RPSBLAST alignment for GI: 254780666 and conserved domain: KOG1122

>gnl|CDD|36338 KOG1122, KOG1122, KOG1122, tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification]. Length = 460
 Score =  137 bits (347), Expect = 5e-33
 Identities = 78/246 (31%), Positives = 122/246 (49%), Gaps = 12/246 (4%)

Query: 202 GIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQ 258
           G+ + +    I + P +  G + +Q+AS+ +PV          +LD+CAAPGGKT   A 
Sbjct: 202 GLVVFDSVVPIGATPEYLAGHYMLQNASSFLPVMALDPQPGERILDMCAAPGGKTTHIAA 261

Query: 259 LIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFDYCPKKL---FDAVLVDAP 315
           L+ +   + A D ++ RL+ L+ NL RL +    +   D  ++  K+    FD VL+DAP
Sbjct: 262 LMKNTGVIFANDSNENRLKSLKANLHRLGVTNTIVSNYDGREFPEKEFPGSFDRVLLDAP 321

Query: 316 CSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEE 375
           CS TG I +   V   +   DI++ A  QR+LLL  I  VK GG++V+S CS+  +++E 
Sbjct: 322 CSGTGVISKDQSVKTNKTVKDILRYAHLQRELLLSAIDLVKAGGVLVYSTCSITVEENEA 381

Query: 376 VVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDMLEKIDGVSSGMDGFFA 435
           VV   L+  P  V+LVP                  G    +  +  +       MDGFF 
Sbjct: 382 VVDYALKKRP-EVKLVPTGLDIGGE-----GRFRGGRFHPSLKLTRRFYPHVHNMDGFFV 435

Query: 436 VALRRL 441
             L++ 
Sbjct: 436 AKLKKA 441