDNQDKGYLKIYPNI--------HGIDGFFIAKLKRI 440


>gi|260901337|ref|ZP_05909732.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ4037]
 gi|308109871|gb|EFO47411.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ4037]
          Length = 427

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 123/452 (27%), Positives = 207/452 (45%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGK-ERVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y +    +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LP F +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAAPCDVMKLPSFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLTK 424


>gi|153837662|ref|ZP_01990329.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ3810]
 gi|149748952|gb|EDM59779.1| ribosomal RNA small subunit methyltransferase B [Vibrio
           parahaemolyticus AQ3810]
          Length = 427

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 125/452 (27%), Positives = 210/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+C L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSCALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGKERV-LAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y ++   +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAAPCDVMKLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLTK 424


>gi|226224425|ref|YP_002758532.1| RNA-binding Sun protein [Listeria monocytogenes Clip81459]
 gi|225876887|emb|CAS05596.1| Putative RNA-binding Sun protein [Listeria monocytogenes serotype
           4b str. CLIP 80459]
          Length = 444

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 208/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWTDQYGIEKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        E        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFTLEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + +I++ P  +        G DGFF  +LR++
Sbjct: 408 VLPEKLAQIKKDDFIQLLPTDI--------GSDGFFVSSLRKV 442


>gi|16801002|ref|NP_471270.1| hypothetical protein lin1936 [Listeria innocua Clip11262]
 gi|16414437|emb|CAC97166.1| lin1936 [Listeria innocua Clip11262]
          Length = 446

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 123/467 (26%), Positives = 209/467 (44%), Gaps = 44/467 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW   R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDLIKDPVQKIAVETSLPEWLARRWADQYGLEKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLN-----AVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN     A         L     S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRAEQLIKELNDQGITATRNEFIDEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLVAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFALEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
              +    +  + ++++ P  +        G DGFF  +LR++  P+
Sbjct: 408 VLPEKLAQIKKDDFVQLLPTDI--------GSDGFFVSSLRKVS-PE 445


>gi|116873257|ref|YP_850038.1| sun protein [Listeria welshimeri serovar 6b str. SLCC5334]
 gi|116742135|emb|CAK21259.1| sun protein [Listeria welshimeri serovar 6b str. SLCC5334]
          Length = 444

 Score =  262 bits (669), Expect = 8e-68,   Method: Composition-based stats.
 Identities = 119/463 (25%), Positives = 207/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG +++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDEVKDPVQKIAVETSLPEWLAKRWADQYGVQKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        +        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRTEQLIKELNDQGITVTQNEFIDEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L        DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHQDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFSLEPVTL--- 409

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + ++++ P  +        G DGFF  +LR++
Sbjct: 410 --PEKLAHIKKDDFVQLLPTDI--------GSDGFFVSSLRKV 442


>gi|307822766|ref|ZP_07652997.1| sun protein [Methylobacter tundripaludum SV96]
 gi|307736370|gb|EFO07216.1| sun protein [Methylobacter tundripaludum SV96]
          Length = 435

 Score =  262 bits (669), Expect = 9e-68,   Method: Composition-based stats.
 Identities = 114/450 (25%), Positives = 208/450 (46%), Gaps = 30/450 (6%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN RLV++ +LS V++   SLT  LD  +        S +D+  ++A+     R   R+D
Sbjct: 1   MNTRLVAARVLSRVLQDGQSLTAALDNAFPSIE----SSKDRAFIQALCYGVCRQYHRLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            +L  +L   L      ++ L  V + Q+ ++ V  +A V   V  A++    +     V
Sbjct: 57  FILSQLLDKPLK--DTDVKSLALVGLYQLKFMRVKPHAAVSETVLAARKKPWAKSLINAV 114

Query: 125 NSILRRVSREKIELLQRIAGIS-IIPEWFKERLENFYGKERV-LAISDACISPLYIDLTV 182
                R          +    +   P+W  +++E  + ++ + + + +    P+ + + +
Sbjct: 115 LRTYLREQEGLEHKADKCQVAALSHPDWLIKQIEQDWPEQALNIFLENNQQPPMVLRVNL 174

Query: 183 -KFDIETWAHKLNAVMLPTGGIRLKEL------PESIVSLPGFAEGVWWVQDASASIPVQ 235
            K   E +   L    +    +           P  +  LPGF++G+  VQD +A +   
Sbjct: 175 SKTSREDYLQLLAGQDIAAEPVSFCRSAIRLDKPVPVDLLPGFSDGLVSVQDTAAQLAAG 234

Query: 236 LFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCNLDRLHLYAED 292
           L        VLD+CAAPGGKTA ++ S  ++    A+D+ + R++++  NL RL+L+A  
Sbjct: 235 LLDVRPGHRVLDVCAAPGGKTAHILESQQQLKELVAVDIDESRMQRVSENLQRLNLHATL 294

Query: 293 I--IEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQ 350
           +     +   +   K FD +L+DAPCS+ G IRRHPD+   R  +DI +    Q+ +L  
Sbjct: 295 VVGDAANPASWWDGKPFDRILLDAPCSALGVIRRHPDIKLLRRAEDIGQLQALQKNILQA 354

Query: 351 GISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPE 410
               + PGG+++++ CS+ KQ++E+ VQ  L      VEL   + +   +   A  ++  
Sbjct: 355 VWPLLAPGGLMLYATCSILKQENEQQVQAFLAEHSDAVELPLFSDSSLGT--TAWGINGA 412

Query: 411 GWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
              +I            S MDGF+   + +
Sbjct: 413 CGRQIL--------TGESAMDGFYYACISK 434


>gi|46908054|ref|YP_014443.1| sun protein [Listeria monocytogenes serotype 4b str. F2365]
 gi|47093059|ref|ZP_00230837.1| sun protein [Listeria monocytogenes str. 4b H7858]
 gi|254826136|ref|ZP_05231137.1| sun protein [Listeria monocytogenes FSL J1-194]
 gi|254852729|ref|ZP_05242077.1| sun protein [Listeria monocytogenes FSL R2-503]
 gi|254933294|ref|ZP_05266653.1| sun protein [Listeria monocytogenes HPB2262]
 gi|300763865|ref|ZP_07073862.1| sun protein [Listeria monocytogenes FSL N1-017]
 gi|46881324|gb|AAT04620.1| sun protein [Listeria monocytogenes serotype 4b str. F2365]
 gi|47018560|gb|EAL09315.1| sun protein [Listeria monocytogenes str. 4b H7858]
 gi|258606052|gb|EEW18660.1| sun protein [Listeria monocytogenes FSL R2-503]
 gi|293584854|gb|EFF96886.1| sun protein [Listeria monocytogenes HPB2262]
 gi|293595376|gb|EFG03137.1| sun protein [Listeria monocytogenes FSL J1-194]
 gi|300515601|gb|EFK42651.1| sun protein [Listeria monocytogenes FSL N1-017]
 gi|332312263|gb|EGJ25358.1| Ribosomal RNA small subunit methyltransferase B [Listeria
           monocytogenes str. Scott A]
          Length = 444

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 208/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWADQYGIEKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        E        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFTLEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + +I++ P  +        G DGFF  +LR++
Sbjct: 408 VLPEKLAQIKKDDFIQLLPTDI--------GSDGFFVSSLRKV 442


>gi|290893049|ref|ZP_06556038.1| sun protein [Listeria monocytogenes FSL J2-071]
 gi|290557409|gb|EFD90934.1| sun protein [Listeria monocytogenes FSL J2-071]
 gi|313608142|gb|EFR84195.1| ribosomal RNA small subunit methyltransferase B [Listeria
           monocytogenes FSL F2-208]
          Length = 444

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 122/463 (26%), Positives = 208/463 (44%), Gaps = 43/463 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW  +R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDAIKDPVQKIAVETSLPEWLAKRWADQYGIEKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        E        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIPTEQLIKELNDQGITVTRNEFIEEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLAAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFALEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
              +    +  + +I++ P  +        G DGFF  +LR++
Sbjct: 408 VLPEKLAQIKKDDFIQLLPTDI--------GSDGFFVSSLRKV 442


>gi|308047743|ref|YP_003911309.1| 16S rRNA m(5)C-967 methyltransferase [Ferrimonas balearica DSM
           9799]
 gi|307629933|gb|ADN74235.1| 16S rRNA m(5)C-967 methyltransferase [Ferrimonas balearica DSM
           9799]
          Length = 441

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 125/451 (27%), Positives = 198/451 (43%), Gaps = 39/451 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           N R +++ ++  V+ +  SL+  L              RD+ L+  I    +R LP++D 
Sbjct: 5   NLRALAASVVIQVIDQGHSLSQALPKAQSKLR----DARDKALLAEIAYGVMRQLPQLDT 60

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLVN 125
            L   L   L  KK  +  LL   + Q+ +  V  +AVV  +V  A R+        LVN
Sbjct: 61  QLRRCLQKPLSGKKRIIHGLLLAGLYQLKHTRVGSHAVVAESVN-ACREIGAPGMTGLVN 119

Query: 126 SILRRVSREKI----ELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYI--D 179
            +LR + R+      E     +     P WF +RL+  Y  +    +     +P     +
Sbjct: 120 GVLRALDRDMDALQAEQFDAPSVHYRHPGWFIKRLQQAYPDQWAAILDANNEAPPLWLRN 179

Query: 180 LTVKFDIETWAHKL-----NAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPV 234
             ++   + +  +L      AV            P  +  LPGF +G   VQD SA I  
Sbjct: 180 NALQQSRDAYLQQLADAGVEAVAGEEQEAIRLPKPRDVTGLPGFPKGAVSVQDHSAQISG 239

Query: 235 QLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKV---TALDVSKRRLEKLRCNLDRLHLYAE 291
           +L        VLD CAAPGGK+  ++    ++    ALDV   RL +++ NLDRL L A 
Sbjct: 240 RLLNAQPGERVLDACAAPGGKSCHILEQQPQLAELVALDVDPWRLTRVQQNLDRLGLTAT 299

Query: 292 --DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLL 349
                  D   +   + FD +L+DAPCS+TG IRR+PD  W R  +DI + A  Q K+L 
Sbjct: 300 LKCGDGTDPQSWWDGQAFDRILLDAPCSATGVIRRNPDSKWLRRDEDIAQLAELQGKILR 359

Query: 350 QGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSP 409
                +KPGG +V++ CS+   ++ + +Q  L+++P  +            I      + 
Sbjct: 360 ACWQMLKPGGTLVYATCSVLPDENVQQIQAFLQNTPDAM---------LDPIVAGEDDTT 410

Query: 410 EGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            GW ++ P           G DGF+   L +
Sbjct: 411 PGW-QLLP--------TVEGGDGFYYARLIK 432


>gi|187778898|ref|ZP_02995371.1| hypothetical protein CLOSPO_02493 [Clostridium sporogenes ATCC
           15579]
 gi|187772523|gb|EDU36325.1| hypothetical protein CLOSPO_02493 [Clostridium sporogenes ATCC
           15579]
          Length = 442

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 124/458 (27%), Positives = 206/458 (44%), Gaps = 42/458 (9%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V+  +L  V+ +      +L+ +   S    L   D+ L+  IV  TL++   +D 
Sbjct: 3   NAREVALDVLKAVLYEGAYSNIVLNKKLNKS---NLKDNDKALITEIVYGTLKYKETLDI 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   L + +     ++  +LR+++ QI YLD +  +A V+ AVE +K+   +  ++KLV
Sbjct: 60  IIQSYLKNPIKTMDKNIANILRITIYQIRYLDKIPSFAAVNEAVEMSKKI--SIKYSKLV 117

Query: 125 NSILRRVSREKIELLQR--------IAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           N +LR   R                 + I   P+W  +   + YG E    I        
Sbjct: 118 NGVLRNYIRTYKNKKFYDDRNNLEKFSFIYSYPKWLIKMFISQYGIEIAEKILKGLNERP 177

Query: 177 YIDLTVK---FDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQD 227
            I + V     D +    KL+          +          ++I   P F EG   VQD
Sbjct: 178 NITVRVNNLKIDYDEAFEKLDEYGYNIEEGYICPEAIQIIKGKNIEKNPLFIEGDITVQD 237

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            SA +            VLDLC+APGGKT  +   I + +KV A DV + +L  +  N  
Sbjct: 238 ESAMLVAPSMELTEESIVLDLCSAPGGKTTHISEIINNKSKVYAYDVHQNKLSLIEENAK 297

Query: 285 RLHLYAEDIIEMDAFDYCPKKLF--DAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL +   +    DA  +  +       VL+D PCS  G IR+ P++ WT++  +I     
Sbjct: 298 RLGIKNVETDVCDAAIFNKELKEIAHRVLMDVPCSGLGIIRKKPEIKWTKNEKEIKNIID 357

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            QRK++  G S++K GGI+++S C+L+K+++EE +   L+      ++ PL      +I 
Sbjct: 358 IQRKIMNNGASYLKKGGILLYSTCTLNKEENEENINWFLKKHKN-FKIEPLYYGDVDNI- 415

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  EG++ I P+           MDGFF   L++
Sbjct: 416 ---IYHKEGFVSILPN---------DKMDGFFIAKLKK 441


>gi|237795946|ref|YP_002863498.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum Ba4 str. 657]
 gi|229261794|gb|ACQ52827.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum Ba4 str. 657]
          Length = 442

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 116/456 (25%), Positives = 201/456 (44%), Gaps = 38/456 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V+  +L  V+ +      +L  +   S    L   D+ L+  IV  TL++   +D 
Sbjct: 3   NAREVALDVLKAVLFEGAYSNIVLSKKLNKS---NLKDNDKALITEIVYGTLKYKETLDI 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH----- 119
           ++   L + +     ++  +LR+++ QI YLD +  +A V+ AVE +K+           
Sbjct: 60  IIQSYLRNPIKTMDKNIINILRITIYQIRYLDKIPSFAAVNEAVEMSKKISIKYSKLVNG 119

Query: 120 -FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
                + +   +   +    L++ + +   P+W  +   + YG E    I         I
Sbjct: 120 VLRNYIRTYKNKKFYDHRNNLEKFSFMYSYPKWLIKMFISQYGIEIAEKILKGLNERPNI 179

Query: 179 DLTVK---FDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
            + V     D +    KL           +          ++I   P F EG   VQD S
Sbjct: 180 TVRVNNLKIDYDEAFEKLGEYGYNIEEGYICPEAIQIIKGKNIEKNPLFIEGNITVQDES 239

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           A +            VLDLC+APGGKT  +   + + +KV A D+ + +L  +  N  RL
Sbjct: 240 AMLVAPSMELDEESIVLDLCSAPGGKTTHISEIMNNKSKVYAYDIHQNKLSLIESNAKRL 299

Query: 287 HLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
            +   +    DA  +  K  +    VL+D PCS  G IR+ P++ WT++  +I      Q
Sbjct: 300 GIKNIETDVGDAAVFNKKLKEKAHRVLMDVPCSGLGIIRKKPEIKWTKNEREIKNIIDIQ 359

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           RK++  G S++K GGI+++S C+L+K+++EE +   L+      ++ PL      +I   
Sbjct: 360 RKIMNNGASYLKEGGILLYSTCTLNKEENEENINWFLKKHKN-FKIEPLYYGDVDNI--- 415

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                EG++ I P+           MDGFF   L++
Sbjct: 416 -IYHKEGFVSILPN---------DKMDGFFIAKLKK 441


>gi|254229997|ref|ZP_04923398.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
 gi|262392829|ref|YP_003284683.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
 gi|151937499|gb|EDN56356.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
 gi|262336423|gb|ACY50218.1| ribosomal RNA small subunit methyltransferase B [Vibrio sp. Ex25]
          Length = 427

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 124/452 (27%), Positives = 208/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L      +A + +  RD  L++ I    LR+LPR++
Sbjct: 1   MNVRAAAANVLYLVVDKGHSLSSALP-----AAQQTVRPRDHALLQEICYGALRYLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            + + ++   L  K+     L+ V + Q+ ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  MIANQLMDKPLKGKQRVFHHLILVGIYQLSFMRIPAHAAVGETVEGTKELKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQR----IAGISIIPEWFKERLENFYGK-ERVLAISDACISPLYID 179
           N++LR   R + EL Q      AG    P W  + L+  Y +    +  ++   +P+++ 
Sbjct: 115 NAVLRNYQRNQEELDQMAVSNNAGKYGHPSWLLKLLQEAYPQQWESIVEANNQKAPMWLR 174

Query: 180 L-TVKFDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDASASI 232
           +       + +   L    + +              P  ++ LPGF +G   VQDA+A +
Sbjct: 175 VNHQHHTRDEYLALLKNENIDSTPHTEAMDAIKLAAPCDVMKLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA      SG++V A+D    RL+++  NL RL+L A
Sbjct: 235 SINYLKPQDGELILDCCAAPGGKTAHILERTSGSEVVAIDCDDTRLKRVHENLKRLNLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                   +  ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  Q ++ 
Sbjct: 295 KVVCGDARNPQEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIAALAELQSEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
               + +KPGG +V++ CS+  Q++ E V+  L  +     L        +         
Sbjct: 355 DAMWTQLKPGGTMVYATCSITPQENVEQVKAFLARTADAQLLDSDPDQPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EEDMDGFYYAVLSK 424


>gi|145300988|ref|YP_001143829.1| ribosomal RNA small subunit methyltransferase B [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142853760|gb|ABO92081.1| ribosomal RNA small subunit methyltransferase B [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 430

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 128/454 (28%), Positives = 204/454 (44%), Gaps = 43/454 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ ++  V+ +  SL+ +L      +A   ++ RD+ L++ +   TLR+LPR+D
Sbjct: 1   MKTRAQAALVIQQVLDQGQSLSAVLP-----AAQEKVAPRDRALLQELCYGTLRWLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A +  ++   L  K      L+ V + Q++Y  +  +A V   V   K  K       L+
Sbjct: 56  AAVGEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKLLKGT-SLRGLI 114

Query: 125 NSILRRVSREKIELLQRIAGISI----IPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           N +LR   R    +L RI  +       PEW  +RL   Y ++    I +A      + +
Sbjct: 115 NGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAYPEDW-EFIMEANNQRPPMWI 173

Query: 181 TVKFDIETWAHKLNA---------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
                 +     L                    L E P  +  LPGF  G   VQD +A 
Sbjct: 174 RNNSQRQGREQMLARMAEVGINAVAGQEGEDCILLERPCDVTKLPGFETGDCSVQDGAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGA---KVTALDVSKRRLEKLRCNLDRLHL 288
              +L        VLD CAAPGGKTA L+        V A+D  + RL++++ NLDR+ L
Sbjct: 234 QAARLLDPQPGEWVLDACAAPGGKTAHLLERQPALAGVVAVDADENRLKRVQENLDRIGL 293

Query: 289 YA--EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
            A            + P+  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  QR+
Sbjct: 294 QARVIHGDASTPELWWPQGQFDRILLDAPCSATGVIRRHPDIKWLRRDQDIRELAELQRR 353

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA 406
           +L+   S +K GG ++++ CS+  +++ E ++  L ++P    LVPL++           
Sbjct: 354 ILIALWSKLKSGGTLLYATCSVLPEENREQIRAFLATTPDAT-LVPLHAQDTPDCP---- 408

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                  +  P   E        MDGF+   L +
Sbjct: 409 -----GRQFLPGEAE--------MDGFYYAKLIK 429


>gi|110803437|ref|YP_699027.1| sun protein [Clostridium perfringens SM101]
 gi|110683938|gb|ABG87308.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           perfringens SM101]
          Length = 442

 Score =  262 bits (668), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 109/459 (23%), Positives = 201/459 (43%), Gaps = 42/459 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR +   +L  V+         ++ ++  +    +  +D+ L+  +V  T+++   ID
Sbjct: 1   MNARKIIVEILDNVLLNGAYSNIEINKQFASN---DIDPKDKGLITEVVYGTIKYKKMID 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +L   +   + +   S+  +LR ++ Q+ +LD V  YA+V+ AV   K      + AK 
Sbjct: 58  IILSNFVA-DIGKIDESVVNILRSAIYQMKFLDRVPPYAIVNEAVNLTKET--EPNLAKF 114

Query: 124 VNSILRRVSREKIELLQRI-------AGISIIPEWFKERLENFYGKERVLAISDACISPL 176
           VN +LR   R + +  +                 W  E     YGK+  L I     +  
Sbjct: 115 VNGVLRNYLRNENKNFKVGLRNNEALCYDFSFDRWMIEMFIKQYGKDDALRILRGLNTIP 174

Query: 177 YIDLTVKF---DIETWAHKLNAVMLPTGGI------RLKELPESIVSLPGFAEGVWWVQD 227
           Y+ + V     D +    +L                 + +   +I     + EG+  VQD
Sbjct: 175 YVTVRVNTCKADYDEVYERLEEEGYDIEEGAFSPEAIIIKKGSAIEKNKLYQEGLITVQD 234

Query: 228 ASASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLD 284
            SA +   LF   ++  V+DLC+APG K   +   +++  KV A D+   +L  ++ N+D
Sbjct: 235 ESAMLVAPLFDLKDDEQVMDLCSAPGTKATHIGELMMNKGKVVAFDIHDHKLTLIKENID 294

Query: 285 RLHLYAEDIIEMDAFDYCPKK--LFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSAC 342
           RL L   ++   DA     K     D VL+D PCS  G IR+ P++ W +  +D+ +   
Sbjct: 295 RLGLTNVEVELGDATKINSKYINWADRVLLDVPCSGLGIIRKKPEIKWNKKNNDLTEVVK 354

Query: 343 FQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSID 402
            Q+++L    ++++ GG +V+S C+L+K+++EEV+   +  +             +    
Sbjct: 355 VQKEILKNAWNYLREGGELVYSTCTLNKKENEEVIDWFVEKNSDCEV-----EKVFLGKA 409

Query: 403 MAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
             +  +  G + I P+           MDGFF   L++ 
Sbjct: 410 DNVVYNDNGSVTILPNKY---------MDGFFIAKLKKK 439


>gi|313618293|gb|EFR90347.1| ribosomal RNA small subunit methyltransferase B [Listeria innocua
           FSL S4-378]
          Length = 446

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 123/467 (26%), Positives = 209/467 (44%), Gaps = 44/467 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW   R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDLIKDPVQKIAVETSLPEWLARRWADQYGLEKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLN-----AVMLPTGGIRLKELPESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN     A         L     S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRAEQLIKELNDQGITATRNEFIDEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLVAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFESETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFALEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
              +    +  + ++++ P  +        G DGFF  +LR++  P+
Sbjct: 408 VLPEKLAQIKKDDFVQLLPTDI--------GSDGFFVSSLRKVS-PE 445


>gi|330831512|ref|YP_004394464.1| ribosomal RNA small subunit methyltransferase B [Aeromonas veronii
           B565]
 gi|328806648|gb|AEB51847.1| Ribosomal RNA small subunit methyltransferase B [Aeromonas veronii
           B565]
          Length = 430

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 128/455 (28%), Positives = 203/455 (44%), Gaps = 43/455 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M  R  ++ ++  V+ +  SL+ +L      +A   ++ RD+ L++ +   TLR+LPR+D
Sbjct: 1   MKTRAQAALVIQQVLDQGQSLSAVLP-----AAQEKVAPRDRALLQELCYGTLRWLPRLD 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           A ++ ++   L  K      L+ V + Q++Y  +  +A V   V   K  K       L+
Sbjct: 56  AAVNEMMDKPLKNKSRIFHYLILVGLYQLIYTRIPAHAAVAETVNAVKLLKGT-SLRGLI 114

Query: 125 NSILRRVSREKIELLQRIAGISI----IPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           N +LR   R    +L RI  +       PEW  +RL   Y  +    I +A      + +
Sbjct: 115 NGVLRNFQRSAEVILLRIDRVPSIRLGHPEWLTKRLRQAY-HDEWEFIMEANNQRPPMWI 173

Query: 181 TVKFDIETWAHKLNA---------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASAS 231
                 ++    L                    L E P  +  LPGF  G   VQD +A 
Sbjct: 174 RNNSQRQSRDAMLARMAEAGINAVAGEEGEDCILLERPCDVTKLPGFEVGDCSVQDGAAQ 233

Query: 232 IPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAK---VTALDVSKRRLEKLRCNLDRLHL 288
               L        VLD CAAPGGKTA L+    K   V A+D  + RL++++ NLDR+ L
Sbjct: 234 QAAALLDPQPGEWVLDACAAPGGKTAHLLERQPKLAGVVAVDADENRLKRVQENLDRIGL 293

Query: 289 YA--EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRK 346
            A            + P+  FD +L+DAPCS+TG IRRHPD+ W R   DI + A  QR+
Sbjct: 294 TAKVIHGDAAAPEQWWPEGQFDRILLDAPCSATGVIRRHPDIKWLRRDQDIRELAELQRR 353

Query: 347 LLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMA 406
           +L      +K GG ++++ CS+  +++ E ++  L ++    +LVPL+            
Sbjct: 354 ILNALWGKLKSGGTLLYATCSVLPEENREQIRAFLAATK-DAKLVPLHEQDTPDCP---- 408

Query: 407 LSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRL 441
                  +  P   E        MDGF+   L +L
Sbjct: 409 -----GRQFLPGEAE--------MDGFYYAKLVKL 430


>gi|222151048|ref|YP_002560202.1| hypothetical protein MCCL_0799 [Macrococcus caseolyticus JCSC5402]
 gi|222120171|dbj|BAH17506.1| conserved hypothetical protein [Macrococcus caseolyticus JCSC5402]
          Length = 434

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 107/462 (23%), Positives = 198/462 (42%), Gaps = 47/462 (10%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK   N R V+  +L  V+ +      L++          +   D+ L+  +V  TL+  
Sbjct: 1   MK--HNVRSVALEILDAVLTEGAYSNLLINEAIKKG---YVEPVDRALLTELVYGTLQRK 55

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ++      + +++      +++L+ +S+ Q +YLD V D+A+++ AVE  KR + +  
Sbjct: 56  LTLEFYAAPYIKTNIKG---WMRRLILMSIYQSVYLDKVPDHAIINEAVEITKR-RGSMG 111

Query: 120 FAKLVNSILRRVSREK-------IELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
            A  VN+ILR   R          + L+R++  +  P W  +     +G +  L +++  
Sbjct: 112 GANTVNAILRNFQRNPLRDLSEIKDDLKRLSVATSTPLWLIKHWNTHFGFDTTLEMAEEF 171

Query: 173 ISPLYIDLTVKFDI---ETWAHKLNAVMLPTGG-----IRLKELPESIVSLPGFAEGVWW 224
           ++     + V       E    +L                L      IV    F  G   
Sbjct: 172 LNYPDTTVRVNTTKITPEDAIKRLTEAGYTVEQSEIIPECLTIDGPPIVQHELFKHGFLS 231

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVSGAKVTA---LDVSKRRLEKLRC 281
           VQDAS+ +   +     + ++LD C+APGGK   +     +       DV   +++ ++ 
Sbjct: 232 VQDASSMLVANVLDPQPDETILDACSAPGGKACHIAEKMNRTGHIDSHDVHPHKIDLIQY 291

Query: 282 NLDRLHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341
           N+ RL L        DA     K  +D VLVDAPCS  G ++R P++ + +   DI    
Sbjct: 292 NITRLSLRNIHPSVHDATIPYDK-QYDRVLVDAPCSGFGVMKRKPEIKYDKTQKDIDTLW 350

Query: 342 CFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSI 401
             Q ++L    + VKPGG++V+S C++++ ++E VV   ++ +    E+ P+        
Sbjct: 351 PLQLEILKNAANAVKPGGVLVYSTCTIEQMENENVVYSFIKQN-EDFEIEPIELP----- 404

Query: 402 DMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQ 443
                +  +  +++ P             DGFF   LRR  +
Sbjct: 405 ----VIGKQKLLQVLPQDF--------NSDGFFIAKLRRKCK 434


>gi|153938943|ref|YP_001391803.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum F str. Langeland]
 gi|152934839|gb|ABS40337.1| ribosomal RNA small subunit methyltransferase B [Clostridium
           botulinum F str. Langeland]
          Length = 442

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 117/456 (25%), Positives = 201/456 (44%), Gaps = 38/456 (8%)

Query: 6   NARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDA 65
           NAR V+  +L  V+ +      +L  +   S    L   D+ L+  IV  TL++   +D 
Sbjct: 3   NAREVALDVLKAVLFEGAYSNIVLSKKLNKS---NLKDNDKALITEIVYGTLKYKETLDI 59

Query: 66  VLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH----- 119
           ++   L + +     ++  +LR+++ QI YLD +  +A V+ AVE +K+           
Sbjct: 60  IIQSYLRNPIKTMDKNIVNILRITIYQIRYLDKIPSFAAVNEAVEMSKKISIKYSKLVNG 119

Query: 120 -FAKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYI 178
                + +   +   +    L++ + +   P+W  +   + YG E    I         I
Sbjct: 120 VLRNYIRTYKNKKFYDHRNNLEKFSFMYSYPKWLIKMFISQYGIEMAEKILKGLNERPNI 179

Query: 179 DLTVK---FDIETWAHKLNAVMLPTGGIRLKE------LPESIVSLPGFAEGVWWVQDAS 229
            + V     D +    KL           +          ++I   P F EG   VQD S
Sbjct: 180 TVRVNNLKIDYDEAFEKLGEYGYNIEEGYICPEAIQIIKGKNIEKNPLFIEGNITVQDES 239

Query: 230 ASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDRL 286
           A +            VLDLC+APGGKT  +   + + +KV A DV + +L  +  N  RL
Sbjct: 240 AMLVAPSMELDEESIVLDLCSAPGGKTTHISEIMNNKSKVYAYDVHQNKLSLIESNAKRL 299

Query: 287 HLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQ 344
            +   +    DA  +  K  +    VL+D PCS  G IR+ P++ WT++  +I      Q
Sbjct: 300 GIKNIETDVGDAAVFNKKLKEKAHRVLMDVPCSGLGIIRKKPEIKWTKNEREIKNIIAIQ 359

Query: 345 RKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMA 404
           RK++  G S++K GGI+++S C+L+K+++EE +   L+      ++ PL      +I   
Sbjct: 360 RKIMNNGASYLKEGGILLYSTCTLNKEENEENINWFLKKHKN-FKIEPLYYGDVDNI--- 415

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                EG++ I P+           MDGFF   L++
Sbjct: 416 -IYHKEGFVSILPN---------DKMDGFFIAKLKK 441


>gi|331091584|ref|ZP_08340420.1| ribosomal RNA small subunit methyltransferase B [Lachnospiraceae
           bacterium 2_1_46FAA]
 gi|330403611|gb|EGG83167.1| ribosomal RNA small subunit methyltransferase B [Lachnospiraceae
           bacterium 2_1_46FAA]
          Length = 449

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 96/463 (20%), Positives = 187/463 (40%), Gaps = 38/463 (8%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           M   ++ R +   +L  + ++      +L        ++ L ++++  +  +V  TL  L
Sbjct: 1   MTKQISEREIVLGILLEITKEGGYSHIVLRNTLE--KYQYLDKKERAFITRVVEGTLEHL 58

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             ID +++      + + K  ++ ++R SV QI Y+D V + AV + AV+ A++ K    
Sbjct: 59  IEIDYIINQFSKVKVNKMKPVIRTIIRNSVYQIKYMDSVPNSAVCNEAVKLAEK-KGFFQ 117

Query: 120 FAKLVNSILRR--------VSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDA 171
               VN +LR            +K  +++ ++    +P W  E     Y    +  I   
Sbjct: 118 LKGFVNGVLRNIDRNVSNIQYPDKKNMVEYMSIKYSMPIWILEEWGKSYDFSVIERILQG 177

Query: 172 CISPLYIDLTVK---FDIETWAHKLNAVMLPTGGIRL------KELPESIVSLPGFAEGV 222
            +      +         E    KL    +                   +  +  F EG 
Sbjct: 178 FLEEKGTTIRCNLNKISKEELVEKLKKENVRVKEHAYLPYALEISGYNYLGDMESFREGD 237

Query: 223 WWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQLIVS---GAKVTALDVSKRRLEKL 279
           + VQD S+ +  ++        V+D+C+APGGK   +         V A D++  ++  +
Sbjct: 238 FQVQDISSMLVSEIADPKKEDYVIDVCSAPGGKALHMADKLGETGYVEARDLTDYKVSLI 297

Query: 280 RCNLDRLHLYAEDIIEMDAFDYCP--KKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDI 337
             N++R  +     ++ DA       K+  D VL D PCS  G + +  D+ +    +  
Sbjct: 298 EDNIERSGMKNIRAVKQDALICDEESKEKADIVLADLPCSGLGVLGKKTDIKYKMTRETQ 357

Query: 338 VKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAY 397
            +    QRK+L    ++ KPGG +V+S C+++++++   V+  L+  P       L S  
Sbjct: 358 QELKKLQRKILSVVQNYTKPGGTLVYSTCTINEEENIGNVRWFLKQYPQ----YQLVSVE 413

Query: 398 WKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
            +  D       EG +++ P +           DGFF    R+
Sbjct: 414 DRLCDELKPSVKEGCLQLLPGI--------HNSDGFFIAKFRK 448


>gi|313623277|gb|EFR93521.1| ribosomal RNA small subunit methyltransferase B [Listeria innocua
           FSL J1-023]
          Length = 446

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 121/467 (25%), Positives = 209/467 (44%), Gaps = 44/467 (9%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MK     R ++  L+  +   +     L++        + L+  D+ L+  +V  T +  
Sbjct: 1   MKKQKTVRAIALELIIKIENNQSYSHLLINDALKK---QKLNPLDKGLLTELVYGTTQRK 57

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRH 119
             +D  L   L          ++ LLR+SV Q+ +LD V ++A+++ A + AK D  ++ 
Sbjct: 58  ITLDYYLAPFLNKEP---DNWVKNLLRMSVYQLTFLDKVPEHAILNEAGDIAK-DLGHQG 113

Query: 120 FAKLVNSILRRVSRE-------KIELLQRIAGISIIPEWFKERLENFYGKERVLAISDAC 172
             K VN +LR V R+         + +Q+IA  + +PEW   R  + YG E++  I  A 
Sbjct: 114 VTKFVNGVLRNVIRKGVPSIDLIKDPVQKIAVETSLPEWLARRWADQYGLEKLREIGLAF 173

Query: 173 ISPLYIDLTVKFD---IETWAHKLNAVMLPTGGIRLKEL-----PESIVSLPGFAEGVWW 224
           +   +  + V       E    +LN   +        +        S+     + +G   
Sbjct: 174 LVAPHQSIRVNQTEIRAEQLIKELNDQGITVTRNEFIDEALLVEKGSVAETKAYKDGKCS 233

Query: 225 VQDASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRC 281
           +QD S+ +        +NL+VLD CAAPGGKT      +     V ALD+ +++ + +  
Sbjct: 234 IQDESSMLVAYALQLEDNLTVLDACAAPGGKTTHIAEKMHGTGMVHALDIHEKKTKLIDQ 293

Query: 282 NLDRLHLYAEDIIEMDAFD---YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIV 338
              RL L       +DA         + FD +LVDAPCS  G +RR PD+ + +   DI 
Sbjct: 294 AAKRLQLLNIRTAHLDARTASTMFEPETFDRILVDAPCSGFGVLRRKPDIKYAKTEKDIH 353

Query: 339 KSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYW 398
           K A  Q  +L      VK  GI+V+S C++DK+++E V++  L   P    L P+     
Sbjct: 354 KLAEIQLAILDDVSQLVKENGILVYSTCTIDKEENETVLRAFLEKHP-EFALEPV----- 407

Query: 399 KSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFAVALRRLIQPK 445
              +    +  + ++++ P  +        G DGFF  +LR++  P+
Sbjct: 408 VLPEKLAQIKKDDFVQLLPTDI--------GSDGFFVSSLRKVS-PE 445


>gi|149190437|ref|ZP_01868708.1| Sun protein [Vibrio shilonii AK1]
 gi|148835691|gb|EDL52657.1| Sun protein [Vibrio shilonii AK1]
          Length = 425

 Score =  261 bits (667), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 123/452 (27%), Positives = 209/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++++L  V+ K  SL+  L L       + +  RDQ L++ I    LR LPR++
Sbjct: 1   MNVRAAAANILFQVVDKGQSLSSALPL-----GQQQVKPRDQALLQEICFGALRILPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           +V   ++   L  K+     L+ V + QI ++ +  +A V   VE  K  K  R    L+
Sbjct: 56  SVASELMDKPLKGKQRVFHHLILVGIYQIGHMRIPAHAAVGETVEATKTLKGPR-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKERVLAISDAC-ISPLYID 179
           N++LR   R + +L +      AG    P W  + L+  Y ++  + +      +P+++ 
Sbjct: 115 NAVLRNYQRNQEQLDEISVSHNAGKYGHPSWLLKLLQESYPQQWEMIVEANNTKAPMWLR 174

Query: 180 LTVKF-DIETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDASASI 232
           +  +  + + +   L    + +              P  + +LPGF +G   VQDA+A +
Sbjct: 175 VNHQHLNRDDYQALLKNEGIDSTAHSEALDALKLAAPCDVNNLPGFDKGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQ--LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            +      +   +LD CAAPGGKTA        ++V A+D  + RL+++  NL RL L A
Sbjct: 235 SINYLEPKDGELILDCCAAPGGKTAHILERTKDSQVVAIDCDETRLKRVHDNLKRLKLQA 294

Query: 291 --EDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                      ++   + FD +L+DAPCS+TG IRRHPD+ W R  DDI   A  QR++ 
Sbjct: 295 KVVCGDARTPSEWWQGEQFDRILLDAPCSATGVIRRHPDIKWLRRADDIEALAELQREIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +K GG +V++ CS+  Q+++E V+  L  +    +L+  +              
Sbjct: 355 DAMWQQLKVGGTLVYATCSITPQENKEQVKAFLART-DNAQLIDSDIDNP---------- 403

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L++
Sbjct: 404 ---GRQILPG--------EEDMDGFYYAVLKK 424


>gi|90581174|ref|ZP_01236973.1| Putative Sun protein [Vibrio angustum S14]
 gi|90437695|gb|EAS62887.1| Putative Sun protein [Vibrio angustum S14]
          Length = 426

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 120/452 (26%), Positives = 209/452 (46%), Gaps = 44/452 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MN R  ++ ++  V+ +  SL+  L      +A + + +RD  L++ I    LR+LPR++
Sbjct: 1   MNVRATAAKVIYQVVDQGQSLSAALP-----AAQQDIRERDHALLQEICYGVLRWLPRLE 55

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
           ++   ++   L  K+     L+ V + Q+ Y+ +  +A V   V   K  K+ +    L+
Sbjct: 56  SITQALMDKPLKGKQRVFHHLILVGLYQLGYMRIPAHAAVAETVNATKTLKKPQ-LRGLI 114

Query: 125 NSILRRVSREKIELLQ----RIAGISIIPEWFKERLENFYGKERV-LAISDACISPLYID 179
           N+ILR   R++ EL        AG    P W  + L+  Y ++   +  ++   +P+++ 
Sbjct: 115 NAILRNYQRQQEELDTKAISHDAGKYGHPSWLLKLLKESYPEQFADICEANNTKAPMWLR 174

Query: 180 LTVKFD-IETWAHKLNAVMLPTGGIRLK------ELPESIVSLPGFAEGVWWVQDASASI 232
           +  + +  + +   L+A  + T              P  +  LPGF++G   VQDA+A +
Sbjct: 175 VNRQHNTRDAYRALLDAEDIATELHPQAADALRLVSPCDVTKLPGFSDGWVSVQDAAAQL 234

Query: 233 PVQLFGTLNNLSVLDLCAAPGGKTAQLIVS--GAKVTALDVSKRRLEKLRCNLDRLHLYA 290
            V          +LD CAAPGGKTA ++      KV A+D  + RL+++  NL RL+L A
Sbjct: 235 AVDYLQPKAGELILDCCAAPGGKTAHIMEHVPSTKVVAIDCDENRLKRVHENLARLNLDA 294

Query: 291 E--DIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLL 348
                       +     FD +L+DAPCS+TG IRRHPD+ W R  +DI   A  Q ++ 
Sbjct: 295 TVLCADARYPEQWWQGDKFDRILLDAPCSATGVIRRHPDIKWLRRGEDIAALATLQAEIF 354

Query: 349 LQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALS 408
                 +KPGG +V++ CS+  Q++ + V+  L  +     +    +   +         
Sbjct: 355 DAMWLQLKPGGTLVYATCSITPQENCDQVKAFLARTSDATLIGSDPAKPGR--------- 405

Query: 409 PEGWIRITPDMLEKIDGVSSGMDGFFAVALRR 440
                +I P            MDGF+   L +
Sbjct: 406 -----QILPG--------EESMDGFYYAVLTK 424


>gi|220931836|ref|YP_002508744.1| sun protein [Halothermothrix orenii H 168]
 gi|219993146|gb|ACL69749.1| sun protein [Halothermothrix orenii H 168]
          Length = 440

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 111/450 (24%), Positives = 187/450 (41%), Gaps = 36/450 (8%)

Query: 7   ARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRIDAV 66
           +R V+  +L  +  K      +L+ E    +     +RD+  +  +V   LR   R+D +
Sbjct: 4   SRKVAIKVLIEID-KGAYSNLVLNKELNKVS----DKRDRAFITELVYGVLRQKKRLDYM 58

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKLVN 125
           L       L +    +   LRV++ QI Y D V   A V   VE  K    +    K  N
Sbjct: 59  LSCFSKRPLRKMDNEVLSALRVALYQIEYTDSVPARAAVYETVEALKSFTGH-GAVKFTN 117

Query: 126 SILRRV---------SREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPL 176
            +LR                  +  +A     PEW  +   N YG +    +        
Sbjct: 118 GVLRSYLRNKDKIIFPDRNQNPVNFLANYYSYPEWIIKEWINKYGFKDTERLCQYLNDSP 177

Query: 177 YIDLTVKFDIETWAHKLNA--------VMLPTGGIRLKELPESIVSLPGFAEGVWWVQDA 228
            + +            L                   +     +I  LP F +G + VQ  
Sbjct: 178 PVTVRYNRLQVDQKRFLEVFKKYNIEVESTTVPDCYVVNNFNTIKDLPLFKDGGFIVQGP 237

Query: 229 SASIPVQLFGTLNNLSVLDLCAAPGGKTAQL---IVSGAKVTALDVSKRRLEKLRCNLDR 285
           +A++   + G      VLD+ A PGGKT  L   + +  ++ ALD+ + +L+ +  N +R
Sbjct: 238 AATLAGFVLGPDPGNRVLDMSAGPGGKTTHLAELMNNRGEIIALDIYEHKLKLIEENCNR 297

Query: 286 LHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQR 345
           L +     I++D  DY  ++ FD VLVDAPC+  G +   P++ W R  +D+ K    Q+
Sbjct: 298 LGVNIVKTIKVDGRDYTSQEKFDMVLVDAPCTGLGLVAHKPEIKWNRTENDVKKLQEIQK 357

Query: 346 KLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWK-SIDMA 404
            LL   +S V+ GG V++S C+L + ++EEVV +VL+ +   V  V +     +      
Sbjct: 358 SLLHNALSLVRDGGFVLYSTCTLTRAENEEVVNQVLQQTDFVVSPVNMEKRLSEIGFSGK 417

Query: 405 MALSPEGWIRITPDMLEKIDGVSSGMDGFF 434
             ++PEG++   P          S  +GF+
Sbjct: 418 FKITPEGYLEFFP--------PESKTEGFY 439


>gi|255101745|ref|ZP_05330722.1| ribosomal RNA small subunit methyltransferase [Clostridium
           difficile QCD-63q42]
          Length = 441

 Score =  261 bits (666), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 99/460 (21%), Positives = 207/460 (45%), Gaps = 43/460 (9%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           M+AR V   +L  + +        ++  + +     +S  D+ L   ++   +     +D
Sbjct: 1   MDAREVGFKVLCDIEKNDNYSNIAINKHFKN---LEISDMDRGLATELIYGVIENKYYLD 57

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLD-VADYAVVDLAVEQAKRDKENRHFAKL 123
            +++ +    + +    ++  LR+   QIL+LD ++DYA V+  V+ +K+   ++  +  
Sbjct: 58  YIINKLSKIKVKKMSTYVKIFLRMGTYQILFLDSISDYAAVNETVKLSKKY--DKKSSGF 115

Query: 124 VNSILRRVSREKIELLQ--------RIAGISIIPEWFKERLENFYGKERVLAISDACISP 175
           +N+ILR   R K  ++          ++       W  +   + +G+E    + +A    
Sbjct: 116 INAILRNEIRAKETIMDITEEDSVKYLSIKYSYNSWIIKNWIDKFGQEFAEDLLEANNEK 175

Query: 176 LYIDLTVKF---DIETWAHKLNAVMLPT------GGIRLKELPESIVSLPGFAEGVWWVQ 226
             I +         E    KL+ + +              E  ++I     F  G++ +Q
Sbjct: 176 PSIYIRTNTLKISREELIEKLSEMGIVCLKVPMVEEAIKVEKMKNIEKNELFKAGLFTIQ 235

Query: 227 DASASIPVQLFGTLNNLSVLDLCAAPGGKTAQ---LIVSGAKVTALDVSKRRLEKLRCNL 283
           D S+ I  ++        +LD+C+APGGK+     L+ +  +V A D+ + +L+ +   +
Sbjct: 236 DISSMIVGKVINPKEGSFILDVCSAPGGKSTHLATLMNNTGQVVARDIFEHKLKLINSTV 295

Query: 284 DRLHLYAEDIIEMDAFDYCPK--KLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSA 341