HHsearch alignment for GI: 254780671 and conserved domain: PRK10772

>PRK10772 cell division protein FtsL; Provisional.
Probab=95.92  E-value=0.16  Score=30.24  Aligned_cols=59  Identities=15%  Similarity=0.096  Sum_probs=43.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCC---CEEEE
Q ss_conf             9999999999999999999999999999999950279989899999999980987898---68767
Q gi|254780671|r   39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD---EIILF  101 (105)
Q Consensus        39 ~~~~~l~~~~~~~~~~l~~l~~~~~~L~~~i~~L~~~~~D~d~lEe~aR~~Lg~~kp~---E~iii  101 (105)
T Consensus        58 H~TR~l~~e~e~L~~erd~Ld~EW~nL~LEqstl~~----hsRIE~~A~~~L~M~~pdp~qEviVv  119 (121)
T PRK10772         58 HHTRLLTAQREQLVLERDALDIEWRNLILEENALGD----HSRVERIATEKLQMQHVDPSQENIVV  119 (121)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHCCCCCCCCCCCEEEE
T ss_conf             898999988999999999999999999999986221----65899999985598369941044653