BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein
[Candidatus Liberibacter asiaticus str. psy62]
         (445 letters)

Database: las_proteome 
           1233 sequences; 328,796 total letters

Searching...................................................done



>gi|254780666|ref|YP_003065079.1| Fmu (Sun) domain protein [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 445

 Score =  902 bits (2330), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/445 (100%), Positives = 445/445 (100%)

Query: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60
           MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL
Sbjct: 1   MKSGMNARLVSSHLLSCVMRKRISLTCLLDLEYGDSAFRLLSQRDQILVRAIVNVTLRFL 60

Query: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120
           PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF
Sbjct: 61  PRIDAVLDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQAKRDKENRHF 120

Query: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180
           AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL
Sbjct: 121 AKLVNSILRRVSREKIELLQRIAGISIIPEWFKERLENFYGKERVLAISDACISPLYIDL 180

Query: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240
           TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL
Sbjct: 181 TVKFDIETWAHKLNAVMLPTGGIRLKELPESIVSLPGFAEGVWWVQDASASIPVQLFGTL 240

Query: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300
           NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD
Sbjct: 241 NNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMDAFD 300

Query: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360
           YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI
Sbjct: 301 YCPKKLFDAVLVDAPCSSTGTIRRHPDVLWTRDTDDIVKSACFQRKLLLQGISFVKPGGI 360

Query: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420
           VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML
Sbjct: 361 VVFSNCSLDKQDSEEVVQKVLRSSPIPVELVPLNSAYWKSIDMAMALSPEGWIRITPDML 420

Query: 421 EKIDGVSSGMDGFFAVALRRLIQPK 445
           EKIDGVSSGMDGFFAVALRRLIQPK
Sbjct: 421 EKIDGVSSGMDGFFAVALRRLIQPK 445


>gi|254780634|ref|YP_003065047.1| NOL1/NOP2/SUN family signature protein [Candidatus Liberibacter
           asiaticus str. psy62]
          Length = 429

 Score = 90.1 bits (222), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/178 (29%), Positives = 89/178 (50%), Gaps = 17/178 (9%)

Query: 218 FAEGVWWVQDASASIPVQLFGTLNNLSVLDLCAAPGGKT---AQLIVSGAKVTALDVSKR 274
           F  G + +QD  + I   L    N+  +LD CA  GGKT   + L+ +  ++ A D +K 
Sbjct: 208 FQRGWFEIQDEGSQIVSNLTAITNSSQILDFCAGGGGKTLALSMLLNNKGQIHAWDNNKS 267

Query: 275 RLEKLRCNLDR-------LHLYAEDIIEMDAFDYCPKKLFDAVLVDAPCSSTGTIRRHPD 327
           R+  +   + R       LH   E +  +       ++ F  VLVDAPCS TGT RR PD
Sbjct: 268 RMAPIVARIKRAGIHNVQLHSSWESLRNL-------QEHFTTVLVDAPCSGTGTWRRRPD 320

Query: 328 VLWTRDTDDIVKSACFQRKLLLQGISFVKPGGIVVFSNCSLDKQDSEEVVQKVLRSSP 385
           + W     ++++    Q+K+L +   FV+P G +V+  CS+  +++ + +   L  +P
Sbjct: 321 IKWRLSQKNLIERTEEQKKILEESAQFVRPEGYLVYITCSILPEENIQQINYFLSKNP 378


>gi|254780398|ref|YP_003064811.1| dimethyladenosine transferase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 284

 Score = 29.6 bits (65), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 17/71 (23%), Positives = 36/71 (50%)

Query: 238 GTLNNLSVLDLCAAPGGKTAQLIVSGAKVTALDVSKRRLEKLRCNLDRLHLYAEDIIEMD 297
           G+L+ ++V+++ A PG  T  L+  GA+   +    ++   +  ++   H    +II+ D
Sbjct: 44  GSLDGITVIEIGAGPGNLTQMLLTLGARKVIVIEKDQQFFPILKDISSQHPNRLEIIQDD 103

Query: 298 AFDYCPKKLFD 308
           A     +K F+
Sbjct: 104 ALKVDFEKFFN 114


>gi|254780772|ref|YP_003065185.1| surface antigen (D15) [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 781

 Score = 23.9 bits (50), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 10/44 (22%), Positives = 26/44 (59%)

Query: 67  LDFVLISSLPRKKYSLQQLLRVSVAQILYLDVADYAVVDLAVEQ 110
           +++ +I    R+  +      V+++Q+   DV+DY ++ ++V+Q
Sbjct: 395 INYSMIERAKRRIMATGYFSEVNISQLPANDVSDYVILRVSVKQ 438


>gi|254780461|ref|YP_003064874.1| 3-oxoacyl-(acyl carrier protein) synthase I [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 406

 Score = 23.5 bits (49), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 12/29 (41%), Positives = 16/29 (55%)

Query: 248 LCAAPGGKTAQLIVSGAKVTALDVSKRRL 276
           L A  GG + + IVS A +T    S RR+
Sbjct: 100 LIAGSGGPSTKCIVSAADLTREHCSTRRI 128


>gi|254780222|ref|YP_003064635.1| DNA topoisomerase IV subunit B [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 686

 Score = 23.1 bits (48), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 10/28 (35%), Positives = 17/28 (60%)

Query: 257 AQLIVSGAKVTALDVSKRRLEKLRCNLD 284
            +++ S  K TA+D +KR L ++  N D
Sbjct: 621 GEMLASQLKETAMDANKRTLLRVEINKD 648


  Database: las_proteome
    Posted date:  Jun 5, 2011  6:30 PM
  Number of letters in database: 328,796
  Number of sequences in database:  1233
  
Lambda     K      H
   0.323    0.138    0.406 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 275,147
Number of Sequences: 1233
Number of extensions: 11295
Number of successful extensions: 29
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 6
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 21
Number of HSP's gapped (non-prelim): 8
length of query: 445
length of database: 328,796
effective HSP length: 77
effective length of query: 368
effective length of database: 233,855
effective search space: 86058640
effective search space used: 86058640
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 40 (20.0 bits)