HHsearch alignment for GI: 254780671 and conserved domain: TIGR02209

>TIGR02209 ftsL_broad cell division protein FtsL; InterPro: IPR011922 This entry represents FtsL, both forms similar to that in Escherichia coli and similar to that in Bacillus subtilis. FtsL is one of the later proteins active in cell division septum formation. FtsL is small, low in complexity, and highly divergent , .; GO: 0007049 cell cycle, 0051301 cell division, 0016021 integral to membrane.
Probab=97.90  E-value=0.00026  Score=47.39  Aligned_cols=60  Identities=17%  Similarity=0.242  Sum_probs=54.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHCCCCCCCEEEEE
Q ss_conf             9999999999999999999999999999999950279989899999999980987898687675
Q gi|254780671|r   39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY  102 (105)
Q Consensus        39 ~~~~~l~~~~~~~~~~l~~l~~~~~~L~~~i~~L~~~~~D~d~lEe~aR~~Lg~~kp~E~iii~  102 (105)
T Consensus        24 ~~~r~~~~e~~~~~~~~~~~~~e~~~L~lE~~~L~~----~~Ri~~iA~~~L~m~~~~~~~~~~   83 (85)
T TIGR02209        24 HQTRQLNNELQKLQLEIDKLQKEWRDLQLEVAELSR----HERIEKIAKKQLGMKLPDANIKVV   83 (85)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC----HHHHHHHHHHHCCCCCCCCCCEEC
T ss_conf             999999999999999999999999989999986014----889999999865899876554010