RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780667|ref|YP_003065080.1| hypothetical protein CLIBASIA_02770 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) >gnl|CDD|161830 TIGR00344, alaS, alanine--tRNA ligase. The model describes alanine--tRNA ligase. This enzyme catalyzes the reaction (tRNAala + L-alanine + ATP = L-alanyl-tRNAala + pyrophosphate + AMP). Length = 851 Score = 24.7 bits (54), Expect = 5.4 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 6/41 (14%) Query: 3 KGLLHADDIEFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ 43 G L A+D +FR VQ+ P+ VV+ FG + + + Sbjct: 505 TGYLIANDGKFRVVDVQK------PNGVVFHFGEVEGGSLK 539 >gnl|CDD|150068 pfam09272, Hepsin-SRCR, Hepsin, SRCR. Members of this family form an extracellular domain of the serine protease hepsin. They are formed primarily by three elements of regular secondary structure: a 12-residue alpha helix, a twisted five-stranded antiparallel beta sheet, and a second, two-stranded, antiparallel sheet. The two beta-sheets lie at roughly right angles to each other, with the helix nestled between the two, adopting an SRCR fold. The exact function of this domain has not been identified, though it probably may serve to orient the protease domain or place it in the vicinity of its substrate. Length = 110 Score = 24.1 bits (52), Expect = 7.1 Identities = 10/32 (31%), Positives = 11/32 (34%), Gaps = 2/32 (6%) Query: 12 EFRFTAVQRLVFAFYPSAVVWEFGRILTATCQ 43 E QRL+ GR L A CQ Sbjct: 73 EGELPYGQRLLTVISVCDC--PRGRFLEAICQ 102 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.336 0.142 0.458 Gapped Lambda K H 0.267 0.0693 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 707,279 Number of extensions: 25278 Number of successful extensions: 81 Number of sequences better than 10.0: 1 Number of HSP's gapped: 81 Number of HSP's successfully gapped: 3 Length of query: 43 Length of database: 5,994,473 Length adjustment: 17 Effective length of query: 26 Effective length of database: 5,627,137 Effective search space: 146305562 Effective search space used: 146305562 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 50 (23.1 bits)