RPSBLAST alignment for GI: 254780666 and conserved domain: cd00620

>gnl|CDD|29566 cd00620, Methyltransferase_Sun, N-terminal RNA binding domain of the methyltransferase Sun. The rRNA-specific 5-methylcytidine transferase Sun, also known as RrmB or Fmu shares the RNA-binding non-catalytic domain with the transcription termination factor NusB. The precise biological role of this domain in Sun is unknown, although it is likely to be involved in sequence-specific RNA binding. The C-terminal methyltransferase domain of Sun has been shown to catalyze formation of m5C at position 967 of 16S rRNA in Escherichia coli.. Length = 126
 Score = 73.0 bits (179), Expect = 1e-13
 Identities = 47/131 (35%), Positives = 71/131 (54%), Gaps = 5/131 (3%)

Query: 5   MNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFLPRID 64
           MNAR  ++ +L  V+++  SL  +L            S RD+ L   +V  TLR+L  +D
Sbjct: 1   MNARSTAAEVLRDVLQRGASLNAVLSALQKKD----KSDRDRGLATELVYGTLRWLALLD 56

Query: 65  AVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHFAKLV 124
            +++ +L      K   ++ LLR+ + Q+LYLDV  +A VD  VE AK  K+    A LV
Sbjct: 57  WIINPLLKKPDVGKDPDVRNLLRLGLYQLLYLDVPPHAAVDETVEIAKIRKD-LGRAGLV 115

Query: 125 NSILRRVSREK 135
           N++LRR  RE 
Sbjct: 116 NAVLRRFERED 126