BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Reference for composition-based statistics starting in round 2: Schaffer, Alejandro A., L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Query= gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] (105 letters) Database: nr 14,124,377 sequences; 4,842,793,630 total letters Searching..................................................done Results from round 1 >gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] gi|254040348|gb|ACT57144.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 105 Score = 211 bits (538), Expect = 2e-53, Method: Compositional matrix adjust. Identities = 105/105 (100%), Positives = 105/105 (100%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE Sbjct: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF Sbjct: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 >gi|315122218|ref|YP_004062707.1| putative cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495620|gb|ADR52219.1| putative cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 120 Score = 159 bits (402), Expect = 1e-37, Method: Compositional matrix adjust. Identities = 81/105 (77%), Positives = 90/105 (85%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT++YKK FFR +F VIAF V+YF NHAI D GL+ KSLEKSLIERERFL EL+E Sbjct: 16 MWTRHYKKGKFFRIVFRVIAFFSVIYFINHAIKDDCGLEETKSLEKSLIERERFLFELQE 75 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 RS+LERKVKLMSDGSLEKDLLDEKARY+LNLSRSDEIILFY +F Sbjct: 76 VRSKLERKVKLMSDGSLEKDLLDEKARYNLNLSRSDEIILFYPNF 120 >gi|227821845|ref|YP_002825815.1| hypothetical protein NGR_c12810 [Sinorhizobium fredii NGR234] gi|227340844|gb|ACP25062.1| hypothetical protein NGR_c12810 [Sinorhizobium fredii NGR234] Length = 106 Score = 112 bits (279), Expect = 2e-23, Method: Compositional matrix adjust. Identities = 51/102 (50%), Positives = 74/102 (72%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK R + VIA + YF H+I G YGL+A + ++ + ER+ L EL + Sbjct: 1 MWTRHHKKRRLGRLVVPVIAVAFLSYFGYHSIHGGYGLRATEEFDRQIAERQARLDELTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE++V+LMSDGSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 61 KRQILEKEVELMSDGSLERDMLDEKARLALNMSRSDEIVIFH 102 >gi|307309211|ref|ZP_07588882.1| Septum formation initiator [Sinorhizobium meliloti BL225C] gi|307321954|ref|ZP_07601335.1| Septum formation initiator [Sinorhizobium meliloti AK83] gi|306892378|gb|EFN23183.1| Septum formation initiator [Sinorhizobium meliloti AK83] gi|306900357|gb|EFN30973.1| Septum formation initiator [Sinorhizobium meliloti BL225C] Length = 106 Score = 110 bits (274), Expect = 8e-23, Method: Compositional matrix adjust. Identities = 50/102 (49%), Positives = 74/102 (72%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK R + ++A + YF H+I G YGL+A K ++ + ER+ L EL + Sbjct: 1 MWTRHHKKRRLGRLVVPLLAVAFLSYFGYHSIHGGYGLEATKEFDRQIAERQARLDELTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE++V+LMSDGSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 61 TRKILEKEVELMSDGSLERDMLDEKARLALNMSRSDEIVIFH 102 >gi|218660789|ref|ZP_03516719.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli IE4771] Length = 106 Score = 109 bits (273), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 51/101 (50%), Positives = 71/101 (70%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ +ERE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVEREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIF 101 >gi|218461963|ref|ZP_03502054.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli Kim 5] Length = 106 Score = 109 bits (273), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 51/101 (50%), Positives = 71/101 (70%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ +ERE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVEREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIF 101 >gi|116251996|ref|YP_767834.1| cell division protein [Rhizobium leguminosarum bv. viciae 3841] gi|115256644|emb|CAK07732.1| putative cell division protein [Rhizobium leguminosarum bv. viciae 3841] Length = 106 Score = 107 bits (268), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 50/101 (49%), Positives = 70/101 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ + RE+ L+ LK Sbjct: 1 MWTKHHKKRKIGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVAREKELAVLKT 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIF 101 >gi|190891626|ref|YP_001978168.1| cell division protein (septum formation initiator protein) [Rhizobium etli CIAT 652] gi|190696905|gb|ACE90990.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli CIAT 652] Length = 106 Score = 107 bits (268), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 50/101 (49%), Positives = 70/101 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVAREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIF 101 >gi|150396295|ref|YP_001326762.1| septum formation initiator [Sinorhizobium medicae WSM419] gi|150027810|gb|ABR59927.1| Septum formation initiator [Sinorhizobium medicae WSM419] Length = 106 Score = 107 bits (268), Expect = 5e-22, Method: Compositional matrix adjust. Identities = 48/102 (47%), Positives = 73/102 (71%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK R + ++A + YF H+I G YGL+A K ++ + R+ L +L + Sbjct: 1 MWTRHHKKRRLGRLVVPLLAVAFLSYFGYHSIHGGYGLEATKEFDRQIAGRQARLEDLTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE++V+LMSDGSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 61 QRKTLEKEVELMSDGSLERDMLDEKARLALNMSRSDEIVIFH 102 >gi|327189240|gb|EGE56419.1| putative cell division protein (septum formation initiator protein) [Rhizobium etli CNPAF512] Length = 106 Score = 107 bits (266), Expect = 7e-22, Method: Compositional matrix adjust. Identities = 49/101 (48%), Positives = 70/101 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H + GDYGL+A ++ E+ + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCVHGDYGLRATETFERQRVAREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIF 101 >gi|86357553|ref|YP_469445.1| putative septum formation initiator protein [Rhizobium etli CFN 42] gi|86281655|gb|ABC90718.1| putative septum formation initiator protein [Rhizobium etli CFN 42] Length = 106 Score = 106 bits (265), Expect = 9e-22, Method: Compositional matrix adjust. Identities = 50/101 (49%), Positives = 69/101 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVAREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIF 101 >gi|241204523|ref|YP_002975619.1| Septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858413|gb|ACS56080.1| Septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 106 Score = 106 bits (264), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 50/101 (49%), Positives = 69/101 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKIGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVAREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEIVVF 101 >gi|209549201|ref|YP_002281118.1| septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534957|gb|ACI54892.1| Septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 106 Score = 105 bits (263), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 49/101 (48%), Positives = 69/101 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKIGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVAREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DE+++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEVVIF 101 >gi|222148555|ref|YP_002549512.1| hypothetical protein Avi_2110 [Agrobacterium vitis S4] gi|221735541|gb|ACM36504.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 103 Score = 105 bits (263), Expect = 1e-21, Method: Compositional matrix adjust. Identities = 48/101 (47%), Positives = 69/101 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++K F R + + + YF H+I GDYGLKA + + ER + L+ L Sbjct: 1 MWTRHHKNRKFGRLVLPAVTIAFIGYFGYHSIHGDYGLKAGEHFDVVRAERSKELAALIH 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +R +LE +VKL+SDGSLE+D++DEKARY LN+SR DEI++F Sbjct: 61 DRKKLETQVKLLSDGSLERDMIDEKARYQLNMSRPDEIVIF 101 >gi|325292759|ref|YP_004278623.1| Septum formation initiator [Agrobacterium sp. H13-3] gi|325060612|gb|ADY64303.1| Septum formation initiator [Agrobacterium sp. H13-3] Length = 105 Score = 105 bits (261), Expect = 2e-21, Method: Compositional matrix adjust. Identities = 49/105 (46%), Positives = 73/105 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK F R I I + YF H+I GD+GL+A + LE+ I R L++L + Sbjct: 1 MWTRHHKKRRFGRLIVPAITIAFLSYFGYHSIHGDFGLQATERLERQRIARTAELAKLTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 R LER+V+L+SDGSLE+D++DE +RY LN+SR+DEI++ + F Sbjct: 61 ARVALERQVELLSDGSLERDMIDEISRYQLNMSRTDEIVIMNTYF 105 >gi|218678337|ref|ZP_03526234.1| putative septum formation initiator protein [Rhizobium etli CIAT 894] Length = 106 Score = 104 bits (260), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 49/101 (48%), Positives = 69/101 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVVREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +V L+SDGSL++D+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDRDMLDEKARYQLNMSRADEIVIF 101 >gi|222085875|ref|YP_002544406.1| septum formation initiator protein [Agrobacterium radiobacter K84] gi|221723323|gb|ACM26479.1| septum formation initiator protein [Agrobacterium radiobacter K84] Length = 103 Score = 104 bits (260), Expect = 4e-21, Method: Compositional matrix adjust. Identities = 51/101 (50%), Positives = 67/101 (66%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTKY+KK F R + I V YF H I GDYGLKA + E+ I+R + L++L Sbjct: 1 MWTKYHKKRRFGRFVLPAITIAFVSYFGYHCIHGDYGLKATEVFEQRRIDRGKELADLVA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE+ V L+SDGSL+KD+LD+ ARY L SR+DEI++F Sbjct: 61 KREHLEKAVALLSDGSLDKDMLDQYARYQLTYSRADEIVIF 101 >gi|159184756|ref|NP_354434.2| hypothetical protein Atu1428 [Agrobacterium tumefaciens str. C58] gi|159140044|gb|AAK87219.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 105 Score = 103 bits (258), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 48/105 (45%), Positives = 73/105 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK F R I I + YF H+I GD+GL+A + LE+ + R L++L + Sbjct: 1 MWTRHHKKRRFGRLIVPAITIAFLSYFGYHSIHGDFGLQATERLERQRLTRTAELAKLTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 R LER+V+L+SDGSLE+D++DE +RY LN+SR+DEI++ + F Sbjct: 61 ARVALERQVELLSDGSLERDMIDEISRYQLNMSRTDEIVIMNTYF 105 >gi|15965197|ref|NP_385550.1| hypothetical protein SMc01029 [Sinorhizobium meliloti 1021] gi|15074377|emb|CAC46023.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] Length = 93 Score = 95.5 bits (236), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 46/87 (52%), Positives = 64/87 (73%), Gaps = 2/87 (2%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 L +AF YF H+I G YGL+A K ++ + ER+ L EL + R LE++V+LMSDG Sbjct: 5 LLAVAFLS--YFGYHSIHGGYGLEATKEFDRQIAERQARLDELTQTRKILEKEVELMSDG 62 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFY 102 SLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 63 SLERDMLDEKARLALNMSRSDEIVIFH 89 >gi|13470618|ref|NP_102187.1| hypothetical protein mlr0382 [Mesorhizobium loti MAFF303099] gi|14021360|dbj|BAB47973.1| mlr0382 [Mesorhizobium loti MAFF303099] Length = 120 Score = 87.0 bits (214), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 6/104 (5%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVV---YFTNHAIVGDYGLKANKSLEKSLIERERFLSE 57 MWT+ +K+ + R L+I CVV YF HA G++G+ + LE + + L Sbjct: 14 MWTRQHKQRNTGR---LIIPSLCVVFLAYFGFHAYHGEFGINSKYQLEAQTVALQAQLDA 70 Query: 58 LKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +K R LER+V+LM DG+LEKD+LDE+AR +LNLS++DEI + Sbjct: 71 IKARRMELERRVRLMHDGTLEKDMLDEQARRALNLSQADEITIM 114 >gi|260459503|ref|ZP_05807758.1| Septum formation initiator [Mesorhizobium opportunistum WSM2075] gi|259035057|gb|EEW36313.1| Septum formation initiator [Mesorhizobium opportunistum WSM2075] Length = 107 Score = 86.3 bits (212), Expect = 1e-15, Method: Compositional matrix adjust. Identities = 45/104 (43%), Positives = 65/104 (62%), Gaps = 6/104 (5%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVV---YFTNHAIVGDYGLKANKSLEKSLIERERFLSE 57 MWT+ +K+ + R L+I CVV YF HA G++G+ + LE + + L Sbjct: 1 MWTRQHKQRNTGR---LIIPSLCVVFLAYFGFHAYHGEFGINSKYQLETQTVALQAQLDA 57 Query: 58 LKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +K R LER+V+LM DG+LEKD+LDE+AR +LNLS+ DEI + Sbjct: 58 VKARRMELERRVRLMHDGTLEKDMLDEQARKALNLSQPDEITIM 101 >gi|110633983|ref|YP_674191.1| septum formation initiator [Mesorhizobium sp. BNC1] gi|110284967|gb|ABG63026.1| Septum formation initiator [Chelativorans sp. BNC1] Length = 105 Score = 85.5 bits (210), Expect = 2e-15, Method: Compositional matrix adjust. Identities = 40/102 (39%), Positives = 64/102 (62%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++K+ + R I + + YF HA G+YGL A LE+ + E L L++ Sbjct: 1 MWTRHHKRRNTGRLIVPAVTALVLSYFGFHAYQGEYGLNAKAQLEQRVASLEAELEALRK 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R +LE + L+S +E+D+LDE+AR +LNLS+ +EI++FY Sbjct: 61 ARGKLEERAGLLSGDMIEQDMLDEQARRALNLSKENEIVIFY 102 >gi|163760090|ref|ZP_02167173.1| putative cell division protein [Hoeflea phototrophica DFL-43] gi|162282489|gb|EDQ32777.1| putative cell division protein [Hoeflea phototrophica DFL-43] Length = 102 Score = 85.1 bits (209), Expect = 3e-15, Method: Compositional matrix adjust. Identities = 42/101 (41%), Positives = 63/101 (62%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T++ ++ + + V++ C VYF H+ GD+GL A +LE+ +E L+ L E Sbjct: 1 MRTQFRRQQSWGLWVIPVLSIGCFVYFGFHSWHGDFGLNATAALEQRRVELTERLATLTE 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE +VKL+SDG +E D LDE+AR LN++R DEI+ F Sbjct: 61 RRQHLETRVKLLSDGIVEADALDERARLMLNVAREDEIVYF 101 >gi|319783387|ref|YP_004142863.1| septum formation initiator [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169275|gb|ADV12813.1| Septum formation initiator [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 107 Score = 83.2 bits (204), Expect = 1e-14, Method: Compositional matrix adjust. Identities = 40/101 (39%), Positives = 63/101 (62%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+ +K+ + R I + + YF HA G++G+ + LE + + L +K Sbjct: 1 MWTRQHKQRNTGRLIIPSLCVAFLAYFGFHAYHGEFGIYSKYQLEAQTVALQGQLDAIKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LER+V+LM +G+LEKD+LDE+AR +LNLS++DEI + Sbjct: 61 RRMELERRVRLMHEGTLEKDMLDEQARKALNLSQADEITIM 101 >gi|23502008|ref|NP_698135.1| hypothetical protein BR1130 [Brucella suis 1330] gi|62290043|ref|YP_221836.1| hypothetical protein BruAb1_1136 [Brucella abortus bv. 1 str. 9-941] gi|82699970|ref|YP_414544.1| septum formation initiator [Brucella melitensis biovar Abortus 2308] gi|148559039|ref|YP_001259051.1| hypothetical protein BOV_1088 [Brucella ovis ATCC 25840] gi|161619082|ref|YP_001592969.1| septum formation initiator [Brucella canis ATCC 23365] gi|163843397|ref|YP_001627801.1| septum formation initiator [Brucella suis ATCC 23445] gi|189024284|ref|YP_001935052.1| Septum formation initiator [Brucella abortus S19] gi|225627600|ref|ZP_03785637.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225852630|ref|YP_002732863.1| septum formation initiator [Brucella melitensis ATCC 23457] gi|237815553|ref|ZP_04594550.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|254689356|ref|ZP_05152610.1| Septum formation initiator [Brucella abortus bv. 6 str. 870] gi|254693840|ref|ZP_05155668.1| Septum formation initiator [Brucella abortus bv. 3 str. Tulya] gi|254697489|ref|ZP_05159317.1| Septum formation initiator [Brucella abortus bv. 2 str. 86/8/59] gi|254701873|ref|ZP_05163701.1| Septum formation initiator [Brucella suis bv. 5 str. 513] gi|254704419|ref|ZP_05166247.1| Septum formation initiator [Brucella suis bv. 3 str. 686] gi|254706685|ref|ZP_05168513.1| Septum formation initiator [Brucella pinnipedialis M163/99/10] gi|254710207|ref|ZP_05172018.1| Septum formation initiator [Brucella pinnipedialis B2/94] gi|254714204|ref|ZP_05176015.1| Septum formation initiator [Brucella ceti M644/93/1] gi|254717639|ref|ZP_05179450.1| Septum formation initiator [Brucella ceti M13/05/1] gi|254730386|ref|ZP_05188964.1| Septum formation initiator [Brucella abortus bv. 4 str. 292] gi|256031701|ref|ZP_05445315.1| Septum formation initiator [Brucella pinnipedialis M292/94/1] gi|256061213|ref|ZP_05451365.1| Septum formation initiator [Brucella neotomae 5K33] gi|256113686|ref|ZP_05454497.1| Septum formation initiator [Brucella melitensis bv. 3 str. Ether] gi|256159856|ref|ZP_05457589.1| Septum formation initiator [Brucella ceti M490/95/1] gi|256255102|ref|ZP_05460638.1| Septum formation initiator [Brucella ceti B1/94] gi|256257602|ref|ZP_05463138.1| Septum formation initiator [Brucella abortus bv. 9 str. C68] gi|256263877|ref|ZP_05466409.1| septum formation initiator [Brucella melitensis bv. 2 str. 63/9] gi|256369556|ref|YP_003107066.1| septum formation initiator [Brucella microti CCM 4915] gi|260168833|ref|ZP_05755644.1| septum formation initiator [Brucella sp. F5/99] gi|260546596|ref|ZP_05822335.1| septum formation initiator [Brucella abortus NCTC 8038] gi|260566334|ref|ZP_05836804.1| septum formation initiator [Brucella suis bv. 4 str. 40] gi|260754873|ref|ZP_05867221.1| septum formation initiator [Brucella abortus bv. 6 str. 870] gi|260758090|ref|ZP_05870438.1| septum formation initiator [Brucella abortus bv. 4 str. 292] gi|260761914|ref|ZP_05874257.1| septum formation initiator [Brucella abortus bv. 2 str. 86/8/59] gi|260883885|ref|ZP_05895499.1| septum formation initiator [Brucella abortus bv. 9 str. C68] gi|261214124|ref|ZP_05928405.1| septum formation initiator [Brucella abortus bv. 3 str. Tulya] gi|261219478|ref|ZP_05933759.1| septum formation initiator [Brucella ceti M13/05/1] gi|261222297|ref|ZP_05936578.1| septum formation initiator [Brucella ceti B1/94] gi|261314146|ref|ZP_05953343.1| septum formation initiator [Brucella pinnipedialis M163/99/10] gi|261317765|ref|ZP_05956962.1| septum formation initiator [Brucella pinnipedialis B2/94] gi|261321974|ref|ZP_05961171.1| septum formation initiator [Brucella ceti M644/93/1] gi|261325221|ref|ZP_05964418.1| septum formation initiator [Brucella neotomae 5K33] gi|261752436|ref|ZP_05996145.1| septum formation initiator [Brucella suis bv. 5 str. 513] gi|261755096|ref|ZP_05998805.1| septum formation initiator [Brucella suis bv. 3 str. 686] gi|261758321|ref|ZP_06002030.1| septum formation initiator [Brucella sp. F5/99] gi|265988796|ref|ZP_06101353.1| septum formation initiator [Brucella pinnipedialis M292/94/1] gi|265995047|ref|ZP_06107604.1| septum formation initiator [Brucella melitensis bv. 3 str. Ether] gi|265998261|ref|ZP_06110818.1| septum formation initiator [Brucella ceti M490/95/1] gi|294852468|ref|ZP_06793141.1| septum formation initiator [Brucella sp. NVSL 07-0026] gi|297248444|ref|ZP_06932162.1| septum formation initiator [Brucella abortus bv. 5 str. B3196] gi|306841856|ref|ZP_07474538.1| septum formation initiator [Brucella sp. BO2] gi|306843995|ref|ZP_07476590.1| septum formation initiator [Brucella sp. BO1] gi|23347960|gb|AAN30050.1| conserved hypothetical protein [Brucella suis 1330] gi|62196175|gb|AAX74475.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82616071|emb|CAJ11109.1| Septum formation initiator [Brucella melitensis biovar Abortus 2308] gi|148370296|gb|ABQ60275.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161335893|gb|ABX62198.1| Septum formation initiator [Brucella canis ATCC 23365] gi|163674120|gb|ABY38231.1| Septum formation initiator [Brucella suis ATCC 23445] gi|189019856|gb|ACD72578.1| Septum formation initiator [Brucella abortus S19] gi|225617605|gb|EEH14650.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225640995|gb|ACO00909.1| Septum formation initiator [Brucella melitensis ATCC 23457] gi|237788851|gb|EEP63062.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|255999718|gb|ACU48117.1| septum formation initiator [Brucella microti CCM 4915] gi|260095646|gb|EEW79523.1| septum formation initiator [Brucella abortus NCTC 8038] gi|260155852|gb|EEW90932.1| septum formation initiator [Brucella suis bv. 4 str. 40] gi|260668408|gb|EEX55348.1| septum formation initiator [Brucella abortus bv. 4 str. 292] gi|260672346|gb|EEX59167.1| septum formation initiator [Brucella abortus bv. 2 str. 86/8/59] gi|260674981|gb|EEX61802.1| septum formation initiator [Brucella abortus bv. 6 str. 870] gi|260873413|gb|EEX80482.1| septum formation initiator [Brucella abortus bv. 9 str. C68] gi|260915731|gb|EEX82592.1| septum formation initiator [Brucella abortus bv. 3 str. Tulya] gi|260920881|gb|EEX87534.1| septum formation initiator [Brucella ceti B1/94] gi|260924567|gb|EEX91135.1| septum formation initiator [Brucella ceti M13/05/1] gi|261294664|gb|EEX98160.1| septum formation initiator [Brucella ceti M644/93/1] gi|261296988|gb|EEY00485.1| septum formation initiator [Brucella pinnipedialis B2/94] gi|261301201|gb|EEY04698.1| septum formation initiator [Brucella neotomae 5K33] gi|261303172|gb|EEY06669.1| septum formation initiator [Brucella pinnipedialis M163/99/10] gi|261738305|gb|EEY26301.1| septum formation initiator [Brucella sp. F5/99] gi|261742189|gb|EEY30115.1| septum formation initiator [Brucella suis bv. 5 str. 513] gi|261744849|gb|EEY32775.1| septum formation initiator [Brucella suis bv. 3 str. 686] gi|262552729|gb|EEZ08719.1| septum formation initiator [Brucella ceti M490/95/1] gi|262766160|gb|EEZ11949.1| septum formation initiator [Brucella melitensis bv. 3 str. Ether] gi|263094008|gb|EEZ17942.1| septum formation initiator [Brucella melitensis bv. 2 str. 63/9] gi|264660993|gb|EEZ31254.1| septum formation initiator [Brucella pinnipedialis M292/94/1] gi|294821057|gb|EFG38056.1| septum formation initiator [Brucella sp. NVSL 07-0026] gi|297175613|gb|EFH34960.1| septum formation initiator [Brucella abortus bv. 5 str. B3196] gi|306275750|gb|EFM57474.1| septum formation initiator [Brucella sp. BO1] gi|306288083|gb|EFM59480.1| septum formation initiator [Brucella sp. BO2] gi|326409149|gb|ADZ66214.1| Septum formation initiator [Brucella melitensis M28] gi|326538857|gb|ADZ87072.1| Septum formation initiator [Brucella melitensis M5-90] Length = 109 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 46/105 (43%), Positives = 66/105 (62%), Gaps = 4/105 (3%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE--KSLIERERFLSEL 58 MWTK +K+ R I V+ + YF HA G+YGL A LE KSL+ + L+++ Sbjct: 1 MWTKQKRKSIRGRFILPVLTAAFLSYFGFHAYHGEYGLYARIQLEEQKSLLNAQ--LAKI 58 Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 59 SADRIALEKRVALLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|254719194|ref|ZP_05181005.1| Septum formation initiator [Brucella sp. 83/13] gi|265984191|ref|ZP_06096926.1| septum formation initiator [Brucella sp. 83/13] gi|306838187|ref|ZP_07471043.1| septum formation initiator [Brucella sp. NF 2653] gi|264662783|gb|EEZ33044.1| septum formation initiator [Brucella sp. 83/13] gi|306406777|gb|EFM63000.1| septum formation initiator [Brucella sp. NF 2653] Length = 109 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 46/105 (43%), Positives = 66/105 (62%), Gaps = 4/105 (3%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE--KSLIERERFLSEL 58 MWTK +K+ R I V+ + YF HA G+YGL A LE KSL+ + L+++ Sbjct: 1 MWTKQKRKSIRGRFILPVLTAVFLSYFGFHAYHGEYGLYARIQLEEQKSLLNAQ--LAKI 58 Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 59 SADRIALEKRVALLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|239832019|ref|ZP_04680348.1| septum formation initiator [Ochrobactrum intermedium LMG 3301] gi|239824286|gb|EEQ95854.1| septum formation initiator [Ochrobactrum intermedium LMG 3301] Length = 109 Score = 79.3 bits (194), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 43/105 (40%), Positives = 67/105 (63%), Gaps = 4/105 (3%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE--KSLIERERFLSEL 58 MWTK +K+ R + ++ + YF HA G++GL + LE KSL+ ++ L ++ Sbjct: 1 MWTKQKRKSIRGRFVLPILTAAFLSYFGFHAYHGEFGLYSRIQLEEQKSLLAKQ--LEQV 58 Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +RS LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 59 TADRSALEKRVTLLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|153009388|ref|YP_001370603.1| septum formation initiator [Ochrobactrum anthropi ATCC 49188] gi|151561276|gb|ABS14774.1| Septum formation initiator [Ochrobactrum anthropi ATCC 49188] Length = 109 Score = 79.0 bits (193), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 43/105 (40%), Positives = 67/105 (63%), Gaps = 4/105 (3%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE--KSLIERERFLSEL 58 MWTK +K+ R + ++ + YF HA G+YGL + LE KSL+ ++ L ++ Sbjct: 1 MWTKQKRKSIRGRFVLPILTAAFLSYFGFHAYHGEYGLYSRIQLEEQKSLLAKQ--LEQV 58 Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R+ LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 59 TADRNALEKRVTLLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|17987136|ref|NP_539770.1| hypothetical protein BMEI0853 [Brucella melitensis bv. 1 str. 16M] gi|256044787|ref|ZP_05447691.1| hypothetical protein Bmelb1R_09859 [Brucella melitensis bv. 1 str. Rev.1] gi|260565610|ref|ZP_05836094.1| septum formation initiator [Brucella melitensis bv. 1 str. 16M] gi|265991211|ref|ZP_06103768.1| septum formation initiator [Brucella melitensis bv. 1 str. Rev.1] gi|17982800|gb|AAL52034.1| hypothetical protein BMEI0853 [Brucella melitensis bv. 1 str. 16M] gi|260151678|gb|EEW86772.1| septum formation initiator [Brucella melitensis bv. 1 str. 16M] gi|263001995|gb|EEZ14570.1| septum formation initiator [Brucella melitensis bv. 1 str. Rev.1] Length = 109 Score = 78.6 bits (192), Expect = 3e-13, Method: Compositional matrix adjust. Identities = 46/105 (43%), Positives = 65/105 (61%), Gaps = 4/105 (3%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLE--KSLIERERFLSEL 58 MWTK +K+ R I V+ + YF HA G+YGL A LE KSL+ + L+++ Sbjct: 1 MWTKQKRKSIRGRFILPVLTAAFLSYFGFHAYHGEYGLYARIQLEEQKSLLNAQ--LAKI 58 Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R LE+ V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 59 SADRIALEKGVALLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|114704543|ref|ZP_01437451.1| hypothetical protein FP2506_06401 [Fulvimarina pelagi HTCC2506] gi|114539328|gb|EAU42448.1| hypothetical protein FP2506_06401 [Fulvimarina pelagi HTCC2506] Length = 92 Score = 74.3 bits (181), Expect = 5e-12, Method: Compositional matrix adjust. Identities = 34/91 (37%), Positives = 57/91 (62%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 R I ++ + YF H GDYGL + LE+ L ++ L+ L+ R+ L ++V+ Sbjct: 1 MIRLIIPTLSAAVLAYFAIHVQTGDYGLSSKAELERRLNVKKAELASLERERTALAQRVE 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 L+S G+LE+D+LDE+AR++LN+ DEI++ Sbjct: 61 LLSSGTLERDMLDERARWALNVVAEDEIVIL 91 >gi|319405528|emb|CBI79147.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 113 Score = 71.2 bits (173), Expect = 4e-11, Method: Compositional matrix adjust. Identities = 35/104 (33%), Positives = 61/104 (58%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R I ++ + YF+ H G YGL + + + +IE + L ++K Sbjct: 1 MWTKQKQRSIKARFILPLVTVGVLSYFSYHIYHGKYGLYSRSKINQHIIELKEELHQIKT 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +E+++ L+ DG +EKD+LDE R +LN S+S+E+ + S Sbjct: 61 ERISIEKRISLLRDGHIEKDMLDEYVRKNLNFSKSNELTILISP 104 >gi|121602813|ref|YP_988848.1| septum formation initiator family protein [Bartonella bacilliformis KC583] gi|120614990|gb|ABM45591.1| septum formation initiator family protein [Bartonella bacilliformis KC583] Length = 109 Score = 70.5 bits (171), Expect = 7e-11, Method: Compositional matrix adjust. Identities = 37/107 (34%), Positives = 61/107 (57%), Gaps = 6/107 (5%) Query: 1 MWTKYYK---KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSE 57 MWTK + K HF I V+ V YF+ H G+YGL+A + + + E + L + Sbjct: 1 MWTKQKRRSIKTHF---ILPVMTVWVVSYFSYHIYHGEYGLRARGEINQHIFELKEELHQ 57 Query: 58 LKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ R+ +E ++ L+ +G +EKD+LDE R +LN SR +E+ + S Sbjct: 58 IEVERTSIENRISLLREGHIEKDMLDEYVRENLNFSRPNELTILVSP 104 >gi|288958363|ref|YP_003448704.1| septum formation initiator [Azospirillum sp. B510] gi|288910671|dbj|BAI72160.1| septum formation initiator [Azospirillum sp. B510] Length = 123 Score = 68.6 bits (166), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 32/93 (34%), Positives = 56/93 (60%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K+ +AI + C V YF +A+ GD GL A K ++ + + E L++L+ R +ER Sbjct: 16 KSALRQAIMPALCACVVAYFAYYAVHGDRGLVAMKQIQGQIAQAETVLNQLRTEREDMER 75 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +L+ L++D+L+E+AR LN S S ++I+ Sbjct: 76 RAQLLRGDGLDRDMLEERARLMLNFSSSRDVIV 108 >gi|319898762|ref|YP_004158855.1| hypothetical protein BARCL_0592 [Bartonella clarridgeiae 73] gi|319402726|emb|CBI76273.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 113 Score = 68.2 bits (165), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 34/104 (32%), Positives = 59/104 (56%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R I +I + YF+ H G YGL + + + +IE + ++K Sbjct: 1 MWTKQKQRSIKTRFILPLITTGVLSYFSYHIYHGKYGLYSRSKINQHIIELKEEFHQVKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +E+++ L+ DG +EKD+LDE R +LN S+ +E+ + S Sbjct: 61 ERISIEKRISLLRDGHIEKDMLDEYVRKNLNFSKPNELTILTSP 104 >gi|319408348|emb|CBI82001.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 112 Score = 67.0 bits (162), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 34/104 (32%), Positives = 58/104 (55%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R I + + YF H GDYGL A + + + E + L +++ Sbjct: 4 MWTKQKRRSITARFILPFMTVGVLSYFGYHIYHGDYGLSARSKIIQHITELKEELYKIEV 63 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +E+++ L+ DG +EKD+LDE R +LN S+ +E+ + S Sbjct: 64 ERMSIEKRISLLRDGHIEKDMLDEYVRKNLNFSKPNELTILISP 107 >gi|158423364|ref|YP_001524656.1| putative septum formation initiator [Azorhizobium caulinodans ORS 571] gi|158330253|dbj|BAF87738.1| putative septum formation initiator [Azorhizobium caulinodans ORS 571] Length = 107 Score = 66.6 bits (161), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 35/101 (34%), Positives = 56/101 (55%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ + FF + V+A + YF HA GD+GL A ++ E+ ++ E L+ LK Sbjct: 1 MQTRSRIRAFFFALLLYVVAGGVIGYFAYHAYNGDHGLMAKRNYEQDVVRLETELAALKS 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R LE KV L+ S++ DLLDE+ R L+ + +++L Sbjct: 61 QRQALEHKVSLLDPRSIDPDLLDEEGRKQLDFINAKDLVLI 101 >gi|304391613|ref|ZP_07373555.1| septum formation initiator [Ahrensia sp. R2A130] gi|303295842|gb|EFL90200.1| septum formation initiator [Ahrensia sp. R2A130] Length = 106 Score = 66.2 bits (160), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 33/98 (33%), Positives = 56/98 (57%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 +K R I + + YF HA G YG++A +++ + E+ L++ R +LE Sbjct: 6 RKRPLTRFIAPLATLMILGYFGFHAFNGQYGIRAKIAMDVQTAKLEKKLAQRTAVREKLE 65 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +V ++ DG+LEKD++DE R LN++R DEI+L + Sbjct: 66 ARVAMLRDGNLEKDMVDEYVRRQLNMAREDEIVLMNPE 103 >gi|83310757|ref|YP_421021.1| septum formation initiator [Magnetospirillum magneticum AMB-1] gi|82945598|dbj|BAE50462.1| Septum formation initiator [Magnetospirillum magneticum AMB-1] Length = 88 Score = 66.2 bits (160), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 30/84 (35%), Positives = 50/84 (59%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +I V YFT H + GD G+ A L+ ++E E LS + R+ +E +V+L+ L Sbjct: 1 MIGLGAVAYFTYHTVEGDRGVLAYFRLQAEILEAEMHLSRVASERTEMEHRVQLLRPDHL 60 Query: 78 EKDLLDEKARYSLNLSRSDEIILF 101 + D+L+E+AR LN+ R E+++F Sbjct: 61 DPDMLEERARIMLNMGRDGEVVVF 84 >gi|46201561|ref|ZP_00054821.2| COG2919: Septum formation initiator [Magnetospirillum magnetotacticum MS-1] Length = 88 Score = 64.7 bits (156), Expect = 4e-09, Method: Compositional matrix adjust. Identities = 29/84 (34%), Positives = 50/84 (59%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +I V YFT H + GD G+ A L+ +++ E LS + R+ +E +V+L+ L Sbjct: 1 MIGLGAVAYFTYHTVEGDRGVLAYFRLQAEILDAEMHLSRVASERTEMEHRVQLLRPDHL 60 Query: 78 EKDLLDEKARYSLNLSRSDEIILF 101 + D+L+E+AR LN+ R E+++F Sbjct: 61 DPDMLEERARIMLNMGREGEVVVF 84 >gi|209963465|ref|YP_002296380.1| septum formation initiator, putative [Rhodospirillum centenum SW] gi|209956931|gb|ACI97567.1| septum formation initiator, putative [Rhodospirillum centenum SW] Length = 120 Score = 64.3 bits (155), Expect = 5e-09, Method: Compositional matrix adjust. Identities = 32/96 (33%), Positives = 53/96 (55%), Gaps = 1/96 (1%) Query: 9 NHFFRAIF-LVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 N FR I V+ V YF H + GD GL A L+ + E R L+E++ R +LE Sbjct: 9 NRAFRQIIGPVLGASVVAYFAYHTVQGDRGLVALTHLQGEVEEASRVLAEVRHEREQLEH 68 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + +L+ +L+ D+L+E+AR LN + D++++ Sbjct: 69 RARLLRPDNLDPDMLEERARLLLNKTHPDDLVILLP 104 >gi|49474126|ref|YP_032168.1| hypothetical protein BQ04900 [Bartonella quintana str. Toulouse] gi|49239630|emb|CAF25989.1| hypothetical protein BQ04900 [Bartonella quintana str. Toulouse] Length = 109 Score = 63.9 bits (154), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 31/101 (30%), Positives = 59/101 (58%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK ++ R + ++ V YF+ H G YGL + + + ++E E+ L +++ Sbjct: 1 MWTKQKPRSIKVRFVLPLMTVGVVSYFSYHIYHGQYGLYSCNEVNQHIVELEKELHKVEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERMFIEKRIFLLRNGHIEKDMLDEYVRKNLNFSKPNELTIL 101 >gi|240850260|ref|YP_002971653.1| septum formation initiator protein [Bartonella grahamii as4aup] gi|240267383|gb|ACS50971.1| septum formation initiator protein [Bartonella grahamii as4aup] Length = 103 Score = 63.9 bits (154), Expect = 7e-09, Method: Compositional matrix adjust. Identities = 30/101 (29%), Positives = 60/101 (59%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R + ++ + YF+ H G+YGL + + + + E E+ L +++ Sbjct: 1 MWTKQKRRSIKVRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVNQHISELEKELHKIEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERIFMEKRISLLRNGHIEKDMLDEYVRKNLNFSKPNELTIL 101 >gi|163868057|ref|YP_001609261.1| hypothetical protein Btr_0860 [Bartonella tribocorum CIP 105476] gi|161017708|emb|CAK01266.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 103 Score = 63.9 bits (154), Expect = 8e-09, Method: Compositional matrix adjust. Identities = 30/101 (29%), Positives = 60/101 (59%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R + ++ + YF+ H G+YGL + + + + E E+ L +++ Sbjct: 1 MWTKQKRRSIKVRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVNQYISELEKELHKIEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERKFIEKRISLLRNGHIEKDMLDEYVRKNLNFSKPNELTIL 101 >gi|144898637|emb|CAM75501.1| Septum formation initiator [Magnetospirillum gryphiswaldense MSR-1] Length = 101 Score = 63.2 bits (152), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 32/94 (34%), Positives = 53/94 (56%), Gaps = 1/94 (1%) Query: 9 NHFFRAIF-LVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 N + R + +I + YF H + GD G+ A L+K ++ E L+ + R LE Sbjct: 6 NRYLRHVMGPLIGVGALAYFAYHTVEGDRGVLAWVRLDKEILAAEMQLANVSTERQALEH 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +V L+ L+ D+L+E+AR LN+ RSDE+++F Sbjct: 66 RVLLLRPDHLDPDMLEERARAMLNMGRSDEMVIF 99 >gi|118589908|ref|ZP_01547312.1| Septum formation initiator [Stappia aggregata IAM 12614] gi|118437405|gb|EAV44042.1| Septum formation initiator [Stappia aggregata IAM 12614] Length = 97 Score = 61.6 bits (148), Expect = 3e-08, Method: Compositional matrix adjust. Identities = 32/87 (36%), Positives = 48/87 (55%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I IA + YF HA+ G+ G+ +E+ + E E L+ L R L KV L+ Sbjct: 2 ITPAIAIAALGYFGFHAMSGELGMVGRAMIERQVSELESELAVLTAQRQELVAKVSLLRP 61 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILF 101 SL+ D+LDE+AR +LNL DE+++ Sbjct: 62 ESLDPDMLDERARLNLNLVHPDELVVL 88 >gi|319407098|emb|CBI80735.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 93 Score = 59.3 bits (142), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/78 (35%), Positives = 48/78 (61%) Query: 26 YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEK 85 YF+ H G YGL + + + +IE + L ++K R +E+++ L+ DG +EKD+LDE Sbjct: 6 YFSYHIYHGKYGLYSRSKINQHIIELKEELHQVKAERISIEKRISLLRDGHIEKDMLDEH 65 Query: 86 ARYSLNLSRSDEIILFYS 103 R +LN S+ +E+ + S Sbjct: 66 VRKNLNFSKPNELTILIS 83 >gi|319404086|emb|CBI77674.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 93 Score = 58.9 bits (141), Expect = 2e-07, Method: Compositional matrix adjust. Identities = 28/78 (35%), Positives = 48/78 (61%) Query: 26 YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEK 85 YF+ H G YGL + + + +IE + L ++K R +E+++ L+ DG +EKD+LDE Sbjct: 6 YFSYHIYHGKYGLYSRSKINQHIIELQEELHQVKAERISIEKRISLLRDGHIEKDMLDEY 65 Query: 86 ARYSLNLSRSDEIILFYS 103 R +LN S+ +E+ + S Sbjct: 66 VRKNLNFSKPNELTILIS 83 >gi|146277142|ref|YP_001167301.1| septum formation initiator [Rhodobacter sphaeroides ATCC 17025] gi|145555383|gb|ABP69996.1| Septum formation initiator [Rhodobacter sphaeroides ATCC 17025] Length = 100 Score = 57.4 bits (137), Expect = 6e-07, Method: Compositional matrix adjust. Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 8/91 (8%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGL----KANKSLEKSLIERERFLSELKENRSRLERKV 69 +++ +AF YFT A+ GDYG+ + E ER++ +EL E R++ R Sbjct: 13 SLYFALAFSLSAYFTFAAVQGDYGVFRQVQIKAEAEALRAERDQIAAELDEMRNKTRR-- 70 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+AR +L R+DEI++ Sbjct: 71 --LSDSYLDVDLLDEQARATLGYVRADEIVI 99 >gi|49475367|ref|YP_033408.1| hypothetical protein BH05740 [Bartonella henselae str. Houston-1] gi|49238173|emb|CAF27382.1| hypothetical protein BH05740 [Bartonella henselae str. Houston-1] Length = 109 Score = 57.4 bits (137), Expect = 7e-07, Method: Compositional matrix adjust. Identities = 31/101 (30%), Positives = 60/101 (59%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R + ++ + YF+ H G+YGL + + + ++E E L +L+ Sbjct: 1 MWTKQKRRSIKMRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVNQYIVELEEELQKLEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERIFIEKRISLLRNGHIEKDMLDEYVRRNLNFSKPNELTIL 101 >gi|154253582|ref|YP_001414406.1| septum formation initiator [Parvibaculum lavamentivorans DS-1] gi|154157532|gb|ABS64749.1| Septum formation initiator [Parvibaculum lavamentivorans DS-1] Length = 117 Score = 57.0 bits (136), Expect = 8e-07, Method: Compositional matrix adjust. Identities = 28/87 (32%), Positives = 52/87 (59%), Gaps = 3/87 (3%) Query: 18 VIAFCCVV---YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +I F C++ YF HA+ G +G + ++ + E L+E++ R +L+R+V L+ Sbjct: 19 LIPFVCIIVLGYFAYHAVYGRHGFISWLDIQNRIDTLEHQLTEVETKRMQLDRQVALLRP 78 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILF 101 SL+ DLLDE+AR +L ++++ +F Sbjct: 79 ESLDPDLLDERARAALGYGGANDVTIF 105 >gi|27379897|ref|NP_771426.1| hypothetical protein bll4786 [Bradyrhizobium japonicum USDA 110] gi|27353050|dbj|BAC50051.1| bll4786 [Bradyrhizobium japonicum USDA 110] Length = 105 Score = 57.0 bits (136), Expect = 9e-07, Method: Compositional matrix adjust. Identities = 27/74 (36%), Positives = 45/74 (60%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +A V YF +A G YGL A + L++ +I L++LK R+R E++V L+ + Sbjct: 18 AMAAAIVGYFGVNAYTGKYGLNARQELDQEIIALTSELAQLKRERARSEQRVSLLRSARI 77 Query: 78 EKDLLDEKARYSLN 91 + D+LDE+AR+ L+ Sbjct: 78 DPDMLDERARFQLD 91 >gi|328543940|ref|YP_004304049.1| Septum formation initiator [polymorphum gilvum SL003B-26A1] gi|326413684|gb|ADZ70747.1| Septum formation initiator [Polymorphum gilvum SL003B-26A1] Length = 111 Score = 57.0 bits (136), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 31/103 (30%), Positives = 54/103 (52%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T+ KK+ R + A + YF HA+ G++GL +E + + E L+ + R Sbjct: 5 TRQRKKSVLRRLVIPFAALAVLGYFGFHALNGEFGLVGRARIEHQVRDLEAELAVVVTER 64 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 L +V L+ SL+ D++DE+AR +LNL +DE+ + + Sbjct: 65 EELFARVSLLRPESLDPDMIDERARLNLNLVHADEVAILRPGY 107 >gi|312114100|ref|YP_004011696.1| septum formation initiator [Rhodomicrobium vannielii ATCC 17100] gi|311219229|gb|ADP70597.1| Septum formation initiator [Rhodomicrobium vannielii ATCC 17100] Length = 108 Score = 56.6 bits (135), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 32/90 (35%), Positives = 48/90 (53%), Gaps = 1/90 (1%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD- 74 L I Y A+ G +GL AN+ L + + R L+ LK R+RLER L+ Sbjct: 15 LLAIFLSLTAYVAADAVRGPHGLIANELLRAKIADLNRDLTALKRERARLERDADLLGPK 74 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 S DLLDE+AR L+L+R +I++ ++ Sbjct: 75 ASTHSDLLDEQARALLDLARPADIVIVNAE 104 >gi|154247810|ref|YP_001418768.1| septum formation initiator [Xanthobacter autotrophicus Py2] gi|154161895|gb|ABS69111.1| Septum formation initiator [Xanthobacter autotrophicus Py2] Length = 104 Score = 56.2 bits (134), Expect = 1e-06, Method: Compositional matrix adjust. Identities = 30/80 (37%), Positives = 46/80 (57%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 + YF HA GD+GL A ++ E+ + E L+ LK R +E KV L++ L+ D+LD Sbjct: 24 IGYFAYHAYNGDHGLVAKRNYEQEMKALEAELAGLKAQRRAMENKVSLLAPTQLDPDMLD 83 Query: 84 EKARYSLNLSRSDEIILFYS 103 E+AR LN +++L S Sbjct: 84 EEARRQLNFINGKDLVLLRS 103 >gi|90423988|ref|YP_532358.1| septum formation initiator [Rhodopseudomonas palustris BisB18] gi|90106002|gb|ABD88039.1| Septum formation initiator [Rhodopseudomonas palustris BisB18] Length = 105 Score = 55.8 bits (133), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 27/82 (32%), Positives = 46/82 (56%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 IA V YF +A G YGL A + L++ +I L LK+ R+ E++V L+ + Sbjct: 18 AIAAAMVGYFGTNAYTGKYGLNARQELDQEIIALTSELQRLKQERAAGEQRVSLLRSDRV 77 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+ RY L+ + +++ Sbjct: 78 DPDMLDERVRYQLDYAHPADLV 99 >gi|115524618|ref|YP_781529.1| septum formation initiator [Rhodopseudomonas palustris BisA53] gi|115518565|gb|ABJ06549.1| Septum formation initiator [Rhodopseudomonas palustris BisA53] Length = 105 Score = 55.5 bits (132), Expect = 2e-06, Method: Compositional matrix adjust. Identities = 25/82 (30%), Positives = 48/82 (58%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +IA + YF ++A G YGL A + L++ +I L LK R+ E++V L+ L Sbjct: 18 MIAAAVIGYFGSNAYTGKYGLHAQQELDQEIIALTSELQRLKHERAEGEKRVSLLRSDRL 77 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LD++ R+ L+ + ++++ Sbjct: 78 DPDMLDQRVRFQLDYAHPNDLV 99 >gi|75676011|ref|YP_318432.1| septum formation initiator [Nitrobacter winogradskyi Nb-255] gi|74420881|gb|ABA05080.1| septum formation initiator [Nitrobacter winogradskyi Nb-255] Length = 105 Score = 55.5 bits (132), Expect = 3e-06, Method: Compositional matrix adjust. Identities = 28/82 (34%), Positives = 46/82 (56%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +A V YF +A G YGL A + L++ +I L+ LK R+ E++V L+ + Sbjct: 18 AMAAMIVGYFGVNAYTGKYGLNARQDLDQEIIALTSELARLKAERAEGEKRVALLRASGI 77 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+ RY L+ + E+I Sbjct: 78 DPDMLDERVRYQLHYANPHELI 99 >gi|39935933|ref|NP_948209.1| septum formation initiator [Rhodopseudomonas palustris CGA009] gi|192291583|ref|YP_001992188.1| Septum formation initiator [Rhodopseudomonas palustris TIE-1] gi|39649787|emb|CAE28309.1| Septum formation initiator [Rhodopseudomonas palustris CGA009] gi|192285332|gb|ACF01713.1| Septum formation initiator [Rhodopseudomonas palustris TIE-1] Length = 105 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 27/99 (27%), Positives = 51/99 (51%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ K+ IA + YF +A G YGL A + L++ + L +L++ Sbjct: 1 MVTRSRLKSILAGIALYAIAAAVIGYFGVNAYTGRYGLTAQQELDQEITALTAELVQLRQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R+ E++V L+ ++ D+LDE+ RY L+ + +++ Sbjct: 61 QRAEAEQRVSLLRSDRIDPDMLDERVRYQLDFANPADLV 99 >gi|316933972|ref|YP_004108954.1| Septum formation initiator [Rhodopseudomonas palustris DX-1] gi|315601686|gb|ADU44221.1| Septum formation initiator [Rhodopseudomonas palustris DX-1] Length = 105 Score = 54.3 bits (129), Expect = 5e-06, Method: Compositional matrix adjust. Identities = 27/99 (27%), Positives = 51/99 (51%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ K+ IA + YF +A G YGL A + L++ + L +L++ Sbjct: 1 MVTRSRLKSILAGIALYAIAAAVIGYFGVNAYTGRYGLTAQQELDQEITALTAELVQLRQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R+ E++V L+ ++ D+LDE+ RY L+ + +++ Sbjct: 61 QRAEAEQRVSLLRSDRIDPDMLDERVRYQLDFANPADLV 99 >gi|148255822|ref|YP_001240407.1| septum formation initiator domain-containing protein [Bradyrhizobium sp. BTAi1] gi|146407995|gb|ABQ36501.1| putative exported protein of unknown function with septum formation initiator domain [Bradyrhizobium sp. BTAi1] Length = 104 Score = 54.3 bits (129), Expect = 6e-06, Method: Compositional matrix adjust. Identities = 27/82 (32%), Positives = 46/82 (56%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +A + YF +A G YGL A + L++ +I L LK+ R+ ER+V L+ + Sbjct: 18 TMAAAIIGYFGINAYTGRYGLTARQELDQEIISLTSELVRLKQERAEGERRVSLLRSDRV 77 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+AR+ L + ++I Sbjct: 78 DPDMLDERARFQLGYANPHDLI 99 >gi|85716523|ref|ZP_01047494.1| septum formation initiator [Nitrobacter sp. Nb-311A] gi|85696712|gb|EAQ34599.1| septum formation initiator [Nitrobacter sp. Nb-311A] Length = 125 Score = 53.9 bits (128), Expect = 7e-06, Method: Compositional matrix adjust. Identities = 27/82 (32%), Positives = 45/82 (54%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +A V YF +A G YGL A + L++ +I L+ LK R+ E++V L+ + Sbjct: 38 TMAAMIVGYFGVNAYTGKYGLNARQELDQEIIALTSELARLKAERAEGEKRVALLRSSGI 97 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+ RY L + ++I Sbjct: 98 DPDMLDERVRYQLGYANPRDLI 119 >gi|149201830|ref|ZP_01878804.1| Septum formation initiator [Roseovarius sp. TM1035] gi|149144878|gb|EDM32907.1| Septum formation initiator [Roseovarius sp. TM1035] Length = 115 Score = 53.5 bits (127), Expect = 8e-06, Method: Compositional matrix adjust. Identities = 36/86 (41%), Positives = 51/86 (59%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF +IAF YFT A+ GDYGL ++ +E + L L +R+E + +SD Sbjct: 29 IFFLIAFFLGAYFTFAAVQGDYGLFRRAEIDAQSVELQAQLDALNVRVARMENLTRRLSD 88 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 G L+ DLLD++AR L L RSDEI++ Sbjct: 89 GYLDLDLLDQQAREVLGLLRSDEIVI 114 >gi|307942229|ref|ZP_07657580.1| septum formation initiator [Roseibium sp. TrichSKD4] gi|307774515|gb|EFO33725.1| septum formation initiator [Roseibium sp. TrichSKD4] Length = 114 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 30/100 (30%), Positives = 51/100 (51%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKEN 61 T+ K++ + +A + YF HA+ G+ GL +E+ + + L +L E Sbjct: 4 QTRQRKQSFLRHLVVPTLALSALAYFGFHALNGELGLVGRAKIERDVERLQAELDKLVEE 63 Query: 62 RSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R L +V L+ SL+ D+LDE AR +LNL ++I+ Sbjct: 64 RQYLVSRVSLLRPESLDPDMLDESARRNLNLVHPKDLIIL 103 >gi|162147710|ref|YP_001602171.1| septum formation initiator protein [Gluconacetobacter diazotrophicus PAl 5] gi|209542334|ref|YP_002274563.1| Septum formation initiator [Gluconacetobacter diazotrophicus PAl 5] gi|161786287|emb|CAP55869.1| putative septum formation initiator protein [Gluconacetobacter diazotrophicus PAl 5] gi|209530011|gb|ACI49948.1| Septum formation initiator [Gluconacetobacter diazotrophicus PAl 5] Length = 109 Score = 53.5 bits (127), Expect = 9e-06, Method: Compositional matrix adjust. Identities = 31/95 (32%), Positives = 51/95 (53%), Gaps = 4/95 (4%) Query: 13 RAIFLVIA----FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 RAI +VI YF + + GD+GL++ K+ + L E + + R+ Sbjct: 9 RAIRMVIPPALFIGLTAYFGWNVMQGDHGLQSYKAQLQLLAEARAAQQDAMAEQQVWVRR 68 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 V+ + + +L+ D LDE+AR LNLSR DE+++ Y Sbjct: 69 VRGLKESALDSDTLDERARAMLNLSRPDELVVPYG 103 >gi|92117294|ref|YP_577023.1| septum formation initiator [Nitrobacter hamburgensis X14] gi|91800188|gb|ABE62563.1| Septum formation initiator [Nitrobacter hamburgensis X14] Length = 105 Score = 53.1 bits (126), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 25/81 (30%), Positives = 46/81 (56%) Query: 19 IAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE 78 +A V YF +A G YGL A + L++ ++ L+ LK R+ E++V L+ ++ Sbjct: 19 MAAMVVGYFGVNAYTGKYGLNARQELDQEIVALTSELARLKAERAEGEKRVALLRSSGID 78 Query: 79 KDLLDEKARYSLNLSRSDEII 99 D+LDE+ RY L+ + +++ Sbjct: 79 PDMLDERVRYQLDYANPRDLV 99 >gi|83593217|ref|YP_426969.1| septum formation initiator [Rhodospirillum rubrum ATCC 11170] gi|83576131|gb|ABC22682.1| Septum formation initiator [Rhodospirillum rubrum ATCC 11170] Length = 107 Score = 52.8 bits (125), Expect = 1e-05, Method: Compositional matrix adjust. Identities = 29/83 (34%), Positives = 45/83 (54%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 ++A + YF H I GD G+ + L K + E L + + L+ V +S S+ Sbjct: 16 LLALLVIAYFGYHGIQGDRGVLSLARLTKEIEEARHLLDLRRAEEAALQASVTRLSPESV 75 Query: 78 EKDLLDEKARYSLNLSRSDEIIL 100 ++DLLDE+AR LN R DE+I+ Sbjct: 76 DRDLLDERARIMLNRIRPDEVII 98 >gi|209885411|ref|YP_002289268.1| septum formation initiator [Oligotropha carboxidovorans OM5] gi|209873607|gb|ACI93403.1| septum formation initiator [Oligotropha carboxidovorans OM5] Length = 111 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 27/82 (32%), Positives = 45/82 (54%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 IA + YF +A G YG+ A LEK L+ LK +R+ E++V L+ + Sbjct: 25 AIAAGFITYFGVNAYTGRYGINARIELEKEAATLSAELARLKADRAEEEKRVALLRSDKV 84 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+ARY L+ + +++ Sbjct: 85 DPDMLDERARYQLDYAHPRDLV 106 >gi|254469492|ref|ZP_05082897.1| septum formation initiator [Pseudovibrio sp. JE062] gi|211961327|gb|EEA96522.1| septum formation initiator [Pseudovibrio sp. JE062] Length = 88 Score = 52.4 bits (124), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 31/83 (37%), Positives = 49/83 (59%) Query: 19 IAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE 78 IA + YF HA+ G GL +E ++ E L EL+ R +L+R+V L+ SL+ Sbjct: 4 IAIGALCYFAFHALNGKLGLVGRPQIEHEILALEVELEELRAERLQLQRRVMLLDPESLD 63 Query: 79 KDLLDEKARYSLNLSRSDEIILF 101 D++DE+AR SLNL+ +E+ + Sbjct: 64 PDMVDERARASLNLAHVNEVAIM 86 >gi|146341017|ref|YP_001206065.1| hypothetical protein BRADO4088 [Bradyrhizobium sp. ORS278] gi|146193823|emb|CAL77840.1| conserved hypothetical protein; putative signal peptide; putative Septum formation initiator domain [Bradyrhizobium sp. ORS278] Length = 104 Score = 52.0 bits (123), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 25/82 (30%), Positives = 46/82 (56%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +A + YF +A G YGL A + L++ ++ L LK+ R+ E++V L+ + Sbjct: 18 TMAAAIIGYFGINAYTGRYGLNARQELDQEIVALTSELVRLKQERAEGEKRVSLLRSDRV 77 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+AR+ L + ++I Sbjct: 78 DPDMLDERARFQLGYANPHDLI 99 >gi|294083774|ref|YP_003550531.1| hypothetical protein SAR116_0204 [Candidatus Puniceispirillum marinum IMCC1322] gi|292663346|gb|ADE38447.1| hypothetical protein SAR116_0204 [Candidatus Puniceispirillum marinum IMCC1322] Length = 106 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 28/94 (29%), Positives = 54/94 (57%), Gaps = 1/94 (1%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 KK+ F L++A +F H I G+ G+ A LE+ ++ E L+ L++++S L Sbjct: 5 KKSLAFIGSLLLLA-TMASFFMFHTIAGERGILAQPELERKILIAEEQLALLEKHQSHLH 63 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +++ LM + +++ D+L E AR L L +++I+ Sbjct: 64 QRISLMQNDAIDADMLAETARAELGLYTPNDVIV 97 >gi|163793247|ref|ZP_02187223.1| Septum formation initiator [alpha proteobacterium BAL199] gi|159181893|gb|EDP66405.1| Septum formation initiator [alpha proteobacterium BAL199] Length = 123 Score = 51.2 bits (121), Expect = 5e-05, Method: Compositional matrix adjust. Identities = 26/86 (30%), Positives = 45/86 (52%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + +I V YF HA+ GD G++A + L+ + E L ++ E++V ++ Sbjct: 15 VGPLIGSLLVAYFAYHAVEGDRGIRAWQRLDGEVAEARAVRDRLSGEQAAFEKRVSMLRP 74 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLL+E+AR L SD +I+ Sbjct: 75 DGLDPDLLEERARLVLGFVPSDGLIM 100 >gi|332185266|ref|ZP_08387015.1| septum formation initiator family protein [Sphingomonas sp. S17] gi|332014990|gb|EGI57046.1| septum formation initiator family protein [Sphingomonas sp. S17] Length = 96 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 26/88 (29%), Positives = 46/88 (52%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 RA + V +F +A++G GL A ++ L++RE L + R+ L+ +V L+ Sbjct: 6 RAALPALGLTIVAFFGAYAVLGRNGLLAYGEYQRQLVKREHDYVLLDKRRTILKNRVALL 65 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 D++DE R LN++ DE+I+ Sbjct: 66 DPDHANPDMVDEMVRKELNVAHPDEVIV 93 >gi|148284143|ref|YP_001248233.1| hypothetical protein OTBS_0266 [Orientia tsutsugamushi str. Boryong] gi|189184296|ref|YP_001938081.1| hypothetical protein OTT_1389 [Orientia tsutsugamushi str. Ikeda] gi|146739582|emb|CAM79332.1| conserved hypothetical protein [Orientia tsutsugamushi str. Boryong] gi|189181067|dbj|BAG40847.1| hypothetical protein OTT_1389 [Orientia tsutsugamushi str. Ikeda] Length = 99 Score = 50.8 bits (120), Expect = 6e-05, Method: Compositional matrix adjust. Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 8/91 (8%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKA----NKSLEKSLIERERFLSELKENRSRLERK 68 R +F V+ ++YF HA+ G+ GL + N ++++SL + L +LK R LE++ Sbjct: 3 RILFSVVLIGLLIYFAFHAVYGNRGLISYIEFNNNVDQSL----KKLYKLKAERLELEQR 58 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 V L+ SL+ D+LDE+ R L L+ S+E I Sbjct: 59 VNLLRLQSLDLDMLDEQVRKKLGLAHSNEKI 89 >gi|299134959|ref|ZP_07028150.1| Septum formation initiator [Afipia sp. 1NLS2] gi|298589936|gb|EFI50140.1| Septum formation initiator [Afipia sp. 1NLS2] Length = 104 Score = 50.1 bits (118), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 28/82 (34%), Positives = 42/82 (51%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 IA + YF +A G YGL A LEK L+ LK R+ E+ V L+ + Sbjct: 18 AIAAGFITYFGVNAYTGRYGLNARVELEKEAATLTTELARLKAQRADEEKHVALLRSDRV 77 Query: 78 EKDLLDEKARYSLNLSRSDEII 99 + D+LDE+ARY L + +++ Sbjct: 78 DPDMLDEEARYQLGYANPRDLV 99 >gi|330994776|ref|ZP_08318698.1| septum formation initiator [Gluconacetobacter sp. SXCC-1] gi|329758037|gb|EGG74559.1| septum formation initiator [Gluconacetobacter sp. SXCC-1] Length = 100 Score = 49.7 bits (117), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 28/90 (31%), Positives = 47/90 (52%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I + YF +A+ G++GL + + L E + + R+V+ + + Sbjct: 6 IPPALFIGLTAYFGWNAMRGEHGLHSYATQLHLLDEARSAQKDATAEQEVWLRRVRGLKE 65 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 G+L+ DLLDE+AR NL+R DEI++ Y D Sbjct: 66 GALDTDLLDERARSMQNLARQDEIVVPYGD 95 >gi|197105208|ref|YP_002130585.1| septum formation initiator [Phenylobacterium zucineum HLK1] gi|196478628|gb|ACG78156.1| septum formation initiator [Phenylobacterium zucineum HLK1] Length = 98 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 25/70 (35%), Positives = 42/70 (60%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 + YF HA G+ GL + ++L+ ++R LS+++ R LE + +L+ D SL DLL+ Sbjct: 18 IFYFAFHAFTGEGGLLRSNQRGETLLAKQRELSQVRAKREDLEARAQLLRDQSLSADLLE 77 Query: 84 EKARYSLNLS 93 E+AR L + Sbjct: 78 ERARSLLGFA 87 >gi|15604288|ref|NP_220804.1| hypothetical protein RP423 [Rickettsia prowazekii str. Madrid E] gi|6647962|sp|Q9ZDA9|Y423_RICPR RecName: Full=Uncharacterized protein RP423 gi|3860980|emb|CAA14880.1| unknown [Rickettsia prowazekii] gi|292572037|gb|ADE29952.1| Septum formation initiator [Rickettsia prowazekii Rp22] Length = 107 Score = 48.9 bits (115), Expect = 2e-04, Method: Compositional matrix adjust. Identities = 35/95 (36%), Positives = 50/95 (52%), Gaps = 11/95 (11%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSRLERKVK 70 IFL + +VYF H I G+ G LK N+ LEK+ E L L+ R LE VK Sbjct: 16 IFLAL---LLVYFIFHCIYGNKGIIAYLKVNRQLEKAYDE----LKNLRAERVELEHNVK 68 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 L+ SL KD+L+E+A+ L ++ +E + D Sbjct: 69 LLRTESLNKDMLEEQAKKILGIAAPNEQVFTIKDI 103 >gi|15892511|ref|NP_360225.1| hypothetical protein RC0588 [Rickettsia conorii str. Malish 7] gi|34580496|ref|ZP_00141976.1| hypothetical protein [Rickettsia sibirica 246] gi|229586701|ref|YP_002845202.1| Septum formation initiator [Rickettsia africae ESF-5] gi|15619671|gb|AAL03126.1| unknown [Rickettsia conorii str. Malish 7] gi|28261881|gb|EAA25385.1| unknown [Rickettsia sibirica 246] gi|228021751|gb|ACP53459.1| Septum formation initiator [Rickettsia africae ESF-5] Length = 101 Score = 48.9 bits (115), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 33/93 (35%), Positives = 49/93 (52%), Gaps = 8/93 (8%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSR 64 NH + I ++ + YF H I G+ G LK N+ LEK+ E L L+ R Sbjct: 7 NHAKKIILNIVLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LKGLRAERVE 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE VKL+ SL KD+L+E+A+ L ++ +E Sbjct: 63 LEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNE 95 >gi|254512341|ref|ZP_05124408.1| septum formation initiator [Rhodobacteraceae bacterium KLH11] gi|221536052|gb|EEE39040.1| septum formation initiator [Rhodobacteraceae bacterium KLH11] Length = 91 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 35/88 (39%), Positives = 54/88 (61%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 IF +AF VYFT A+ GDYGL + + E+ + ++ L++LK+ R+E + Sbjct: 5 IFFSVAFMLGVYFTFAAVQGDYGLFRRVEIAAERDALSQD--LNQLKDEIVRMENLTHRL 62 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLD++AR L + RSDEI++ Sbjct: 63 SDTYLDLDLLDQQARSVLGMIRSDEIVI 90 >gi|298291780|ref|YP_003693719.1| septum formation initiator [Starkeya novella DSM 506] gi|296928291|gb|ADH89100.1| Septum formation initiator [Starkeya novella DSM 506] Length = 113 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 27/82 (32%), Positives = 42/82 (51%) Query: 20 AFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEK 79 A + YF G YGL A +S E+ + L+ R L+ KV+L+S ++ Sbjct: 20 AAALIGYFAFQGYNGQYGLLARRSFEQQHANLTQERDRLRSQREALQAKVRLLSPERVDA 79 Query: 80 DLLDEKARYSLNLSRSDEIILF 101 D+LDE+AR LNL +++L Sbjct: 80 DMLDEQARSLLNLVNPKDLVLL 101 >gi|16125969|ref|NP_420533.1| hypothetical protein CC_1725 [Caulobacter crescentus CB15] gi|221234734|ref|YP_002517170.1| septum formation initiator [Caulobacter crescentus NA1000] gi|13423141|gb|AAK23701.1| conserved hypothetical protein [Caulobacter crescentus CB15] gi|220963906|gb|ACL95262.1| septum formation initiator [Caulobacter crescentus NA1000] Length = 100 Score = 48.5 bits (114), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 38/71 (53%) Query: 21 FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 F + YF HA+ GD GL + L + R L +++ R LE + +L+ GSL D Sbjct: 15 FFLIFYFAFHALTGDRGLLSISQRNADLAAKTRELRKIRAERMDLEARARLLRSGSLSAD 74 Query: 81 LLDEKARYSLN 91 LL+E+AR L Sbjct: 75 LLEERARSLLG 85 >gi|296445307|ref|ZP_06887266.1| Septum formation initiator [Methylosinus trichosporium OB3b] gi|296257262|gb|EFH04330.1| Septum formation initiator [Methylosinus trichosporium OB3b] Length = 111 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 24/80 (30%), Positives = 41/80 (51%) Query: 26 YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEK 85 YF H + G GLKA + + L ER + L R + ER++ L+ ++ D+LDE+ Sbjct: 25 YFVWHGVNGQRGLKAGEEYAERLAALEREHAGLVAERKQWERRIALLRGDVIDADMLDEQ 84 Query: 86 ARYSLNLSRSDEIILFYSDF 105 AR +L +E+++ Sbjct: 85 ARVTLGRIHRNEVVILAPQL 104 >gi|157964506|ref|YP_001499330.1| septum formation initiator [Rickettsia massiliae MTU5] gi|157844282|gb|ABV84783.1| Septum formation initiator [Rickettsia massiliae MTU5] Length = 103 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 34/101 (33%), Positives = 51/101 (50%), Gaps = 8/101 (7%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLS 56 M+ + NH + I + + YF H I G+ G LK N+ LEK+ E L Sbjct: 1 MYMIIHLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LK 56 Query: 57 ELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 L+ R LE VKL+ SL KD+L+E+A+ L ++ +E Sbjct: 57 GLRAARVELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNE 97 >gi|157825708|ref|YP_001493428.1| hypothetical protein A1C_03170 [Rickettsia akari str. Hartford] gi|157799666|gb|ABV74920.1| hypothetical protein A1C_03170 [Rickettsia akari str. Hartford] Length = 107 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSR 64 NH + I + + YF H I G+ G LK N+ LEK+ E L L+ R Sbjct: 7 NHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LKGLRAERVE 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 LE VKL+ SL KD+L+E+A+ L ++ +E + D Sbjct: 63 LEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFTIKD 102 >gi|315499907|ref|YP_004088710.1| septum formation initiator [Asticcacaulis excentricus CB 48] gi|315417919|gb|ADU14559.1| Septum formation initiator [Asticcacaulis excentricus CB 48] Length = 104 Score = 48.1 bits (113), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 29/87 (33%), Positives = 49/87 (56%), Gaps = 7/87 (8%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 AIFL +C V Y T GD G + ++ + L E+++ LS+L R LE + + + Sbjct: 15 AIFLT--YCGVQYLT-----GDKGFFSQETRQVELAEKQKLLSDLAAERQDLEARARYLR 67 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIIL 100 +L K+LL+E+AR L L+ +E ++ Sbjct: 68 TDNLSKELLEERARVLLGLNAPNEYVI 94 >gi|239947290|ref|ZP_04699043.1| septum formation initiator [Rickettsia endosymbiont of Ixodes scapularis] gi|239921566|gb|EER21590.1| septum formation initiator [Rickettsia endosymbiont of Ixodes scapularis] Length = 107 Score = 48.1 bits (113), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 50/100 (50%), Gaps = 8/100 (8%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSR 64 NH + I + + YF H I G+ G LK N+ LEK+ E L L+ R Sbjct: 7 NHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LKGLRAERVE 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 LE VKL+ SL KD+L+E+A+ L ++ +E + D Sbjct: 63 LEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFTIKD 102 >gi|86749889|ref|YP_486385.1| septum formation initiator [Rhodopseudomonas palustris HaA2] gi|86572917|gb|ABD07474.1| Septum formation initiator [Rhodopseudomonas palustris HaA2] Length = 105 Score = 47.8 bits (112), Expect = 5e-04, Method: Compositional matrix adjust. Identities = 24/77 (31%), Positives = 42/77 (54%) Query: 27 FTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKA 86 F +A G YGL A + L++ +I L LK R+ E++V L+ L+ D+LDE+ Sbjct: 27 FGINAYTGRYGLTAQQELDQEIIALTSELVRLKHERAEGEKRVALLRSDRLDPDMLDERV 86 Query: 87 RYSLNLSRSDEIILFYS 103 RY L+ + +++ + Sbjct: 87 RYQLDFANPADLVRMHP 103 >gi|91205562|ref|YP_537917.1| septum formation initiator [Rickettsia bellii RML369-C] gi|157827278|ref|YP_001496342.1| septum formation initiator [Rickettsia bellii OSU 85-389] gi|91069106|gb|ABE04828.1| Septum formation initiator [Rickettsia bellii RML369-C] gi|157802582|gb|ABV79305.1| Septum formation initiator [Rickettsia bellii OSU 85-389] Length = 108 Score = 47.8 bits (112), Expect = 6e-04, Method: Compositional matrix adjust. Identities = 32/76 (42%), Positives = 42/76 (55%), Gaps = 8/76 (10%) Query: 26 YFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDL 81 YF H I G+ G LK N+ LEK+ E L L+ R LE VKL+ SL+KD+ Sbjct: 28 YFVFHCIYGNKGVIAYLKVNRQLEKAYDE----LKLLQAERVELEHNVKLLRTESLDKDM 83 Query: 82 LDEKARYSLNLSRSDE 97 LDE+AR L ++ E Sbjct: 84 LDEQARKVLGIAAPSE 99 >gi|85706347|ref|ZP_01037441.1| hypothetical protein ROS217_15670 [Roseovarius sp. 217] gi|85669120|gb|EAQ23987.1| hypothetical protein ROS217_15670 [Roseovarius sp. 217] Length = 98 Score = 47.4 bits (111), Expect = 7e-04, Method: Compositional matrix adjust. Identities = 36/86 (41%), Positives = 50/86 (58%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF VIAF YFT A+ GDYGL ++ +E + L L +R+E + +SD Sbjct: 12 IFFVIAFFLGAYFTFAAVQGDYGLFRRAEIDAQSVELQAQLDALDARVARMENLTRRLSD 71 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLD++AR L L RSDEI++ Sbjct: 72 SYLDLDLLDQQAREVLGLLRSDEIVI 97 >gi|89069558|ref|ZP_01156902.1| hypothetical protein OG2516_03243 [Oceanicola granulosus HTCC2516] gi|89044893|gb|EAR50983.1| hypothetical protein OG2516_03243 [Oceanicola granulosus HTCC2516] Length = 99 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 28/86 (32%), Positives = 46/86 (53%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 ++ V A YF A+ GDYG+ ++ E L+ L+ + +E + +SD Sbjct: 13 LYFVGALLLSFYFVFAAVQGDYGVFRRAEVDAEARELRAELALLQAEVAEMENLARRLSD 72 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DL+DE+AR L L R+DEI++ Sbjct: 73 AYLDLDLVDERARDVLGLIRADEIVV 98 >gi|329113362|ref|ZP_08242143.1| Hypothetical protein APO_0127 [Acetobacter pomorum DM001] gi|326697187|gb|EGE48847.1| Hypothetical protein APO_0127 [Acetobacter pomorum DM001] Length = 109 Score = 47.0 bits (110), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 28/95 (29%), Positives = 55/95 (57%), Gaps = 9/95 (9%) Query: 13 RAIFLVIAFCCVV-YFTNHAIVGDYGLKANKS----LEKSLIERERFLSELKENRSRLER 67 RA+ + F + YF +A GD+G++A K LE++ ++ ++E ++ R Sbjct: 12 RAVVPPLVFLGIAGYFGWNATQGDHGIQAYKQQLGLLEQAKQSKQDAIAE----QAAWHR 67 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 +V + + SL+ D+LDE+AR LN++ ++I++ Y Sbjct: 68 RVNGLREQSLDTDILDERARAMLNMADRNDIVVPY 102 >gi|295689364|ref|YP_003593057.1| septum formation initiator [Caulobacter segnis ATCC 21756] gi|295431267|gb|ADG10439.1| Septum formation initiator [Caulobacter segnis ATCC 21756] Length = 100 Score = 47.0 bits (110), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 27/74 (36%), Positives = 40/74 (54%), Gaps = 2/74 (2%) Query: 16 FLVIA--FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 FL A F + YF HA+ GD GL + L + + L +++ R LE + +L+ Sbjct: 8 FLPTAAIFFLIFYFAFHALTGDRGLLSISQRNADLAAKTKELRKIRAERMDLEARARLLR 67 Query: 74 DGSLEKDLLDEKAR 87 GSL DLL+E+AR Sbjct: 68 SGSLSADLLEERAR 81 >gi|157828460|ref|YP_001494702.1| hypothetical protein A1G_03315 [Rickettsia rickettsii str. 'Sheila Smith'] gi|165933178|ref|YP_001649967.1| septum formation initiator [Rickettsia rickettsii str. Iowa] gi|238650887|ref|YP_002916743.1| septum formation initiator [Rickettsia peacockii str. Rustic] gi|157800941|gb|ABV76194.1| hypothetical protein A1G_03315 [Rickettsia rickettsii str. 'Sheila Smith'] gi|165908265|gb|ABY72561.1| septum formation initiator [Rickettsia rickettsii str. Iowa] gi|238624985|gb|ACR47691.1| septum formation initiator [Rickettsia peacockii str. Rustic] Length = 101 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 33/93 (35%), Positives = 48/93 (51%), Gaps = 8/93 (8%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSR 64 NH + I + + YF H I G+ G LK N+ LEK+ E L L+ R Sbjct: 7 NHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LKGLRAERVE 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE VKL+ SL KD+L+E+A+ L ++ +E Sbjct: 63 LEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNE 95 >gi|254476889|ref|ZP_05090275.1| septum formation initiator [Ruegeria sp. R11] gi|214031132|gb|EEB71967.1| septum formation initiator [Ruegeria sp. R11] Length = 99 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 34/85 (40%), Positives = 47/85 (55%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 F IAF YFT A+ GD+GL ++ + L ELK +R+E +SD Sbjct: 14 FSTIAFALSAYFTFAAVQGDFGLFRRVEIQAEAEALRQDLDELKRETARMENLTHRLSDN 73 Query: 76 SLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLDE+AR L L R+DEI++ Sbjct: 74 YLDLDLLDEQARTVLGLLRADEIVI 98 >gi|67459046|ref|YP_246670.1| hypothetical protein RF_0654 [Rickettsia felis URRWXCal2] gi|67004579|gb|AAY61505.1| unknown [Rickettsia felis URRWXCal2] Length = 107 Score = 47.0 bits (110), Expect = 0.001, Method: Compositional matrix adjust. Identities = 34/100 (34%), Positives = 49/100 (49%), Gaps = 8/100 (8%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSR 64 NH + I + + YF H I G+ G LK N+ LEK+ E L L+ R Sbjct: 7 NHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LKGLRAERVE 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 LE VKL+ SL KD+L+E+A+ L ++ E + D Sbjct: 63 LEHNVKLLRTESLNKDMLEEQAKKVLGVADPKEQVFTIKD 102 >gi|304321946|ref|YP_003855589.1| hypothetical protein PB2503_12019 [Parvularcula bermudensis HTCC2503] gi|303300848|gb|ADM10447.1| hypothetical protein PB2503_12019 [Parvularcula bermudensis HTCC2503] Length = 125 Score = 46.6 bits (109), Expect = 0.001, Method: Compositional matrix adjust. Identities = 30/92 (32%), Positives = 45/92 (48%), Gaps = 3/92 (3%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 A FLV+ T + D GL + LE + R L+ L+ ++ LE + + Sbjct: 3 AAFLVVTTGYNALLT---VNSDEGLIVAERLEADIAARRDHLAALQSQKTALEERTDRLR 59 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 + L+KDLLDEK R L L+R DE ++ D Sbjct: 60 EDRLDKDLLDEKVRSVLGLARPDEYLVRMEDL 91 >gi|182678480|ref|YP_001832626.1| septum formation initiator [Beijerinckia indica subsp. indica ATCC 9039] gi|182634363|gb|ACB95137.1| Septum formation initiator [Beijerinckia indica subsp. indica ATCC 9039] Length = 106 Score = 46.2 bits (108), Expect = 0.001, Method: Compositional matrix adjust. Identities = 25/91 (27%), Positives = 45/91 (49%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 F I + YF HA+ G+ GLK + + E L+ LKE + + ++ Sbjct: 11 LFPLILYAASAALSSYFLWHALNGERGLKTRDEYARQIALLEGQLTALKEEHEQWQHRIG 70 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 LM + ++++DLLDE R L +D++++ Sbjct: 71 LMHNNAVDRDLLDEATRTRLGRIGADDLMVI 101 >gi|51473611|ref|YP_067368.1| hypothetical protein RT0409 [Rickettsia typhi str. Wilmington] gi|51459923|gb|AAU03886.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington] Length = 107 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 31/86 (36%), Positives = 45/86 (52%), Gaps = 8/86 (9%) Query: 24 VVYFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEK 79 +VYF H I G+ G LK N+ LEK+ E L L+ R LE VKL+ SL K Sbjct: 22 LVYFIFHCIYGNKGIIAYLKVNRQLEKAYDE----LKILRAKRVELEHNVKLLRTESLNK 77 Query: 80 DLLDEKARYSLNLSRSDEIILFYSDF 105 D+L+E+ + L ++ +E + D Sbjct: 78 DMLEEQVKKILGIAAPNEQVFTIKDI 103 >gi|157803819|ref|YP_001492368.1| hypothetical protein A1E_03240 [Rickettsia canadensis str. McKiel] gi|157785082|gb|ABV73583.1| hypothetical protein A1E_03240 [Rickettsia canadensis str. McKiel] Length = 111 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 31/84 (36%), Positives = 44/84 (52%), Gaps = 8/84 (9%) Query: 26 YFTNHAIVGDYG----LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDL 81 YF H I G+ G LK N+ LEK+ E L L+ R LE VKL+ SL KD+ Sbjct: 28 YFVFHCIYGNKGIIAYLKVNRQLEKAYDE----LKGLRAERVELEHNVKLLRTESLNKDM 83 Query: 82 LDEKARYSLNLSRSDEIILFYSDF 105 L+E+A+ L ++ +E + D Sbjct: 84 LEEQAKKVLGVAAPNEQVFTTKDI 107 >gi|91977283|ref|YP_569942.1| septum formation initiator [Rhodopseudomonas palustris BisB5] gi|91683739|gb|ABE40041.1| Septum formation initiator [Rhodopseudomonas palustris BisB5] Length = 105 Score = 46.2 bits (108), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 41/73 (56%) Query: 27 FTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKA 86 F +A G YGL A + L++ +I L LK R+ E++V L+ L+ D+LDE+ Sbjct: 27 FGINAYTGRYGLTAQQELDQEIIALTSELVRLKNERAEGEKRVALLRSERLDPDMLDERV 86 Query: 87 RYSLNLSRSDEII 99 RY L+ + +++ Sbjct: 87 RYQLDFANPADLV 99 >gi|258542193|ref|YP_003187626.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-01] gi|256633271|dbj|BAH99246.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-01] gi|256636330|dbj|BAI02299.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-03] gi|256639383|dbj|BAI05345.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-07] gi|256642439|dbj|BAI08394.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-22] gi|256645494|dbj|BAI11442.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-26] gi|256648547|dbj|BAI14488.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-32] gi|256651600|dbj|BAI17534.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654591|dbj|BAI20518.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-12] Length = 109 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 27/95 (28%), Positives = 55/95 (57%), Gaps = 9/95 (9%) Query: 13 RAIFLVIAFCCVV-YFTNHAIVGDYGLKANKS----LEKSLIERERFLSELKENRSRLER 67 RA+ + F + YF +A GD+G++A + LE++ ++ ++E ++ R Sbjct: 12 RAVVPPLVFLGIAGYFGWNATQGDHGIQAYRQQLGLLEQAKQSKQDAIAE----QAAWHR 67 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 +V + + SL+ D+LDE+AR LN++ ++I++ Y Sbjct: 68 RVNGLREQSLDTDILDERARAMLNMADRNDIVVPY 102 >gi|260433373|ref|ZP_05787344.1| septum formation initiator [Silicibacter lacuscaerulensis ITI-1157] gi|260417201|gb|EEX10460.1| septum formation initiator [Silicibacter lacuscaerulensis ITI-1157] Length = 91 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 34/88 (38%), Positives = 52/88 (59%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 +F +AF VYFT A+ GDYGL + + E+ + R+ L+ L R+E + + Sbjct: 5 LFFSVAFLLGVYFTFAAVQGDYGLLRRVEIAAERDALSRD--LAALNTEIVRMENLTRRL 62 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLDE+AR L + R+DEI++ Sbjct: 63 SDTYLDLDLLDEQARSVLGMIRADEIVI 90 >gi|326405303|ref|YP_004285385.1| septum formation initiator family protein [Acidiphilium multivorum AIU301] gi|325052165|dbj|BAJ82503.1| septum formation initiator family protein [Acidiphilium multivorum AIU301] Length = 112 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 24/84 (28%), Positives = 47/84 (55%), Gaps = 4/84 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +FLV+ YF +AI G G+ A + + L++ + L+++ R R + +V + Sbjct: 5 LFLVV----TAYFVFNAINGSRGIIAQRHDQAVLVKDRQSLTDVTARRDRWQARVDALHH 60 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 ++ D+L+E+AR LNL+ D++ Sbjct: 61 HAIAPDMLNEQARAVLNLADPDDL 84 >gi|302383093|ref|YP_003818916.1| septum formation initiator [Brevundimonas subvibrioides ATCC 15264] gi|302193721|gb|ADL01293.1| Septum formation initiator [Brevundimonas subvibrioides ATCC 15264] Length = 109 Score = 45.8 bits (107), Expect = 0.002, Method: Compositional matrix adjust. Identities = 25/73 (34%), Positives = 39/73 (53%) Query: 21 FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 + Y A+ G+ GL + + + L RE L+ L E R+ LE +V+ + GSL +D Sbjct: 15 LLLIGYLGVQALTGERGLLSGAARDARLDAREAQLAALAEQRADLEVRVRYLRTGSLSRD 74 Query: 81 LLDEKARYSLNLS 93 LL+E+A L S Sbjct: 75 LLEERASAVLGFS 87 >gi|114327846|ref|YP_745003.1| septum formation initiator [Granulibacter bethesdensis CGDNIH1] gi|114316020|gb|ABI62080.1| septum formation initiator [Granulibacter bethesdensis CGDNIH1] Length = 109 Score = 45.1 bits (105), Expect = 0.003, Method: Compositional matrix adjust. Identities = 22/90 (24%), Positives = 47/90 (52%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 A+ + + YF+ + G+ GL++ + +++ + L K + + ER++K + Sbjct: 14 AVAPTVFLALLGYFSWNVTRGNLGLQSYHEHQADMMQAAKDLEAAKADLASWERRIKGLG 73 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 L+ D LDE++R LNL+ +I++ Y Sbjct: 74 SSRLDTDSLDERSRAMLNLADPTDIVVMYP 103 >gi|220926284|ref|YP_002501586.1| Septum formation initiator [Methylobacterium nodulans ORS 2060] gi|219950891|gb|ACL61283.1| Septum formation initiator [Methylobacterium nodulans ORS 2060] Length = 103 Score = 44.3 bits (103), Expect = 0.006, Method: Compositional matrix adjust. Identities = 26/94 (27%), Positives = 48/94 (51%), Gaps = 5/94 (5%) Query: 13 RAIFLVIAF-----CCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 RA+ L + V YF A G GL+A ++L+ ++ L K +R+ ER Sbjct: 8 RALLLPLGLYAASILAVGYFLREAESGSRGLQAKRALKIQAYNLQQELDAAKADRAEWER 67 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +V L+ +++DLL+E+AR L +++++ Sbjct: 68 RVALLRSDQIDRDLLEERARIVLGRVHPNDVVII 101 >gi|167646723|ref|YP_001684386.1| septum formation initiator [Caulobacter sp. K31] gi|167349153|gb|ABZ71888.1| Septum formation initiator [Caulobacter sp. K31] Length = 98 Score = 44.3 bits (103), Expect = 0.007, Method: Compositional matrix adjust. Identities = 26/78 (33%), Positives = 39/78 (50%), Gaps = 2/78 (2%) Query: 16 FLVIA--FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 FL A + YF HA+ G+ GL + L + L +++ R LE + +L+ Sbjct: 8 FLPTAALLLLITYFVFHALTGERGLLSTSQRNADLAAKTLELKKIRAERMDLEARARLLR 67 Query: 74 DGSLEKDLLDEKARYSLN 91 GSL DLL+E+AR L Sbjct: 68 SGSLSADLLEERARSLLG 85 >gi|56697102|ref|YP_167465.1| hypothetical protein SPO2239 [Ruegeria pomeroyi DSS-3] gi|56678839|gb|AAV95505.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 99 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 32/88 (36%), Positives = 56/88 (63%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 +F ++F +YFT A+ GD+GL + + E+ ++ R+ L++++E R+E + + Sbjct: 13 VFFAVSFALAIYFTFAAVQGDFGLFRRVEIAAEREVLSRD--LAKVEEQIVRMENLTRRL 70 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLDE+AR L L R+DEI++ Sbjct: 71 SDDYLDLDLLDEQARSVLGLLRADEIVI 98 >gi|170743959|ref|YP_001772614.1| septum formation initiator [Methylobacterium sp. 4-46] gi|168198233|gb|ACA20180.1| Septum formation initiator [Methylobacterium sp. 4-46] Length = 103 Score = 43.9 bits (102), Expect = 0.007, Method: Compositional matrix adjust. Identities = 23/82 (28%), Positives = 44/82 (53%) Query: 20 AFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEK 79 + V YF A G GL+A ++L+ ++ L K +R+ ER+V L+ +++ Sbjct: 20 SVLAVGYFLREAESGSRGLQAKRALKIQAYNLQKELDAAKADRAEWERRVALLRSDQIDR 79 Query: 80 DLLDEKARYSLNLSRSDEIILF 101 DLL+E+AR L +++++ Sbjct: 80 DLLEERARLMLGRVHPNDVVII 101 >gi|296116170|ref|ZP_06834788.1| Septum formation initiator [Gluconacetobacter hansenii ATCC 23769] gi|295977276|gb|EFG84036.1| Septum formation initiator [Gluconacetobacter hansenii ATCC 23769] Length = 109 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 24/90 (26%), Positives = 47/90 (52%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 A+ + YF + + G++GL + + + L E + + R+V+ + Sbjct: 14 ALPPALFIGLTAYFGWNVMGGEHGLHSYAAQLRLLDEANSAQKDAYAEQQVWLRRVRGLK 73 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + +L++DL+DE+AR NL+R DEI++ Y Sbjct: 74 ENTLDRDLMDERARSMQNLARQDEIVVPYG 103 >gi|254504137|ref|ZP_05116288.1| Septum formation initiator subfamily [Labrenzia alexandrii DFL-11] gi|222440208|gb|EEE46887.1| Septum formation initiator subfamily [Labrenzia alexandrii DFL-11] Length = 77 Score = 43.5 bits (101), Expect = 0.010, Method: Compositional matrix adjust. Identities = 24/68 (35%), Positives = 37/68 (54%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G+ G+ +E+ + E E L L R L +V L+ SL+ D+LDE+AR LNL Sbjct: 3 GELGVVGRAMIERQVAELEGELQLLVAERRELAARVSLLRPESLDPDMLDERARLYLNLV 62 Query: 94 RSDEIILF 101 DE+++ Sbjct: 63 HPDELVVL 70 >gi|296284154|ref|ZP_06862152.1| hypothetical protein CbatJ_11046 [Citromicrobium bathyomarinum JL354] Length = 113 Score = 43.5 bits (101), Expect = 0.011, Method: Compositional matrix adjust. Identities = 23/73 (31%), Positives = 41/73 (56%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 I G G+ A K+L ERE +++L++ R+ L ++V + + + D++ E R +LN Sbjct: 37 IAGPSGIFAWSDASKALAEREARIAKLQDQRADLRQRVDALDPDNADPDMVVEMMRRNLN 96 Query: 92 LSRSDEIILFYSD 104 + DE+IL D Sbjct: 97 VVHPDEVILPKPD 109 >gi|148261800|ref|YP_001235927.1| septum formation initiator [Acidiphilium cryptum JF-5] gi|146403481|gb|ABQ32008.1| Septum formation initiator [Acidiphilium cryptum JF-5] Length = 120 Score = 43.1 bits (100), Expect = 0.012, Method: Compositional matrix adjust. Identities = 21/77 (27%), Positives = 43/77 (55%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 YF +AI G G+ A + + L++ + L+++ R R + +V + ++ D+L+ Sbjct: 18 TAYFVFNAINGSRGIIAQRHDQAVLVKDRQSLTDVTARRDRWQARVDALHHHAIAPDMLN 77 Query: 84 EKARYSLNLSRSDEIIL 100 E+AR LNL+ D++ + Sbjct: 78 EQARAVLNLADPDDLAV 94 >gi|217976705|ref|YP_002360852.1| septum formation initiator [Methylocella silvestris BL2] gi|217502081|gb|ACK49490.1| septum formation initiator [Methylocella silvestris BL2] Length = 107 Score = 43.1 bits (100), Expect = 0.013, Method: Compositional matrix adjust. Identities = 26/97 (26%), Positives = 48/97 (49%), Gaps = 5/97 (5%) Query: 12 FRAIFLVIAFCCVV-----YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 RAI + CV YF HA+ G+ GLK N + + + L LK + Sbjct: 7 IRAIVFPLLLYCVSGAAGGYFVWHALNGERGLKTNDEYQLKIAGFQTELDGLKAESALWR 66 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R++ L++ +++DLLDE+AR + + +++++ Sbjct: 67 RRIALINGAIVDRDLLDEEARALIGRADKNDLVVMLP 103 >gi|188582153|ref|YP_001925598.1| septum formation initiator [Methylobacterium populi BJ001] gi|179345651|gb|ACB81063.1| Septum formation initiator [Methylobacterium populi BJ001] Length = 103 Score = 42.7 bits (99), Expect = 0.018, Method: Compositional matrix adjust. Identities = 23/88 (26%), Positives = 47/88 (53%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 A+ ++ V YF + A G GL+A ++L+ + L+ K R+ E +V L+ Sbjct: 14 AVLWTVSALVVGYFVHQAESGSRGLEAKRALKVEAYGLTQELNVAKAERATWEHRVSLLR 73 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILF 101 +++DLL+E+AR L ++++++ Sbjct: 74 SEQIDRDLLEERARVVLGRVHANDLVII 101 >gi|170747419|ref|YP_001753679.1| septum formation initiator [Methylobacterium radiotolerans JCM 2831] gi|170653941|gb|ACB22996.1| Septum formation initiator [Methylobacterium radiotolerans JCM 2831] Length = 103 Score = 42.4 bits (98), Expect = 0.022, Method: Compositional matrix adjust. Identities = 23/83 (27%), Positives = 46/83 (55%) Query: 19 IAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE 78 ++ V YF A G+ GL+A K+L+ + L+ +K R+ E +V L+ ++ Sbjct: 19 LSALVVGYFVWQAESGNRGLEAKKALKIRAYGLSQELAAVKAERAVWEHRVNLLKSDQID 78 Query: 79 KDLLDEKARYSLNLSRSDEIILF 101 +DLL+E+AR L ++++++ Sbjct: 79 RDLLEERARIVLGRVHANDVVII 101 >gi|254461306|ref|ZP_05074722.1| septum formation initiator [Rhodobacterales bacterium HTCC2083] gi|206677895|gb|EDZ42382.1| septum formation initiator [Rhodobacteraceae bacterium HTCC2083] Length = 100 Score = 42.0 bits (97), Expect = 0.025, Method: Compositional matrix adjust. Identities = 34/99 (34%), Positives = 50/99 (50%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKEN 61 T K I+ AF YFT A+ GDYG+ + + + LS+LK Sbjct: 1 MTPKTAKPALGALIYFAAAFSLATYFTFAAVQGDYGVFRRAEIVVLARDLDVQLSQLKSE 60 Query: 62 RSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +E K +SD L+ DLLD++AR L L R+DEI++ Sbjct: 61 VAEMENLTKRLSDTYLDLDLLDQQARDVLGLLRADEIVV 99 >gi|163852204|ref|YP_001640247.1| septum formation initiator [Methylobacterium extorquens PA1] gi|218530963|ref|YP_002421779.1| septum formation initiator [Methylobacterium chloromethanicum CM4] gi|240139534|ref|YP_002964010.1| Septum formation initiator [Methylobacterium extorquens AM1] gi|254561950|ref|YP_003069045.1| Septum formation initiator [Methylobacterium extorquens DM4] gi|163663809|gb|ABY31176.1| Septum formation initiator [Methylobacterium extorquens PA1] gi|218523266|gb|ACK83851.1| Septum formation initiator [Methylobacterium chloromethanicum CM4] gi|240009507|gb|ACS40733.1| Septum formation initiator [Methylobacterium extorquens AM1] gi|254269228|emb|CAX25194.1| Septum formation initiator [Methylobacterium extorquens DM4] Length = 103 Score = 42.0 bits (97), Expect = 0.026, Method: Compositional matrix adjust. Identities = 23/88 (26%), Positives = 46/88 (52%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 A+ ++ V YF + A G GL+A + L+ + L+ K R+ E +V L+ Sbjct: 14 AVLWTVSALVVGYFVHQAESGSRGLEAKRVLKVEAYGLTQELNAAKAERATWEHRVSLLR 73 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILF 101 +++DLL+E+AR L ++++++ Sbjct: 74 SEQIDRDLLEERARVVLGRVHANDLVII 101 >gi|84503370|ref|ZP_01001439.1| hypothetical protein OB2597_04485 [Oceanicola batsensis HTCC2597] gi|84388280|gb|EAQ01231.1| hypothetical protein OB2597_04485 [Oceanicola batsensis HTCC2597] Length = 99 Score = 42.0 bits (97), Expect = 0.026, Method: Compositional matrix adjust. Identities = 35/96 (36%), Positives = 54/96 (56%), Gaps = 6/96 (6%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEK---SLIERERFLSELKENRSR 64 + F I+ FC +YFT A+ G+ GL +E +LIE+ L L+ + +R Sbjct: 6 RPAFSGLIYFAGVFCVGMYFTFSAVQGEMGLFRRTEIEADRDALIEQ---LDVLQADIAR 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +E + +SD L+ DLLD++AR L L RSDEI++ Sbjct: 63 MENLTERLSDEYLDLDLLDQQARDVLGLMRSDEIVI 98 >gi|254420950|ref|ZP_05034674.1| Septum formation initiator subfamily [Brevundimonas sp. BAL3] gi|196187127|gb|EDX82103.1| Septum formation initiator subfamily [Brevundimonas sp. BAL3] Length = 103 Score = 42.0 bits (97), Expect = 0.027, Method: Compositional matrix adjust. Identities = 25/64 (39%), Positives = 36/64 (56%) Query: 30 HAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 A+ G+ GL + S + + RE L+ L E R LE +V+ + SL KDLL+E+AR Sbjct: 24 QALTGERGLLSGSSRDALMGRRENQLAHLTEQRRDLETRVRYLRTDSLSKDLLEERARAV 83 Query: 90 LNLS 93 L S Sbjct: 84 LGFS 87 >gi|56416781|ref|YP_153855.1| hypothetical protein AM594 [Anaplasma marginale str. St. Maries] gi|222475144|ref|YP_002563560.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Florida] gi|56388013|gb|AAV86600.1| hypothetical protein AM594 [Anaplasma marginale str. St. Maries] gi|222419281|gb|ACM49304.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Florida] Length = 119 Score = 41.6 bits (96), Expect = 0.034, Method: Compositional matrix adjust. Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Query: 18 VIAFCCVV--YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 VI CVV Y A+ G+ GL A L + L E LS + + + ++R+ L+ + Sbjct: 30 VILVACVVTCYLGAGAMFGERGLLAMLRLRQELRRYESDLSRIVQLKEEMKRRNALLYED 89 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILF 101 SL DLLDE++R L DE+++ Sbjct: 90 SLSLDLLDERSRSVLGHVEPDELVVI 115 >gi|296532890|ref|ZP_06895556.1| probable septum formation initiator protein [Roseomonas cervicalis ATCC 49957] gi|296266788|gb|EFH12747.1| probable septum formation initiator protein [Roseomonas cervicalis ATCC 49957] Length = 107 Score = 41.6 bits (96), Expect = 0.035, Method: Compositional matrix adjust. Identities = 26/94 (27%), Positives = 49/94 (52%), Gaps = 2/94 (2%) Query: 12 FRAIFLVIAFCCVVY-FTNHAIVGDYGLKANKSLEKSLIERERF-LSELKENRSRLERKV 69 + ++L + F +++ F +A+ G + + S I R L+E + R +ERKV Sbjct: 8 IQVLWLPLVFAGLIWHFAWYAVHGPRVGSLAREAKASEIAAARITLAEAEAERDSIERKV 67 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + +++D LDE+AR LN+ DE+++ Y Sbjct: 68 AGLRGDRIDRDQLDERARALLNMVGKDELVVPYG 101 >gi|329889604|ref|ZP_08267947.1| septum formation initiator family protein [Brevundimonas diminuta ATCC 11568] gi|328844905|gb|EGF94469.1| septum formation initiator family protein [Brevundimonas diminuta ATCC 11568] Length = 106 Score = 41.6 bits (96), Expect = 0.042, Method: Compositional matrix adjust. Identities = 24/70 (34%), Positives = 37/70 (52%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 V+ + Y A+ G+ GL + + L +R+ L L E R LE +V+ + SL Sbjct: 8 VLLLLLIAYLGVQALTGERGLLSGGERDALLAQRQTQLMRLAEQRQDLEVRVRYLRTESL 67 Query: 78 EKDLLDEKAR 87 KDLL+E+AR Sbjct: 68 SKDLLEERAR 77 >gi|254994982|ref|ZP_05277172.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Mississippi] gi|255003126|ref|ZP_05278090.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Puerto Rico] gi|255004252|ref|ZP_05279053.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Virginia] Length = 103 Score = 41.2 bits (95), Expect = 0.049, Method: Compositional matrix adjust. Identities = 29/86 (33%), Positives = 45/86 (52%), Gaps = 2/86 (2%) Query: 18 VIAFCCVV--YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 VI CVV Y A+ G+ GL A L + L E LS + + + ++R+ L+ + Sbjct: 14 VILVACVVTCYLGAGAMFGERGLLAMLRLRQELRRYESDLSRIVQLKEEMKRRNALLYED 73 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILF 101 SL DLLDE++R L DE+++ Sbjct: 74 SLSLDLLDERSRSVLGHVEPDELVVI 99 >gi|83950363|ref|ZP_00959096.1| hypothetical protein ISM_04675 [Roseovarius nubinhibens ISM] gi|83838262|gb|EAP77558.1| hypothetical protein ISM_04675 [Roseovarius nubinhibens ISM] Length = 114 Score = 40.8 bits (94), Expect = 0.071, Method: Compositional matrix adjust. Identities = 33/86 (38%), Positives = 48/86 (55%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I+ I F +YFT A+ GD+GL +E E L L+ +R+E + +SD Sbjct: 28 IYFAITFALGLYFTFAAVQGDFGLFRRAEIEAETRALEARLEALESQVARMENLTRRLSD 87 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLD++AR L L RSDEI++ Sbjct: 88 SYLDLDLLDQQARDVLGLMRSDEIVI 113 >gi|58040703|ref|YP_192667.1| hypothetical protein GOX2278 [Gluconobacter oxydans 621H] gi|58003117|gb|AAW62011.1| Hypothetical protein GOX2278 [Gluconobacter oxydans 621H] Length = 109 Score = 40.8 bits (94), Expect = 0.072, Method: Compositional matrix adjust. Identities = 21/86 (24%), Positives = 47/86 (54%), Gaps = 6/86 (6%) Query: 21 FCCVVYFTNHAIVGDYGLKA---NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 YF + + G +G+ A L+K ++ + + + ++ R+V + + +L Sbjct: 21 LSLTAYFGWNVLHGAHGIHAYQEQMQLQKDALQARQ---DADDEQNVWRRRVVALKEKAL 77 Query: 78 EKDLLDEKARYSLNLSRSDEIILFYS 103 + D+LDE+AR ++NL+RS ++++ Y Sbjct: 78 DADMLDERARATMNLTRSGDLVVPYG 103 >gi|148554143|ref|YP_001261725.1| septum formation initiator [Sphingomonas wittichii RW1] gi|148499333|gb|ABQ67587.1| Septum formation initiator [Sphingomonas wittichii RW1] Length = 102 Score = 40.4 bits (93), Expect = 0.087, Method: Compositional matrix adjust. Identities = 25/87 (28%), Positives = 37/87 (42%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 A +A + YF + A++G GL A L + L + R RL KL+ Sbjct: 13 AALPAVAILIIGYFASAALIGPNGLLALGGYRTQLQAKSDELHRTEAVRDRLRHHAKLLD 72 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIIL 100 ++ D +E R S R DEII+ Sbjct: 73 PSRVDPDFGEELVRRSTGQVRPDEIII 99 >gi|159044700|ref|YP_001533494.1| hypothetical protein Dshi_2157 [Dinoroseobacter shibae DFL 12] gi|157912460|gb|ABV93893.1| hypothetical protein Dshi_2157 [Dinoroseobacter shibae DFL 12] Length = 100 Score = 40.4 bits (93), Expect = 0.089, Method: Compositional matrix adjust. Identities = 35/101 (34%), Positives = 53/101 (52%), Gaps = 4/101 (3%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELK 59 T K + A+ +IAF YF HA+ G+YGL + E++ + E L+ L+ Sbjct: 1 MTSKPKHSAVHGAVVTLIAFLVGTYFVFHAVQGEYGLFNRVQAEAEEARLRAE--LALLQ 58 Query: 60 ENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 LE K +SD L+ DLLDE+AR L +R +EI++ Sbjct: 59 GELRALENKTLRLSDQFLDLDLLDERARDVLGYARPNEIVI 99 >gi|323136510|ref|ZP_08071592.1| Septum formation initiator [Methylocystis sp. ATCC 49242] gi|322398584|gb|EFY01104.1| Septum formation initiator [Methylocystis sp. ATCC 49242] Length = 110 Score = 40.0 bits (92), Expect = 0.100, Method: Compositional matrix adjust. Identities = 25/87 (28%), Positives = 44/87 (50%), Gaps = 1/87 (1%) Query: 19 IAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE 78 +A YF H + G GLK + E+ L + LK R + E ++ L+ +++ Sbjct: 20 VAGTVAGYFVWHGVHGQRGLKTGEEYEQKLAQLRLERDILKLQRMQWESRLALIKGENID 79 Query: 79 KDLLDEKARYSLN-LSRSDEIILFYSD 104 D+LDE+ R L + R++ +IL S+ Sbjct: 80 ADILDEETRKRLGRVHRNEVVILLPSE 106 >gi|326387835|ref|ZP_08209441.1| septum formation initiator [Novosphingobium nitrogenifigens DSM 19370] gi|326207881|gb|EGD58692.1| septum formation initiator [Novosphingobium nitrogenifigens DSM 19370] Length = 92 Score = 40.0 bits (92), Expect = 0.11, Method: Compositional matrix adjust. Identities = 22/70 (31%), Positives = 38/70 (54%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSL 90 AI G G+ A + L + +R +++L R RL +V+L+ + DL+ E R L Sbjct: 17 AIAGPSGMLAWTENARMLEQDQREIAKLTAQRDRLHNRVELLDPHHADPDLVGELLRRDL 76 Query: 91 NLSRSDEIIL 100 N++ DE++L Sbjct: 77 NVAHPDEVVL 86 >gi|77463043|ref|YP_352547.1| hypothetical protein RSP_4046 [Rhodobacter sphaeroides 2.4.1] gi|126461918|ref|YP_001043032.1| septum formation initiator [Rhodobacter sphaeroides ATCC 17029] gi|221638901|ref|YP_002525163.1| septum formation initiator [Rhodobacter sphaeroides KD131] gi|332557919|ref|ZP_08412241.1| Septum formation initiator precursor [Rhodobacter sphaeroides WS8N] gi|77387461|gb|ABA78646.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1] gi|126103582|gb|ABN76260.1| Septum formation initiator [Rhodobacter sphaeroides ATCC 17029] gi|221159682|gb|ACM00662.1| Septum formation initiator precursor [Rhodobacter sphaeroides KD131] gi|332275631|gb|EGJ20946.1| Septum formation initiator precursor [Rhodobacter sphaeroides WS8N] Length = 100 Score = 40.0 bits (92), Expect = 0.12, Method: Compositional matrix adjust. Identities = 33/91 (36%), Positives = 52/91 (57%), Gaps = 8/91 (8%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGL----KANKSLEKSLIERERFLSELKENRSRLERKV 69 +++ +AF VYFT A+ GDYG+ + E ER+R +EL + +E + Sbjct: 13 SLYFALAFSLSVYFTFAAVQGDYGVFRQVQIQAEAEALRSERDRIAAELAD----MENRT 68 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLDE+AR L R+DEI++ Sbjct: 69 RRLSDSYLDLDLLDEQARSVLGYVRADEIVI 99 >gi|163742728|ref|ZP_02150113.1| hypothetical protein RG210_15325 [Phaeobacter gallaeciensis 2.10] gi|161383983|gb|EDQ08367.1| hypothetical protein RG210_15325 [Phaeobacter gallaeciensis 2.10] Length = 138 Score = 39.3 bits (90), Expect = 0.16, Method: Compositional matrix adjust. Identities = 32/86 (37%), Positives = 48/86 (55%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F IAF YFT A+ GD+GL ++ + L +LK +++E +SD Sbjct: 52 VFSTIAFALSAYFTFAAVQGDFGLFRRVEIQAEAEALRQDLDQLKRETAQMENLTHRLSD 111 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLDE+AR L L R+DEI++ Sbjct: 112 DYLDLDLLDEQARSVLGLLRADEIVI 137 >gi|163736624|ref|ZP_02144043.1| hypothetical protein RGBS107_15871 [Phaeobacter gallaeciensis BS107] gi|161390494|gb|EDQ14844.1| hypothetical protein RGBS107_15871 [Phaeobacter gallaeciensis BS107] Length = 138 Score = 39.3 bits (90), Expect = 0.18, Method: Compositional matrix adjust. Identities = 32/86 (37%), Positives = 48/86 (55%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F IAF YFT A+ GD+GL ++ + L +LK +++E +SD Sbjct: 52 VFSTIAFALSAYFTFAAVQGDFGLFRRVEIQAEAEALRQDLDQLKRETAQMENLTHRLSD 111 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLDE+AR L L R+DEI++ Sbjct: 112 DYLDLDLLDEQARSVLGLLRADEIVI 137 >gi|83858353|ref|ZP_00951875.1| hypothetical protein OA2633_02601 [Oceanicaulis alexandrii HTCC2633] gi|83853176|gb|EAP91028.1| hypothetical protein OA2633_02601 [Oceanicaulis alexandrii HTCC2633] Length = 110 Score = 39.3 bits (90), Expect = 0.20, Method: Compositional matrix adjust. Identities = 23/92 (25%), Positives = 48/92 (52%), Gaps = 4/92 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R I L+ + Y + HA+ G+ G + ++ + E L++++ R ++E +V + Sbjct: 7 RFIPLIGLAIVISYLSYHALHGEQGYLNHLRIQAQISAAEAELADVRSTREQMEDRVARL 66 Query: 73 ----SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 D +++ D L+E+AR L + DEI++ Sbjct: 67 KAEGPDAAVDVDYLEERARAVLRFAHPDEIVV 98 >gi|114800148|ref|YP_760678.1| septum formation initiator family protein [Hyphomonas neptunium ATCC 15444] gi|114740322|gb|ABI78447.1| septum formation initiator family protein [Hyphomonas neptunium ATCC 15444] Length = 101 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 23/81 (28%), Positives = 40/81 (49%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 V+YF HA G+ GL + L R+ L E+++ RL ++ ++ GS++ D ++ Sbjct: 16 VLYFAFHAFAGEKGLGRWTDAQIELETRKTELVEMQQEIERLRVDIRRLTPGSVDPDYVE 75 Query: 84 EKARYSLNLSRSDEIILFYSD 104 AR L EI+L + Sbjct: 76 ALARDKLAFVYPGEIVLLTPE 96 >gi|257125644|ref|YP_003163758.1| septum formation initiator [Leptotrichia buccalis C-1013-b] gi|257049583|gb|ACV38767.1| Septum formation initiator [Leptotrichia buccalis C-1013-b] Length = 89 Score = 38.5 bits (88), Expect = 0.29, Method: Compositional matrix adjust. Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 7/80 (8%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +I FC VV+F ++ G K ++ SL+E ER + ELKE +++L + K +D Sbjct: 10 IIFFCLVVHFIGQSVSVYMG---KKKMKISLMETERNIKELKERKNKLLEEKKNTND--- 63 Query: 78 EKDLLDEKARYSLNLSRSDE 97 K+ ++ AR LNL R E Sbjct: 64 -KEKTEKYARNDLNLKREGE 82 >gi|84517286|ref|ZP_01004640.1| hypothetical protein SKA53_05620 [Loktanella vestfoldensis SKA53] gi|84508766|gb|EAQ05229.1| hypothetical protein SKA53_05620 [Loktanella vestfoldensis SKA53] Length = 82 Score = 38.5 bits (88), Expect = 0.30, Method: Compositional matrix adjust. Identities = 31/78 (39%), Positives = 47/78 (60%), Gaps = 4/78 (5%) Query: 25 VYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 +YFT A+ GDYGL + E + + E L+ L+ +R+E +SD L+ DLL Sbjct: 6 LYFTFAAVQGDYGLFKRVEVRAESAALRLE--LAGLQAEVARMENLTTRLSDNFLDLDLL 63 Query: 83 DEKARYSLNLSRSDEIIL 100 DE+AR+ L L R+DEI++ Sbjct: 64 DEQARHLLGLIRADEIVI 81 >gi|310815651|ref|YP_003963615.1| septum formation initiator [Ketogulonicigenium vulgare Y25] gi|308754386|gb|ADO42315.1| septum formation initiator [Ketogulonicigenium vulgare Y25] Length = 97 Score = 38.5 bits (88), Expect = 0.32, Method: Compositional matrix adjust. Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 4/87 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 I++ A +YF AI GDYGL + + E + E L L+ +S LE + Sbjct: 11 IYIAAAVMAALYFMFAAIQGDYGLFRRIELNAEADALRTE--LGALRAEQSNLENLTHRL 68 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEII 99 SD L+ DLLDE+AR L R+DE++ Sbjct: 69 SDAYLDLDLLDERARNVLGYVRADEVV 95 >gi|163746653|ref|ZP_02154010.1| hypothetical protein OIHEL45_14659 [Oceanibulbus indolifex HEL-45] gi|161379767|gb|EDQ04179.1| hypothetical protein OIHEL45_14659 [Oceanibulbus indolifex HEL-45] Length = 99 Score = 38.5 bits (88), Expect = 0.35, Method: Compositional matrix adjust. Identities = 32/89 (35%), Positives = 52/89 (58%), Gaps = 6/89 (6%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSL---EKSLIERERFLSELKENRSRLERKVKL 71 +F IAF +YFT A+ GD+GL + + L +R L+E++ +R+E + Sbjct: 13 LFFAIAFALSLYFTFAAVQGDFGLFRRTEIVAENQKLSDR---LAEVRAEVARMENLTRR 69 Query: 72 MSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+ R L + R+DEI++ Sbjct: 70 LSDDYLDLDLLDERTRKVLGMVRTDEIVI 98 >gi|269958808|ref|YP_003328596.1| hypothetical protein ACIS_00720 [Anaplasma centrale str. Israel] gi|269848638|gb|ACZ49282.1| hypothetical protein ACIS_00720 [Anaplasma centrale str. Israel] Length = 119 Score = 37.7 bits (86), Expect = 0.49, Method: Compositional matrix adjust. Identities = 24/76 (31%), Positives = 39/76 (51%) Query: 26 YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEK 85 Y + GD GL A L + L E LS + + + ++R+ L+ + SL DLLDE+ Sbjct: 40 YLGASVMFGDRGLLAMLRLRQELRRYEGDLSRMVQLKEEMQRRNALLYESSLNLDLLDER 99 Query: 86 ARYSLNLSRSDEIILF 101 +R L DE+++ Sbjct: 100 SRSVLGHVEPDELVVI 115 >gi|322419460|ref|YP_004198683.1| Septum formation initiator [Geobacter sp. M18] gi|320125847|gb|ADW13407.1| Septum formation initiator [Geobacter sp. M18] Length = 138 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 34/94 (36%), Positives = 51/94 (54%), Gaps = 11/94 (11%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 +K FF A VI+F ++YFT + GD GL L + L + ++ LSELKE +L+ Sbjct: 2 QKRLFF-APAAVISF--ILYFT---VFGDRGLLRINHLHRDLDDTQKRLSELKEENDKLK 55 Query: 67 RKV-KLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R++ L SD + L+ AR L R +E+I Sbjct: 56 REIAALQSD----RRYLESIARRDFGLVRGNEVI 85 >gi|87200026|ref|YP_497283.1| septum formation initiator [Novosphingobium aromaticivorans DSM 12444] gi|87135707|gb|ABD26449.1| Septum formation initiator [Novosphingobium aromaticivorans DSM 12444] Length = 102 Score = 37.7 bits (86), Expect = 0.55, Method: Compositional matrix adjust. Identities = 21/70 (30%), Positives = 38/70 (54%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSL 90 I G GL A + L +R+ +++L R RL+ +V L+ + DL+ E R +L Sbjct: 29 GIAGPSGLLAWGENARLLDQRQHEIAQLTAERDRLKNRVALLDPRHADPDLVGELLRSNL 88 Query: 91 NLSRSDEIIL 100 N++ DE+++ Sbjct: 89 NVAHPDELVI 98 >gi|197118666|ref|YP_002139093.1| septum formation initiator family protein [Geobacter bemidjiensis Bem] gi|197088026|gb|ACH39297.1| septum formation initiator family protein [Geobacter bemidjiensis Bem] Length = 128 Score = 37.4 bits (85), Expect = 0.68, Method: Compositional matrix adjust. Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 9/93 (9%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 +K FF + ++I ++YFT + GD GL L + L + ++ LSELKE +L+ Sbjct: 2 QKRLFFVPLAVII---FILYFT---VFGDRGLLRINHLHRDLDDTQKRLSELKEENDQLK 55 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R++ + ++ L+ AR L RS+E++ Sbjct: 56 REIAALQS---DRRYLESIARRDFGLVRSNEVV 85 >gi|85708701|ref|ZP_01039767.1| hypothetical protein NAP1_05660 [Erythrobacter sp. NAP1] gi|85690235|gb|EAQ30238.1| hypothetical protein NAP1_05660 [Erythrobacter sp. NAP1] Length = 99 Score = 37.4 bits (85), Expect = 0.73, Method: Compositional matrix adjust. Identities = 24/74 (32%), Positives = 38/74 (51%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSL 90 AI G GL A + L +R+ ++ LKE R L+ +V+L+ + DL+ E R L Sbjct: 25 AIAGPTGLLAWAENGEVLEQRQVRITLLKEKRDALKNRVELLDPEGADPDLVSELVREDL 84 Query: 91 NLSRSDEIILFYSD 104 + DEI++ D Sbjct: 85 GVIHPDEIVITLED 98 >gi|86138770|ref|ZP_01057342.1| hypothetical protein MED193_03342 [Roseobacter sp. MED193] gi|85824417|gb|EAQ44620.1| hypothetical protein MED193_03342 [Roseobacter sp. MED193] Length = 99 Score = 37.4 bits (85), Expect = 0.75, Method: Compositional matrix adjust. Identities = 33/85 (38%), Positives = 46/85 (54%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 F V+AF YFT A+ GD+GL ++ E L LK + +E +SD Sbjct: 14 FFVVAFALGAYFTFAAVQGDFGLFRRVEIQAEADELRLDLDRLKVEIAEIENLTHRLSDD 73 Query: 76 SLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLDE+AR L L R+DEI++ Sbjct: 74 YLDLDLLDEQARSVLGLLRADEIVI 98 >gi|253700560|ref|YP_003021749.1| septum formation initiator [Geobacter sp. M21] gi|251775410|gb|ACT17991.1| Septum formation initiator [Geobacter sp. M21] Length = 133 Score = 37.0 bits (84), Expect = 0.87, Method: Compositional matrix adjust. Identities = 28/93 (30%), Positives = 50/93 (53%), Gaps = 9/93 (9%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 +K FF + ++I ++YFT + GD GL L + L + ++ LSELKE +L+ Sbjct: 2 QKRLFFVPLAVII---FILYFT---VFGDRGLLRINHLHRDLDDTQKRLSELKEENDQLK 55 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R++ + ++ L+ AR L RS+E++ Sbjct: 56 REIAALQS---DRRYLESIARRDFGLVRSNEVV 85 >gi|254437248|ref|ZP_05050742.1| Septum formation initiator subfamily [Octadecabacter antarcticus 307] gi|198252694|gb|EDY77008.1| Septum formation initiator subfamily [Octadecabacter antarcticus 307] Length = 98 Score = 37.0 bits (84), Expect = 0.96, Method: Compositional matrix adjust. Identities = 31/83 (37%), Positives = 48/83 (57%), Gaps = 4/83 (4%) Query: 20 AFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 A +YFT A+ GD+G+ +A E + +E L+ L+ RLE + +SD L Sbjct: 17 ALMLGLYFTFAAVQGDFGVFKRAEIDAEGRALTQE--LALLQTQVDRLENLTRRLSDTFL 74 Query: 78 EKDLLDEKARYSLNLSRSDEIIL 100 + DLLDE+AR L + R+DEI++ Sbjct: 75 DLDLLDEQARDMLGMIRTDEIVI 97 >gi|169827292|ref|YP_001697450.1| protein resB [Lysinibacillus sphaericus C3-41] gi|168991780|gb|ACA39320.1| Protein resB [Lysinibacillus sphaericus C3-41] Length = 560 Score = 36.6 bits (83), Expect = 1.2, Method: Composition-based stats. Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Query: 33 VGDYGLKANKSLEK---SLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 V DY ++ N L++ +L + + L+ELK+ L K S G +E DL + K Y Sbjct: 319 VKDYSIRVNHPLKEDGFALYQMDYRLNELKQMNFELINKASEKSLGKVEIDLTNPKKEYD 378 Query: 90 LNLSRSDEIILFYSDF 105 L S +I+++ DF Sbjct: 379 LGNGSSVQILVYTPDF 394 >gi|84687412|ref|ZP_01015290.1| hypothetical protein 1099457000250_RB2654_05210 [Maritimibacter alkaliphilus HTCC2654] gi|84664570|gb|EAQ11056.1| hypothetical protein RB2654_05210 [Rhodobacterales bacterium HTCC2654] Length = 88 Score = 36.6 bits (83), Expect = 1.2, Method: Compositional matrix adjust. Identities = 31/90 (34%), Positives = 51/90 (56%), Gaps = 8/90 (8%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL----KANKSLEKSLIERERFLSELKENRSRLERKVK 70 ++L+ YFT ++ GDYGL + + + ER+R +E+ + LE K + Sbjct: 2 LYLLGLISAGTYFTFASVQGDYGLFRRVRIDAEAQTLAQERDRLAAEI----ATLENKTR 57 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLD++AR L L R+DE++L Sbjct: 58 RISDDFLDLDLLDQQARDVLGLVRADEVVL 87 >gi|299538373|ref|ZP_07051656.1| protein resB [Lysinibacillus fusiformis ZC1] gi|298725960|gb|EFI66552.1| protein resB [Lysinibacillus fusiformis ZC1] Length = 558 Score = 36.6 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Query: 33 VGDYGLKANKSLEK---SLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 V DY ++ N L++ +L + + L+ELK+ L K S G +E DL + K Y Sbjct: 317 VKDYSIRVNHPLKEDGFALYQMDYRLNELKQMNFELINKTTEKSLGKVEIDLTNPKKEYD 376 Query: 90 LNLSRSDEIILFYSDF 105 L S +I+++ DF Sbjct: 377 LGNGSSVQILVYTPDF 392 >gi|126650118|ref|ZP_01722351.1| cytochrome c biogenesis [Bacillus sp. B14905] gi|126593290|gb|EAZ87252.1| cytochrome c biogenesis [Bacillus sp. B14905] Length = 560 Score = 36.2 bits (82), Expect = 1.4, Method: Composition-based stats. Identities = 24/76 (31%), Positives = 39/76 (51%), Gaps = 3/76 (3%) Query: 33 VGDYGLKANKSLEK---SLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 V DY ++ N L++ +L + + L+ELK+ L K S G +E DL + K Y Sbjct: 319 VKDYSIRVNHPLKEDGYALYQMDYRLNELKQMNFELINKASEKSLGKVEIDLTNPKKEYD 378 Query: 90 LNLSRSDEIILFYSDF 105 L S +I+++ DF Sbjct: 379 LGNGSSVQILVYTPDF 394 >gi|110680206|ref|YP_683213.1| hypothetical protein RD1_3010 [Roseobacter denitrificans OCh 114] gi|109456322|gb|ABG32527.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 99 Score = 36.2 bits (82), Expect = 1.6, Method: Compositional matrix adjust. Identities = 29/88 (32%), Positives = 51/88 (57%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 IF +A YFT A+ GD+G+ +A + E +++ ++ LS ++ + +E + Sbjct: 13 IFFTLALGLATYFTFAAVQGDFGVFKRAEITAEANVLRQQ--LSAVQADVQEMENLTLRL 70 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLDE+ R L + R+DEI++ Sbjct: 71 SDDYLDLDLLDEQVRRVLGMIRADEIVI 98 >gi|225677021|ref|ZP_03788033.1| hypothetical protein WUni_005100 [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225590932|gb|EEH12147.1| hypothetical protein WUni_005100 [Wolbachia endosymbiont of Muscidifurax uniraptor] Length = 104 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 27/101 (26%), Positives = 51/101 (50%), Gaps = 1/101 (0%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M K+ ++ L+I+ +YF+ I G GL L+K + E L ++ Sbjct: 1 MLISKKKQKLLCLSVTLLIS-SLTLYFSISTITGKRGLLTLIDLKKEIEYNELLLKDVSS 59 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 + +L+ KV + + SL+ DLLDE+A+ +L +E+++ Sbjct: 60 EKEKLDNKVFGLYEKSLDLDLLDEQAKNALGYVNPNELMVV 100 >gi|89054183|ref|YP_509634.1| septum formation initiator [Jannaschia sp. CCS1] gi|88863732|gb|ABD54609.1| Septum formation initiator [Jannaschia sp. CCS1] Length = 104 Score = 35.8 bits (81), Expect = 1.9, Method: Compositional matrix adjust. Identities = 36/91 (39%), Positives = 49/91 (53%), Gaps = 6/91 (6%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE---NRSRLERKV 69 RAI I F VYFT A+ G+ GL +E ER+R + EL +R+E Sbjct: 16 RAIMPGILFLVGVYFTFAAVQGNNGLFQRIQVEA---ERDRLVEELARLEMQTARMEILT 72 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLDE+ R L +R DE+IL Sbjct: 73 RRLSDDYLDLDLLDERVRNVLGYARPDEVIL 103 >gi|163731360|ref|ZP_02138807.1| hypothetical protein RLO149_18689 [Roseobacter litoralis Och 149] gi|161394814|gb|EDQ19136.1| hypothetical protein RLO149_18689 [Roseobacter litoralis Och 149] Length = 99 Score = 35.8 bits (81), Expect = 2.3, Method: Compositional matrix adjust. Identities = 30/88 (34%), Positives = 50/88 (56%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 IF +A YFT A+ GD+G+ +A + E S++ ++ L +K + +E + Sbjct: 13 IFFALALGLGTYFTFAAVQGDFGVFKRAEITAEASMLRQQ--LHAVKADVDEMENLTLRL 70 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLDE+ R L + R+DEI++ Sbjct: 71 SDDYLDLDLLDEQVRRVLGMIRADEIVI 98 >gi|260889546|ref|ZP_05900809.1| putative cell division protein DIVIC [Leptotrichia hofstadii F0254] gi|260860957|gb|EEX75457.1| putative cell division protein DIVIC [Leptotrichia hofstadii F0254] Length = 91 Score = 35.4 bits (80), Expect = 2.4, Method: Compositional matrix adjust. Identities = 29/88 (32%), Positives = 48/88 (54%), Gaps = 5/88 (5%) Query: 12 FRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKL 71 R I +I F VV+F ++ G K ++ SL + + + ELKE +S+LE++ + Sbjct: 4 LRLIGNIIFFSLVVHFVLQSVNVFMG---KKDMQISLSQTNQQIKELKERKSKLEQEKE- 59 Query: 72 MSDGSLEKDLLDEKARYSLNLSRSDEII 99 + G KD ++ AR +LNL R E+I Sbjct: 60 -NAGVNNKDKNEKFARNNLNLKRKGEVI 86 >gi|83943193|ref|ZP_00955653.1| hypothetical protein EE36_13468 [Sulfitobacter sp. EE-36] gi|83954328|ref|ZP_00963048.1| hypothetical protein NAS141_18519 [Sulfitobacter sp. NAS-14.1] gi|83841365|gb|EAP80535.1| hypothetical protein NAS141_18519 [Sulfitobacter sp. NAS-14.1] gi|83846201|gb|EAP84078.1| hypothetical protein EE36_13468 [Sulfitobacter sp. EE-36] Length = 99 Score = 35.4 bits (80), Expect = 2.6, Method: Compositional matrix adjust. Identities = 31/93 (33%), Positives = 50/93 (53%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K F +F IAF +YF AI G+YGL + + L++++ + +R+E Sbjct: 6 KPAFGTLLFFAIAFALSLYFAFAAIQGNYGLFRRAEIVAEAQDLRVQLAQVQIDVARMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+ R L + R+DEI++ Sbjct: 66 LTHRLSDEYLDLDLLDEQTRKVLGMIRADEIVI 98 >gi|114767395|ref|ZP_01446198.1| hypothetical protein 1100011001252_R2601_23525 [Pelagibaca bermudensis HTCC2601] gi|114540512|gb|EAU43590.1| hypothetical protein R2601_23525 [Roseovarius sp. HTCC2601] Length = 99 Score = 35.4 bits (80), Expect = 2.7, Method: Compositional matrix adjust. Identities = 34/97 (35%), Positives = 51/97 (52%), Gaps = 6/97 (6%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE---NRS 63 +K F I+ I YF A+ GD+GL +E +E +R ELK + Sbjct: 5 RKPAFGVVIYTAITLSLSGYFVFAAVQGDFGLFRRAEIE---VEGDRLAGELKSLEGEVA 61 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 R+E + +SD L+ DLLD++AR L + RSDEI++ Sbjct: 62 RMENLTRRLSDDYLDLDLLDQQARDVLGVMRSDEIVV 98 >gi|260576742|ref|ZP_05844727.1| Septum formation initiator [Rhodobacter sp. SW2] gi|259020994|gb|EEW24305.1| Septum formation initiator [Rhodobacter sp. SW2] Length = 100 Score = 35.4 bits (80), Expect = 2.8, Method: Compositional matrix adjust. Identities = 33/91 (36%), Positives = 48/91 (52%), Gaps = 8/91 (8%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGL----KANKSLEKSLIERERFLSELKENRSRLERKV 69 A+ L+ A YFT A+ GD+G+ + E ER+R L E ++R R Sbjct: 13 ALILMAAVLIGGYFTFAAVQGDFGVFRQVQIKAEAEALRAERDRLKQALAEMQNRTLR-- 70 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+AR L R+DEI++ Sbjct: 71 --LSDAYLDLDLLDEQARDVLGYIRADEIVI 99 >gi|255262304|ref|ZP_05341646.1| septum formation initiator [Thalassiobium sp. R2A62] gi|255104639|gb|EET47313.1| septum formation initiator [Thalassiobium sp. R2A62] Length = 120 Score = 35.4 bits (80), Expect = 3.0, Method: Compositional matrix adjust. Identities = 30/96 (31%), Positives = 51/96 (53%), Gaps = 4/96 (4%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSR 64 K+ F ++ F +YFT A+ GD+G+ +A E + E L+E++ Sbjct: 26 KRPAFGALMYFSCIFMLGLYFTFAAVQGDFGVFKRAQVDAEADTLAVE--LAEVQAQVDT 83 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +E + +SD L+ DLLD +AR L + R+DEI++ Sbjct: 84 MENLTQRLSDKYLDLDLLDTQARDVLGMIRADEIVI 119 >gi|254452318|ref|ZP_05065755.1| septum formation initiator [Octadecabacter antarcticus 238] gi|198266724|gb|EDY90994.1| septum formation initiator [Octadecabacter antarcticus 238] Length = 98 Score = 35.0 bits (79), Expect = 3.0, Method: Compositional matrix adjust. Identities = 30/83 (36%), Positives = 48/83 (57%), Gaps = 4/83 (4%) Query: 20 AFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 A +YFT A+ GD+G+ +A E + +E L+ L+ +LE + +SD L Sbjct: 17 ALMLGLYFTFAAVQGDFGVFKRAEIDAEGRALTQE--LAILQMQVDQLENLTRRLSDTYL 74 Query: 78 EKDLLDEKARYSLNLSRSDEIIL 100 + DLLDE+AR L + R+DEI++ Sbjct: 75 DLDLLDEQARDMLGMVRADEIVI 97 >gi|149913851|ref|ZP_01902383.1| Septum formation initiator [Roseobacter sp. AzwK-3b] gi|149812135|gb|EDM71966.1| Septum formation initiator [Roseobacter sp. AzwK-3b] Length = 91 Score = 35.0 bits (79), Expect = 3.4, Method: Compositional matrix adjust. Identities = 34/88 (38%), Positives = 49/88 (55%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 I+ +IAF YFT A+ GDYGL +A E + + L +L +R+E + Sbjct: 5 IYSLIAFGLGAYFTFAAVQGDYGLFRRAEIDAETDALRAQ--LKDLSVQVARMENLTLRL 62 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLD++AR L L R DEI++ Sbjct: 63 SDDFLDTDLLDQQARDVLGLLRPDEIVI 90 >gi|126735931|ref|ZP_01751675.1| Septum formation initiator [Roseobacter sp. CCS2] gi|126714488|gb|EBA11355.1| Septum formation initiator [Roseobacter sp. CCS2] Length = 99 Score = 34.7 bits (78), Expect = 4.0, Method: Compositional matrix adjust. Identities = 29/78 (37%), Positives = 45/78 (57%), Gaps = 4/78 (5%) Query: 25 VYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 +YFT A+ GDYGL + E + E L+ L+ +R+E +SD L+ DLL Sbjct: 23 LYFTFAAVQGDYGLFKRIEVKAEGDALAVE--LAALQTEVARMENLTTRLSDNFLDLDLL 80 Query: 83 DEKARYSLNLSRSDEIIL 100 D++AR L + R+DEI++ Sbjct: 81 DQQARDVLGMIRADEIVI 98 >gi|126728749|ref|ZP_01744564.1| hypothetical protein SSE37_07978 [Sagittula stellata E-37] gi|126710679|gb|EBA09730.1| hypothetical protein SSE37_07978 [Sagittula stellata E-37] Length = 87 Score = 34.3 bits (77), Expect = 5.2, Method: Compositional matrix adjust. Identities = 31/88 (35%), Positives = 51/88 (57%), Gaps = 4/88 (4%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 +F + YFT A+ GD+GL +A +E +E+E L+ ++ ++E + + Sbjct: 1 MFFAVTLSLSAYFTFAAVQGDFGLFRRAEIVVEGQKLEQE--LAAVQAEVLQMENLTRRL 58 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SD L+ DLLD++AR L L RSDEI++ Sbjct: 59 SDDFLDLDLLDQQARDVLGLVRSDEIVV 86 >gi|89099080|ref|ZP_01171959.1| cytochrome c biogenesis protein [Bacillus sp. NRRL B-14911] gi|89086210|gb|EAR65332.1| cytochrome c biogenesis protein [Bacillus sp. NRRL B-14911] Length = 551 Score = 34.3 bits (77), Expect = 6.5, Method: Composition-based stats. Identities = 24/76 (31%), Positives = 38/76 (50%), Gaps = 3/76 (3%) Query: 33 VGDYGLKANKSLEK---SLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 V +Y +K N+ L+ +L + + L+EL + L K + G L DL D K Y Sbjct: 319 VKNYSIKVNEPLKFESFALYQVDYKLNELNKMSFSLTNKESGETFGDLTVDLYDPKTEYK 378 Query: 90 LNLSRSDEIILFYSDF 105 LN S E++ ++ DF Sbjct: 379 LNEGYSVEVVSYFPDF 394 >gi|167629668|ref|YP_001680167.1| hypothetical protein HM1_1586 [Heliobacterium modesticaldum Ice1] gi|167592408|gb|ABZ84156.1| conserved domain protein [Heliobacterium modesticaldum Ice1] Length = 639 Score = 33.9 bits (76), Expect = 7.2, Method: Composition-based stats. Identities = 20/55 (36%), Positives = 27/55 (49%), Gaps = 2/55 (3%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDY--GLKANKSLEKSLIERERFLSELKEN 61 N ++F V C V Y + I Y L+ N+ LE+S+ ER R LSE N Sbjct: 309 NMTLTSLFSVALICIVFYVVSRRIADPYRRALELNEELERSVAERTRELSEKNRN 363 >gi|260427253|ref|ZP_05781232.1| septum formation initiator [Citreicella sp. SE45] gi|260421745|gb|EEX14996.1| septum formation initiator [Citreicella sp. SE45] Length = 99 Score = 33.9 bits (76), Expect = 7.4, Method: Compositional matrix adjust. Identities = 32/96 (33%), Positives = 52/96 (54%), Gaps = 4/96 (4%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGL--KANKSLEKSLIERERFLSELKENRSR 64 + F I+ I YF A+ GD+GL +A +E + E L +L+++ +R Sbjct: 5 RNPPFGIVIYAAITLSLSAYFVFAAVQGDFGLFRRAEIEIEGEHLAEE--LVQLEKDVAR 62 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +E +SD L+ DLLD++AR L L R+DEI++ Sbjct: 63 MENLTLRLSDDYLDLDLLDQQARDVLGLMRADEIVV 98 >gi|149184586|ref|ZP_01862904.1| Septum formation initiator [Erythrobacter sp. SD-21] gi|148831906|gb|EDL50339.1| Septum formation initiator [Erythrobacter sp. SD-21] Length = 104 Score = 33.9 bits (76), Expect = 7.4, Method: Compositional matrix adjust. Identities = 18/57 (31%), Positives = 31/57 (54%) Query: 48 LIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 L +RE L L++ R+ L+ KV L+ + D++ E R LN+ DE+++ D Sbjct: 48 LDQREAQLEALQKERAALQNKVALLHPDHADPDMVGELLRSQLNVVHPDEVVIKLED 104 >gi|255721389|ref|XP_002545629.1| transcription initiation factor TFIID subunit 5 [Candida tropicalis MYA-3404] gi|240136118|gb|EER35671.1| transcription initiation factor TFIID subunit 5 [Candida tropicalis MYA-3404] Length = 794 Score = 33.9 bits (76), Expect = 7.6, Method: Composition-based stats. Identities = 19/49 (38%), Positives = 30/49 (61%), Gaps = 4/49 (8%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSD----GSLEKDLLDEK 85 NK L+ L + ER L EL+E ++++ER++K D + EKDL + K Sbjct: 122 NKELKDKLTKSERELKELREKQAKIERELKETKDREVKAAKEKDLKELK 170 >gi|42520224|ref|NP_966139.1| hypothetical protein WD0343 [Wolbachia endosymbiont of Drosophila melanogaster] gi|225630233|ref|YP_002727024.1| hypothetical protein WRi_004450 [Wolbachia sp. wRi] gi|42409962|gb|AAS14073.1| conserved hypothetical protein [Wolbachia endosymbiont of Drosophila melanogaster] gi|225592214|gb|ACN95233.1| hypothetical protein WRi_004450 [Wolbachia sp. wRi] Length = 104 Score = 33.9 bits (76), Expect = 8.1, Method: Compositional matrix adjust. Identities = 22/78 (28%), Positives = 42/78 (53%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 +YF+ I G GL L+K + + L ++ + +L+ KV + + SL+ DLLD Sbjct: 23 TLYFSISTITGKRGLLTLIDLKKEIEYNKLLLKDVSSEKEKLDNKVFGLYEKSLDLDLLD 82 Query: 84 EKARYSLNLSRSDEIILF 101 E+A+ +L +E+++ Sbjct: 83 EQAKNALGYVNPNELMVV 100 >gi|270159826|ref|ZP_06188482.1| cell division protein FtsB [Legionella longbeachae D-4968] gi|289165416|ref|YP_003455554.1| cell division protein ftsB homolog [Legionella longbeachae NSW150] gi|269988165|gb|EEZ94420.1| cell division protein FtsB [Legionella longbeachae D-4968] gi|288858589|emb|CBJ12470.1| putative cell division protein ftsB homolog [Legionella longbeachae NSW150] Length = 89 Score = 33.5 bits (75), Expect = 9.2, Method: Compositional matrix adjust. Identities = 23/93 (24%), Positives = 45/93 (48%), Gaps = 4/93 (4%) Query: 12 FRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKL 71 R +F+++ V+ + +GD L + L+K L E+ ++L LE +K Sbjct: 1 MRPLFIILIVSLVI-LQHKLWLGDGNLIQWRELQKKLAAHEQENNKLATRNRSLEADIKE 59 Query: 72 MSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + +G L+E+ARY L + + +E+ + D Sbjct: 60 LKNGD---QALEEQARYELGMIKENEVYYHFID 89 Searching..................................................done Results from round 2 >gi|86357553|ref|YP_469445.1| putative septum formation initiator protein [Rhizobium etli CFN 42] gi|86281655|gb|ABC90718.1| putative septum formation initiator protein [Rhizobium etli CFN 42] Length = 106 Score = 146 bits (368), Expect = 1e-33, Method: Composition-based stats. Identities = 50/102 (49%), Positives = 69/102 (67%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVAREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIFN 102 >gi|116251996|ref|YP_767834.1| cell division protein [Rhizobium leguminosarum bv. viciae 3841] gi|115256644|emb|CAK07732.1| putative cell division protein [Rhizobium leguminosarum bv. viciae 3841] Length = 106 Score = 145 bits (367), Expect = 2e-33, Method: Composition-based stats. Identities = 50/102 (49%), Positives = 70/102 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ + RE+ L+ LK Sbjct: 1 MWTKHHKKRKIGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVAREKELAVLKT 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIFN 102 >gi|209549201|ref|YP_002281118.1| septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM2304] gi|209534957|gb|ACI54892.1| Septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 106 Score = 145 bits (367), Expect = 2e-33, Method: Composition-based stats. Identities = 49/102 (48%), Positives = 69/102 (67%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKIGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVAREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DE+++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEVVIFN 102 >gi|218461963|ref|ZP_03502054.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli Kim 5] Length = 106 Score = 145 bits (367), Expect = 2e-33, Method: Composition-based stats. Identities = 51/102 (50%), Positives = 71/102 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ +ERE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVEREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIFN 102 >gi|241204523|ref|YP_002975619.1| Septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM1325] gi|240858413|gb|ACS56080.1| Septum formation initiator [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 106 Score = 145 bits (367), Expect = 2e-33, Method: Composition-based stats. Identities = 50/102 (49%), Positives = 69/102 (67%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKIGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVAREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDKDMLDEKARYQLNMSRADEIVVFN 102 >gi|327189240|gb|EGE56419.1| putative cell division protein (septum formation initiator protein) [Rhizobium etli CNPAF512] Length = 106 Score = 145 bits (366), Expect = 2e-33, Method: Composition-based stats. Identities = 49/102 (48%), Positives = 70/102 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H + GDYGL+A ++ E+ + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCVHGDYGLRATETFERQRVAREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIFN 102 >gi|190891626|ref|YP_001978168.1| cell division protein (septum formation initiator protein) [Rhizobium etli CIAT 652] gi|190696905|gb|ACE90990.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli CIAT 652] Length = 106 Score = 144 bits (365), Expect = 3e-33, Method: Composition-based stats. Identities = 50/102 (49%), Positives = 70/102 (68%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVAREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIFN 102 >gi|218660789|ref|ZP_03516719.1| probable cell division protein (septum formation initiator protein) [Rhizobium etli IE4771] Length = 106 Score = 144 bits (365), Expect = 3e-33, Method: Composition-based stats. Identities = 51/102 (50%), Positives = 71/102 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E+ +ERE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFERQRVEREKELAVLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL+KD+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLESQVALLSDGSLDKDMLDEKARYQLNMSRADEIVIFN 102 >gi|218678337|ref|ZP_03526234.1| putative septum formation initiator protein [Rhizobium etli CIAT 894] Length = 106 Score = 143 bits (361), Expect = 9e-33, Method: Composition-based stats. Identities = 49/102 (48%), Positives = 69/102 (67%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK++KK R + + + YF H I GDYGL+A ++ E + RE+ L+ LK Sbjct: 1 MWTKHHKKRKLGRFVIPAMTVAFLSYFGYHCIHGDYGLRATETFEHQRVVREKELAILKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +V L+SDGSL++D+LDEKARY LN+SR+DEI++F Sbjct: 61 KREHLENQVALLSDGSLDRDMLDEKARYQLNMSRADEIVIFN 102 >gi|319898762|ref|YP_004158855.1| hypothetical protein BARCL_0592 [Bartonella clarridgeiae 73] gi|319402726|emb|CBI76273.1| conserved protein of unknown function [Bartonella clarridgeiae 73] Length = 113 Score = 141 bits (355), Expect = 4e-32, Method: Composition-based stats. Identities = 34/104 (32%), Positives = 59/104 (56%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R I +I + YF+ H G YGL + + + +IE + ++K Sbjct: 1 MWTKQKQRSIKTRFILPLITTGVLSYFSYHIYHGKYGLYSRSKINQHIIELKEEFHQVKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +E+++ L+ DG +EKD+LDE R +LN S+ +E+ + S Sbjct: 61 ERISIEKRISLLRDGHIEKDMLDEYVRKNLNFSKPNELTILTSP 104 >gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] gi|254040348|gb|ACT57144.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] Length = 105 Score = 139 bits (352), Expect = 1e-31, Method: Composition-based stats. Identities = 105/105 (100%), Positives = 105/105 (100%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE Sbjct: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF Sbjct: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 >gi|49474126|ref|YP_032168.1| hypothetical protein BQ04900 [Bartonella quintana str. Toulouse] gi|49239630|emb|CAF25989.1| hypothetical protein BQ04900 [Bartonella quintana str. Toulouse] Length = 109 Score = 139 bits (351), Expect = 1e-31, Method: Composition-based stats. Identities = 31/103 (30%), Positives = 59/103 (57%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK ++ R + ++ V YF+ H G YGL + + + ++E E+ L +++ Sbjct: 1 MWTKQKPRSIKVRFVLPLMTVGVVSYFSYHIYHGQYGLYSCNEVNQHIVELEKELHKVEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERMFIEKRIFLLRNGHIEKDMLDEYVRKNLNFSKPNELTILTP 103 >gi|319408348|emb|CBI82001.1| conserved hypothetical protein [Bartonella schoenbuchensis R1] Length = 112 Score = 139 bits (350), Expect = 1e-31, Method: Composition-based stats. Identities = 34/104 (32%), Positives = 58/104 (55%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R I + + YF H GDYGL A + + + E + L +++ Sbjct: 4 MWTKQKRRSITARFILPFMTVGVLSYFGYHIYHGDYGLSARSKIIQHITELKEELYKIEV 63 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +E+++ L+ DG +EKD+LDE R +LN S+ +E+ + S Sbjct: 64 ERMSIEKRISLLRDGHIEKDMLDEYVRKNLNFSKPNELTILISP 107 >gi|319405528|emb|CBI79147.1| conserved hypothetical protein [Bartonella sp. AR 15-3] Length = 113 Score = 139 bits (350), Expect = 2e-31, Method: Composition-based stats. Identities = 35/104 (33%), Positives = 61/104 (58%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R I ++ + YF+ H G YGL + + + +IE + L ++K Sbjct: 1 MWTKQKQRSIKARFILPLVTVGVLSYFSYHIYHGKYGLYSRSKINQHIIELKEELHQIKT 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +E+++ L+ DG +EKD+LDE R +LN S+S+E+ + S Sbjct: 61 ERISIEKRISLLRDGHIEKDMLDEYVRKNLNFSKSNELTILISP 104 >gi|222085875|ref|YP_002544406.1| septum formation initiator protein [Agrobacterium radiobacter K84] gi|221723323|gb|ACM26479.1| septum formation initiator protein [Agrobacterium radiobacter K84] Length = 103 Score = 138 bits (349), Expect = 2e-31, Method: Composition-based stats. Identities = 51/103 (49%), Positives = 67/103 (65%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTKY+KK F R + I V YF H I GDYGLKA + E+ I+R + L++L Sbjct: 1 MWTKYHKKRRFGRFVLPAITIAFVSYFGYHCIHGDYGLKATEVFEQRRIDRGKELADLVA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R LE+ V L+SDGSL+KD+LD+ ARY L SR+DEI++F Sbjct: 61 KREHLEKAVALLSDGSLDKDMLDQYARYQLTYSRADEIVIFNK 103 >gi|240850260|ref|YP_002971653.1| septum formation initiator protein [Bartonella grahamii as4aup] gi|240267383|gb|ACS50971.1| septum formation initiator protein [Bartonella grahamii as4aup] Length = 103 Score = 138 bits (348), Expect = 2e-31, Method: Composition-based stats. Identities = 30/103 (29%), Positives = 60/103 (58%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R + ++ + YF+ H G+YGL + + + + E E+ L +++ Sbjct: 1 MWTKQKRRSIKVRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVNQHISELEKELHKIEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERIFMEKRISLLRNGHIEKDMLDEYVRKNLNFSKPNELTILIP 103 >gi|260459503|ref|ZP_05807758.1| Septum formation initiator [Mesorhizobium opportunistum WSM2075] gi|259035057|gb|EEW36313.1| Septum formation initiator [Mesorhizobium opportunistum WSM2075] Length = 107 Score = 136 bits (344), Expect = 8e-31, Method: Composition-based stats. Identities = 41/103 (39%), Positives = 62/103 (60%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+ +K+ + R I + + YF HA G++G+ + LE + + L +K Sbjct: 1 MWTRQHKQRNTGRLIIPSLCVVFLAYFGFHAYHGEFGINSKYQLETQTVALQAQLDAVKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R LER+V+LM DG+LEKD+LDE+AR +LNLS+ DEI + Sbjct: 61 RRMELERRVRLMHDGTLEKDMLDEQARKALNLSQPDEITIMLP 103 >gi|222148555|ref|YP_002549512.1| hypothetical protein Avi_2110 [Agrobacterium vitis S4] gi|221735541|gb|ACM36504.1| conserved hypothetical protein [Agrobacterium vitis S4] Length = 103 Score = 136 bits (343), Expect = 1e-30, Method: Composition-based stats. Identities = 48/102 (47%), Positives = 69/102 (67%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++K F R + + + YF H+I GDYGLKA + + ER + L+ L Sbjct: 1 MWTRHHKNRKFGRLVLPAVTIAFIGYFGYHSIHGDYGLKAGEHFDVVRAERSKELAALIH 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 +R +LE +VKL+SDGSLE+D++DEKARY LN+SR DEI++F Sbjct: 61 DRKKLETQVKLLSDGSLERDMIDEKARYQLNMSRPDEIVIFN 102 >gi|163868057|ref|YP_001609261.1| hypothetical protein Btr_0860 [Bartonella tribocorum CIP 105476] gi|161017708|emb|CAK01266.1| conserved hypothetical protein [Bartonella tribocorum CIP 105476] Length = 103 Score = 136 bits (343), Expect = 1e-30, Method: Composition-based stats. Identities = 30/103 (29%), Positives = 60/103 (58%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R + ++ + YF+ H G+YGL + + + + E E+ L +++ Sbjct: 1 MWTKQKRRSIKVRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVNQYISELEKELHKIEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERKFIEKRISLLRNGHIEKDMLDEYVRKNLNFSKPNELTILMP 103 >gi|121602813|ref|YP_988848.1| septum formation initiator family protein [Bartonella bacilliformis KC583] gi|120614990|gb|ABM45591.1| septum formation initiator family protein [Bartonella bacilliformis KC583] Length = 109 Score = 135 bits (341), Expect = 2e-30, Method: Composition-based stats. Identities = 34/104 (32%), Positives = 60/104 (57%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ I V+ V YF+ H G+YGL+A + + + E + L +++ Sbjct: 1 MWTKQKRRSIKTHFILPVMTVWVVSYFSYHIYHGEYGLRARGEINQHIFELKEELHQIEV 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+ +E ++ L+ +G +EKD+LDE R +LN SR +E+ + S Sbjct: 61 ERTSIENRISLLREGHIEKDMLDEYVRENLNFSRPNELTILVSP 104 >gi|23502008|ref|NP_698135.1| hypothetical protein BR1130 [Brucella suis 1330] gi|62290043|ref|YP_221836.1| hypothetical protein BruAb1_1136 [Brucella abortus bv. 1 str. 9-941] gi|82699970|ref|YP_414544.1| septum formation initiator [Brucella melitensis biovar Abortus 2308] gi|148559039|ref|YP_001259051.1| hypothetical protein BOV_1088 [Brucella ovis ATCC 25840] gi|161619082|ref|YP_001592969.1| septum formation initiator [Brucella canis ATCC 23365] gi|163843397|ref|YP_001627801.1| septum formation initiator [Brucella suis ATCC 23445] gi|189024284|ref|YP_001935052.1| Septum formation initiator [Brucella abortus S19] gi|225627600|ref|ZP_03785637.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225852630|ref|YP_002732863.1| septum formation initiator [Brucella melitensis ATCC 23457] gi|237815553|ref|ZP_04594550.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|254689356|ref|ZP_05152610.1| Septum formation initiator [Brucella abortus bv. 6 str. 870] gi|254693840|ref|ZP_05155668.1| Septum formation initiator [Brucella abortus bv. 3 str. Tulya] gi|254697489|ref|ZP_05159317.1| Septum formation initiator [Brucella abortus bv. 2 str. 86/8/59] gi|254701873|ref|ZP_05163701.1| Septum formation initiator [Brucella suis bv. 5 str. 513] gi|254704419|ref|ZP_05166247.1| Septum formation initiator [Brucella suis bv. 3 str. 686] gi|254706685|ref|ZP_05168513.1| Septum formation initiator [Brucella pinnipedialis M163/99/10] gi|254710207|ref|ZP_05172018.1| Septum formation initiator [Brucella pinnipedialis B2/94] gi|254714204|ref|ZP_05176015.1| Septum formation initiator [Brucella ceti M644/93/1] gi|254717639|ref|ZP_05179450.1| Septum formation initiator [Brucella ceti M13/05/1] gi|254730386|ref|ZP_05188964.1| Septum formation initiator [Brucella abortus bv. 4 str. 292] gi|256031701|ref|ZP_05445315.1| Septum formation initiator [Brucella pinnipedialis M292/94/1] gi|256061213|ref|ZP_05451365.1| Septum formation initiator [Brucella neotomae 5K33] gi|256113686|ref|ZP_05454497.1| Septum formation initiator [Brucella melitensis bv. 3 str. Ether] gi|256159856|ref|ZP_05457589.1| Septum formation initiator [Brucella ceti M490/95/1] gi|256255102|ref|ZP_05460638.1| Septum formation initiator [Brucella ceti B1/94] gi|256257602|ref|ZP_05463138.1| Septum formation initiator [Brucella abortus bv. 9 str. C68] gi|256263877|ref|ZP_05466409.1| septum formation initiator [Brucella melitensis bv. 2 str. 63/9] gi|256369556|ref|YP_003107066.1| septum formation initiator [Brucella microti CCM 4915] gi|260168833|ref|ZP_05755644.1| septum formation initiator [Brucella sp. F5/99] gi|260546596|ref|ZP_05822335.1| septum formation initiator [Brucella abortus NCTC 8038] gi|260566334|ref|ZP_05836804.1| septum formation initiator [Brucella suis bv. 4 str. 40] gi|260754873|ref|ZP_05867221.1| septum formation initiator [Brucella abortus bv. 6 str. 870] gi|260758090|ref|ZP_05870438.1| septum formation initiator [Brucella abortus bv. 4 str. 292] gi|260761914|ref|ZP_05874257.1| septum formation initiator [Brucella abortus bv. 2 str. 86/8/59] gi|260883885|ref|ZP_05895499.1| septum formation initiator [Brucella abortus bv. 9 str. C68] gi|261214124|ref|ZP_05928405.1| septum formation initiator [Brucella abortus bv. 3 str. Tulya] gi|261219478|ref|ZP_05933759.1| septum formation initiator [Brucella ceti M13/05/1] gi|261222297|ref|ZP_05936578.1| septum formation initiator [Brucella ceti B1/94] gi|261314146|ref|ZP_05953343.1| septum formation initiator [Brucella pinnipedialis M163/99/10] gi|261317765|ref|ZP_05956962.1| septum formation initiator [Brucella pinnipedialis B2/94] gi|261321974|ref|ZP_05961171.1| septum formation initiator [Brucella ceti M644/93/1] gi|261325221|ref|ZP_05964418.1| septum formation initiator [Brucella neotomae 5K33] gi|261752436|ref|ZP_05996145.1| septum formation initiator [Brucella suis bv. 5 str. 513] gi|261755096|ref|ZP_05998805.1| septum formation initiator [Brucella suis bv. 3 str. 686] gi|261758321|ref|ZP_06002030.1| septum formation initiator [Brucella sp. F5/99] gi|265988796|ref|ZP_06101353.1| septum formation initiator [Brucella pinnipedialis M292/94/1] gi|265995047|ref|ZP_06107604.1| septum formation initiator [Brucella melitensis bv. 3 str. Ether] gi|265998261|ref|ZP_06110818.1| septum formation initiator [Brucella ceti M490/95/1] gi|294852468|ref|ZP_06793141.1| septum formation initiator [Brucella sp. NVSL 07-0026] gi|297248444|ref|ZP_06932162.1| septum formation initiator [Brucella abortus bv. 5 str. B3196] gi|306841856|ref|ZP_07474538.1| septum formation initiator [Brucella sp. BO2] gi|306843995|ref|ZP_07476590.1| septum formation initiator [Brucella sp. BO1] gi|23347960|gb|AAN30050.1| conserved hypothetical protein [Brucella suis 1330] gi|62196175|gb|AAX74475.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] gi|82616071|emb|CAJ11109.1| Septum formation initiator [Brucella melitensis biovar Abortus 2308] gi|148370296|gb|ABQ60275.1| conserved hypothetical protein [Brucella ovis ATCC 25840] gi|161335893|gb|ABX62198.1| Septum formation initiator [Brucella canis ATCC 23365] gi|163674120|gb|ABY38231.1| Septum formation initiator [Brucella suis ATCC 23445] gi|189019856|gb|ACD72578.1| Septum formation initiator [Brucella abortus S19] gi|225617605|gb|EEH14650.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] gi|225640995|gb|ACO00909.1| Septum formation initiator [Brucella melitensis ATCC 23457] gi|237788851|gb|EEP63062.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] gi|255999718|gb|ACU48117.1| septum formation initiator [Brucella microti CCM 4915] gi|260095646|gb|EEW79523.1| septum formation initiator [Brucella abortus NCTC 8038] gi|260155852|gb|EEW90932.1| septum formation initiator [Brucella suis bv. 4 str. 40] gi|260668408|gb|EEX55348.1| septum formation initiator [Brucella abortus bv. 4 str. 292] gi|260672346|gb|EEX59167.1| septum formation initiator [Brucella abortus bv. 2 str. 86/8/59] gi|260674981|gb|EEX61802.1| septum formation initiator [Brucella abortus bv. 6 str. 870] gi|260873413|gb|EEX80482.1| septum formation initiator [Brucella abortus bv. 9 str. C68] gi|260915731|gb|EEX82592.1| septum formation initiator [Brucella abortus bv. 3 str. Tulya] gi|260920881|gb|EEX87534.1| septum formation initiator [Brucella ceti B1/94] gi|260924567|gb|EEX91135.1| septum formation initiator [Brucella ceti M13/05/1] gi|261294664|gb|EEX98160.1| septum formation initiator [Brucella ceti M644/93/1] gi|261296988|gb|EEY00485.1| septum formation initiator [Brucella pinnipedialis B2/94] gi|261301201|gb|EEY04698.1| septum formation initiator [Brucella neotomae 5K33] gi|261303172|gb|EEY06669.1| septum formation initiator [Brucella pinnipedialis M163/99/10] gi|261738305|gb|EEY26301.1| septum formation initiator [Brucella sp. F5/99] gi|261742189|gb|EEY30115.1| septum formation initiator [Brucella suis bv. 5 str. 513] gi|261744849|gb|EEY32775.1| septum formation initiator [Brucella suis bv. 3 str. 686] gi|262552729|gb|EEZ08719.1| septum formation initiator [Brucella ceti M490/95/1] gi|262766160|gb|EEZ11949.1| septum formation initiator [Brucella melitensis bv. 3 str. Ether] gi|263094008|gb|EEZ17942.1| septum formation initiator [Brucella melitensis bv. 2 str. 63/9] gi|264660993|gb|EEZ31254.1| septum formation initiator [Brucella pinnipedialis M292/94/1] gi|294821057|gb|EFG38056.1| septum formation initiator [Brucella sp. NVSL 07-0026] gi|297175613|gb|EFH34960.1| septum formation initiator [Brucella abortus bv. 5 str. B3196] gi|306275750|gb|EFM57474.1| septum formation initiator [Brucella sp. BO1] gi|306288083|gb|EFM59480.1| septum formation initiator [Brucella sp. BO2] gi|326409149|gb|ADZ66214.1| Septum formation initiator [Brucella melitensis M28] gi|326538857|gb|ADZ87072.1| Septum formation initiator [Brucella melitensis M5-90] Length = 109 Score = 134 bits (339), Expect = 3e-30, Method: Composition-based stats. Identities = 43/103 (41%), Positives = 62/103 (60%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +K+ R I V+ + YF HA G+YGL A LE+ L+++ Sbjct: 1 MWTKQKRKSIRGRFILPVLTAAFLSYFGFHAYHGEYGLYARIQLEEQKSLLNAQLAKISA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 61 DRIALEKRVALLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|254719194|ref|ZP_05181005.1| Septum formation initiator [Brucella sp. 83/13] gi|265984191|ref|ZP_06096926.1| septum formation initiator [Brucella sp. 83/13] gi|306838187|ref|ZP_07471043.1| septum formation initiator [Brucella sp. NF 2653] gi|264662783|gb|EEZ33044.1| septum formation initiator [Brucella sp. 83/13] gi|306406777|gb|EFM63000.1| septum formation initiator [Brucella sp. NF 2653] Length = 109 Score = 134 bits (338), Expect = 4e-30, Method: Composition-based stats. Identities = 43/103 (41%), Positives = 62/103 (60%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +K+ R I V+ + YF HA G+YGL A LE+ L+++ Sbjct: 1 MWTKQKRKSIRGRFILPVLTAVFLSYFGFHAYHGEYGLYARIQLEEQKSLLNAQLAKISA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 61 DRIALEKRVALLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|227821845|ref|YP_002825815.1| hypothetical protein NGR_c12810 [Sinorhizobium fredii NGR234] gi|227340844|gb|ACP25062.1| hypothetical protein NGR_c12810 [Sinorhizobium fredii NGR234] Length = 106 Score = 133 bits (336), Expect = 7e-30, Method: Composition-based stats. Identities = 51/104 (49%), Positives = 74/104 (71%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK R + VIA + YF H+I G YGL+A + ++ + ER+ L EL + Sbjct: 1 MWTRHHKKRRLGRLVVPVIAVAFLSYFGYHSIHGGYGLRATEEFDRQIAERQARLDELTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R LE++V+LMSDGSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 61 KRQILEKEVELMSDGSLERDMLDEKARLALNMSRSDEIVIFHRP 104 >gi|17987136|ref|NP_539770.1| hypothetical protein BMEI0853 [Brucella melitensis bv. 1 str. 16M] gi|256044787|ref|ZP_05447691.1| hypothetical protein Bmelb1R_09859 [Brucella melitensis bv. 1 str. Rev.1] gi|260565610|ref|ZP_05836094.1| septum formation initiator [Brucella melitensis bv. 1 str. 16M] gi|265991211|ref|ZP_06103768.1| septum formation initiator [Brucella melitensis bv. 1 str. Rev.1] gi|17982800|gb|AAL52034.1| hypothetical protein BMEI0853 [Brucella melitensis bv. 1 str. 16M] gi|260151678|gb|EEW86772.1| septum formation initiator [Brucella melitensis bv. 1 str. 16M] gi|263001995|gb|EEZ14570.1| septum formation initiator [Brucella melitensis bv. 1 str. Rev.1] Length = 109 Score = 133 bits (336), Expect = 7e-30, Method: Composition-based stats. Identities = 43/103 (41%), Positives = 61/103 (59%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +K+ R I V+ + YF HA G+YGL A LE+ L+++ Sbjct: 1 MWTKQKRKSIRGRFILPVLTAAFLSYFGFHAYHGEYGLYARIQLEEQKSLLNAQLAKISA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R LE+ V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 61 DRIALEKGVALLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|153009388|ref|YP_001370603.1| septum formation initiator [Ochrobactrum anthropi ATCC 49188] gi|151561276|gb|ABS14774.1| Septum formation initiator [Ochrobactrum anthropi ATCC 49188] Length = 109 Score = 132 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 40/103 (38%), Positives = 63/103 (61%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +K+ R + ++ + YF HA G+YGL + LE+ + L ++ Sbjct: 1 MWTKQKRKSIRGRFVLPILTAAFLSYFGFHAYHGEYGLYSRIQLEEQKSLLAKQLEQVTA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R+ LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 61 DRNALEKRVTLLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|319783387|ref|YP_004142863.1| septum formation initiator [Mesorhizobium ciceri biovar biserrulae WSM1271] gi|317169275|gb|ADV12813.1| Septum formation initiator [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 107 Score = 132 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 40/103 (38%), Positives = 63/103 (61%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+ +K+ + R I + + YF HA G++G+ + LE + + L +K Sbjct: 1 MWTRQHKQRNTGRLIIPSLCVAFLAYFGFHAYHGEFGIYSKYQLEAQTVALQGQLDAIKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R LER+V+LM +G+LEKD+LDE+AR +LNLS++DEI + Sbjct: 61 RRMELERRVRLMHEGTLEKDMLDEQARKALNLSQADEITIMLP 103 >gi|325292759|ref|YP_004278623.1| Septum formation initiator [Agrobacterium sp. H13-3] gi|325060612|gb|ADY64303.1| Septum formation initiator [Agrobacterium sp. H13-3] Length = 105 Score = 132 bits (334), Expect = 1e-29, Method: Composition-based stats. Identities = 49/105 (46%), Positives = 73/105 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK F R I I + YF H+I GD+GL+A + LE+ I R L++L + Sbjct: 1 MWTRHHKKRRFGRLIVPAITIAFLSYFGYHSIHGDFGLQATERLERQRIARTAELAKLTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 R LER+V+L+SDGSLE+D++DE +RY LN+SR+DEI++ + F Sbjct: 61 ARVALERQVELLSDGSLERDMIDEISRYQLNMSRTDEIVIMNTYF 105 >gi|307309211|ref|ZP_07588882.1| Septum formation initiator [Sinorhizobium meliloti BL225C] gi|307321954|ref|ZP_07601335.1| Septum formation initiator [Sinorhizobium meliloti AK83] gi|306892378|gb|EFN23183.1| Septum formation initiator [Sinorhizobium meliloti AK83] gi|306900357|gb|EFN30973.1| Septum formation initiator [Sinorhizobium meliloti BL225C] Length = 106 Score = 132 bits (332), Expect = 2e-29, Method: Composition-based stats. Identities = 50/104 (48%), Positives = 74/104 (71%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK R + ++A + YF H+I G YGL+A K ++ + ER+ L EL + Sbjct: 1 MWTRHHKKRRLGRLVVPLLAVAFLSYFGYHSIHGGYGLEATKEFDRQIAERQARLDELTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R LE++V+LMSDGSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 61 TRKILEKEVELMSDGSLERDMLDEKARLALNMSRSDEIVIFHHP 104 >gi|239832019|ref|ZP_04680348.1| septum formation initiator [Ochrobactrum intermedium LMG 3301] gi|239824286|gb|EEQ95854.1| septum formation initiator [Ochrobactrum intermedium LMG 3301] Length = 109 Score = 132 bits (332), Expect = 2e-29, Method: Composition-based stats. Identities = 40/103 (38%), Positives = 63/103 (61%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +K+ R + ++ + YF HA G++GL + LE+ + L ++ Sbjct: 1 MWTKQKRKSIRGRFVLPILTAAFLSYFGFHAYHGEFGLYSRIQLEEQKSLLAKQLEQVTA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +RS LE++V L+ DGS+EKD+LDE+AR +LNLS DE+ + S Sbjct: 61 DRSALEKRVTLLRDGSIEKDMLDEQARRALNLSHPDEVTIITS 103 >gi|13470618|ref|NP_102187.1| hypothetical protein mlr0382 [Mesorhizobium loti MAFF303099] gi|14021360|dbj|BAB47973.1| mlr0382 [Mesorhizobium loti MAFF303099] Length = 120 Score = 131 bits (331), Expect = 2e-29, Method: Composition-based stats. Identities = 41/103 (39%), Positives = 63/103 (61%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+ +K+ + R I + + YF HA G++G+ + LE + + L +K Sbjct: 14 MWTRQHKQRNTGRLIIPSLCVVFLAYFGFHAYHGEFGINSKYQLEAQTVALQAQLDAIKA 73 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R LER+V+LM DG+LEKD+LDE+AR +LNLS++DEI + Sbjct: 74 RRMELERRVRLMHDGTLEKDMLDEQARRALNLSQADEITIMLP 116 >gi|159184756|ref|NP_354434.2| hypothetical protein Atu1428 [Agrobacterium tumefaciens str. C58] gi|159140044|gb|AAK87219.2| conserved hypothetical protein [Agrobacterium tumefaciens str. C58] Length = 105 Score = 131 bits (331), Expect = 3e-29, Method: Composition-based stats. Identities = 48/105 (45%), Positives = 73/105 (69%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK F R I I + YF H+I GD+GL+A + LE+ + R L++L + Sbjct: 1 MWTRHHKKRRFGRLIVPAITIAFLSYFGYHSIHGDFGLQATERLERQRLTRTAELAKLTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 R LER+V+L+SDGSLE+D++DE +RY LN+SR+DEI++ + F Sbjct: 61 ARVALERQVELLSDGSLERDMIDEISRYQLNMSRTDEIVIMNTYF 105 >gi|150396295|ref|YP_001326762.1| septum formation initiator [Sinorhizobium medicae WSM419] gi|150027810|gb|ABR59927.1| Septum formation initiator [Sinorhizobium medicae WSM419] Length = 106 Score = 131 bits (329), Expect = 4e-29, Method: Composition-based stats. Identities = 48/104 (46%), Positives = 73/104 (70%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++KK R + ++A + YF H+I G YGL+A K ++ + R+ L +L + Sbjct: 1 MWTRHHKKRRLGRLVVPLLAVAFLSYFGYHSIHGGYGLEATKEFDRQIAGRQARLEDLTQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R LE++V+LMSDGSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 61 QRKTLEKEVELMSDGSLERDMLDEKARLALNMSRSDEIVIFHHP 104 >gi|110633983|ref|YP_674191.1| septum formation initiator [Mesorhizobium sp. BNC1] gi|110284967|gb|ABG63026.1| Septum formation initiator [Chelativorans sp. BNC1] Length = 105 Score = 127 bits (319), Expect = 6e-28, Method: Composition-based stats. Identities = 40/102 (39%), Positives = 64/102 (62%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT+++K+ + R I + + YF HA G+YGL A LE+ + E L L++ Sbjct: 1 MWTRHHKRRNTGRLIVPAVTALVLSYFGFHAYQGEYGLNAKAQLEQRVASLEAELEALRK 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R +LE + L+S +E+D+LDE+AR +LNLS+ +EI++FY Sbjct: 61 ARGKLEERAGLLSGDMIEQDMLDEQARRALNLSKENEIVIFY 102 >gi|49475367|ref|YP_033408.1| hypothetical protein BH05740 [Bartonella henselae str. Houston-1] gi|49238173|emb|CAF27382.1| hypothetical protein BH05740 [Bartonella henselae str. Houston-1] Length = 109 Score = 122 bits (306), Expect = 2e-26, Method: Composition-based stats. Identities = 31/103 (30%), Positives = 60/103 (58%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWTK +++ R + ++ + YF+ H G+YGL + + + ++E E L +L+ Sbjct: 1 MWTKQKRRSIKMRFVLPLMTVGVLSYFSYHIYHGEYGLYSRSEVNQYIVELEEELQKLEA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R +E+++ L+ +G +EKD+LDE R +LN S+ +E+ + Sbjct: 61 ERIFIEKRISLLRNGHIEKDMLDEYVRRNLNFSKPNELTILTP 103 >gi|315122218|ref|YP_004062707.1| putative cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] gi|313495620|gb|ADR52219.1| putative cell division protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 120 Score = 121 bits (305), Expect = 3e-26, Method: Composition-based stats. Identities = 81/105 (77%), Positives = 90/105 (85%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 MWT++YKK FFR +F VIAF V+YF NHAI D GL+ KSLEKSLIERERFL EL+E Sbjct: 16 MWTRHYKKGKFFRIVFRVIAFFSVIYFINHAIKDDCGLEETKSLEKSLIERERFLFELQE 75 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 RS+LERKVKLMSDGSLEKDLLDEKARY+LNLSRSDEIILFY +F Sbjct: 76 VRSKLERKVKLMSDGSLEKDLLDEKARYNLNLSRSDEIILFYPNF 120 >gi|92117294|ref|YP_577023.1| septum formation initiator [Nitrobacter hamburgensis X14] gi|91800188|gb|ABE62563.1| Septum formation initiator [Nitrobacter hamburgensis X14] Length = 105 Score = 118 bits (297), Expect = 2e-25, Method: Composition-based stats. Identities = 27/104 (25%), Positives = 51/104 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K+ +A V YF +A G YGL A + L++ ++ L+ LK Sbjct: 1 MVSRSRLKSVLTGLALYAMAAMVVGYFGVNAYTGKYGLNARQELDQEIVALTSELARLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+ E++V L+ ++ D+LDE+ RY L+ + +++ Sbjct: 61 ERAEGEKRVALLRSSGIDPDMLDERVRYQLDYANPRDLVHIIPQ 104 >gi|328543940|ref|YP_004304049.1| Septum formation initiator [polymorphum gilvum SL003B-26A1] gi|326413684|gb|ADZ70747.1| Septum formation initiator [Polymorphum gilvum SL003B-26A1] Length = 111 Score = 118 bits (297), Expect = 2e-25, Method: Composition-based stats. Identities = 31/103 (30%), Positives = 54/103 (52%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T+ KK+ R + A + YF HA+ G++GL +E + + E L+ + R Sbjct: 5 TRQRKKSVLRRLVIPFAALAVLGYFGFHALNGEFGLVGRARIEHQVRDLEAELAVVVTER 64 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 L +V L+ SL+ D++DE+AR +LNL +DE+ + + Sbjct: 65 EELFARVSLLRPESLDPDMIDERARLNLNLVHADEVAILRPGY 107 >gi|307942229|ref|ZP_07657580.1| septum formation initiator [Roseibium sp. TrichSKD4] gi|307774515|gb|EFO33725.1| septum formation initiator [Roseibium sp. TrichSKD4] Length = 114 Score = 115 bits (289), Expect = 2e-24, Method: Composition-based stats. Identities = 30/102 (29%), Positives = 51/102 (50%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKEN 61 T+ K++ + +A + YF HA+ G+ GL +E+ + + L +L E Sbjct: 4 QTRQRKQSFLRHLVVPTLALSALAYFGFHALNGELGLVGRAKIERDVERLQAELDKLVEE 63 Query: 62 RSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R L +V L+ SL+ D+LDE AR +LNL ++I+ Sbjct: 64 RQYLVSRVSLLRPESLDPDMLDESARRNLNLVHPKDLIILRP 105 >gi|27379897|ref|NP_771426.1| hypothetical protein bll4786 [Bradyrhizobium japonicum USDA 110] gi|27353050|dbj|BAC50051.1| bll4786 [Bradyrhizobium japonicum USDA 110] Length = 105 Score = 115 bits (288), Expect = 2e-24, Method: Composition-based stats. Identities = 29/104 (27%), Positives = 53/104 (50%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K+ +A V YF +A G YGL A + L++ +I L++LK Sbjct: 1 MVSRARLKSILTGLALYAMAAAIVGYFGVNAYTGKYGLNARQELDQEIIALTSELAQLKR 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+R E++V L+ ++ D+LDE+AR+ L+ +++ Sbjct: 61 ERARSEQRVSLLRSARIDPDMLDERARFQLDYVNPRDLVRMIPP 104 >gi|316933972|ref|YP_004108954.1| Septum formation initiator [Rhodopseudomonas palustris DX-1] gi|315601686|gb|ADU44221.1| Septum formation initiator [Rhodopseudomonas palustris DX-1] Length = 105 Score = 115 bits (288), Expect = 2e-24, Method: Composition-based stats. Identities = 27/103 (26%), Positives = 51/103 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ K+ IA + YF +A G YGL A + L++ + L +L++ Sbjct: 1 MVTRSRLKSILAGIALYAIAAAVIGYFGVNAYTGRYGLTAQQELDQEITALTAELVQLRQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R+ E++V L+ ++ D+LDE+ RY L+ + +++ Sbjct: 61 QRAEAEQRVSLLRSDRIDPDMLDERVRYQLDFANPADLVRMMP 103 >gi|39935933|ref|NP_948209.1| septum formation initiator [Rhodopseudomonas palustris CGA009] gi|192291583|ref|YP_001992188.1| Septum formation initiator [Rhodopseudomonas palustris TIE-1] gi|39649787|emb|CAE28309.1| Septum formation initiator [Rhodopseudomonas palustris CGA009] gi|192285332|gb|ACF01713.1| Septum formation initiator [Rhodopseudomonas palustris TIE-1] Length = 105 Score = 114 bits (287), Expect = 3e-24, Method: Composition-based stats. Identities = 27/104 (25%), Positives = 51/104 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ K+ IA + YF +A G YGL A + L++ + L +L++ Sbjct: 1 MVTRSRLKSILAGIALYAIAAAVIGYFGVNAYTGRYGLTAQQELDQEITALTAELVQLRQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+ E++V L+ ++ D+LDE+ RY L+ + +++ Sbjct: 61 QRAEAEQRVSLLRSDRIDPDMLDERVRYQLDFANPADLVRMLPQ 104 >gi|158423364|ref|YP_001524656.1| putative septum formation initiator [Azorhizobium caulinodans ORS 571] gi|158330253|dbj|BAF87738.1| putative septum formation initiator [Azorhizobium caulinodans ORS 571] Length = 107 Score = 114 bits (287), Expect = 4e-24, Method: Composition-based stats. Identities = 35/104 (33%), Positives = 57/104 (54%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ + FF + V+A + YF HA GD+GL A ++ E+ ++ E L+ LK Sbjct: 1 MQTRSRIRAFFFALLLYVVAGGVIGYFAYHAYNGDHGLMAKRNYEQDVVRLETELAALKS 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R LE KV L+ S++ DLLDE+ R L+ + +++L + Sbjct: 61 QRQALEHKVSLLDPRSIDPDLLDEEGRKQLDFINAKDLVLIKGE 104 >gi|146341017|ref|YP_001206065.1| hypothetical protein BRADO4088 [Bradyrhizobium sp. ORS278] gi|146193823|emb|CAL77840.1| conserved hypothetical protein; putative signal peptide; putative Septum formation initiator domain [Bradyrhizobium sp. ORS278] Length = 104 Score = 114 bits (286), Expect = 5e-24, Method: Composition-based stats. Identities = 27/104 (25%), Positives = 51/104 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K+ +A + YF +A G YGL A + L++ ++ L LK+ Sbjct: 1 MVSRARLKSFLTGLALYTMAAAIIGYFGINAYTGRYGLNARQELDQEIVALTSELVRLKQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+ E++V L+ ++ D+LDE+AR+ L + ++I Sbjct: 61 ERAEGEKRVSLLRSDRVDPDMLDERARFQLGYANPHDLIRINRP 104 >gi|90423988|ref|YP_532358.1| septum formation initiator [Rhodopseudomonas palustris BisB18] gi|90106002|gb|ABD88039.1| Septum formation initiator [Rhodopseudomonas palustris BisB18] Length = 105 Score = 114 bits (286), Expect = 5e-24, Method: Composition-based stats. Identities = 29/103 (28%), Positives = 51/103 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K+ IA V YF +A G YGL A + L++ +I L LK+ Sbjct: 1 MVSRTRLKSLLTGVALYAIAAAMVGYFGTNAYTGKYGLNARQELDQEIIALTSELQRLKQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R+ E++V L+ ++ D+LDE+ RY L+ + +++ Sbjct: 61 ERAAGEQRVSLLRSDRVDPDMLDERVRYQLDYAHPADLVRMLP 103 >gi|163760090|ref|ZP_02167173.1| putative cell division protein [Hoeflea phototrophica DFL-43] gi|162282489|gb|EDQ32777.1| putative cell division protein [Hoeflea phototrophica DFL-43] Length = 102 Score = 113 bits (284), Expect = 7e-24, Method: Composition-based stats. Identities = 42/102 (41%), Positives = 63/102 (61%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T++ ++ + + V++ C VYF H+ GD+GL A +LE+ +E L+ L E Sbjct: 1 MRTQFRRQQSWGLWVIPVLSIGCFVYFGFHSWHGDFGLNATAALEQRRVELTERLATLTE 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 R LE +VKL+SDG +E D LDE+AR LN++R DEI+ F Sbjct: 61 RRQHLETRVKLLSDGIVEADALDERARLMLNVAREDEIVYFN 102 >gi|319404086|emb|CBI77674.1| conserved hypothetical protein [Bartonella rochalimae ATCC BAA-1498] Length = 93 Score = 113 bits (284), Expect = 7e-24, Method: Composition-based stats. Identities = 28/83 (33%), Positives = 49/83 (59%) Query: 22 CCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDL 81 + YF+ H G YGL + + + +IE + L ++K R +E+++ L+ DG +EKD+ Sbjct: 2 GVLGYFSYHIYHGKYGLYSRSKINQHIIELQEELHQVKAERISIEKRISLLRDGHIEKDM 61 Query: 82 LDEKARYSLNLSRSDEIILFYSD 104 LDE R +LN S+ +E+ + S Sbjct: 62 LDEYVRKNLNFSKPNELTILISP 84 >gi|148255822|ref|YP_001240407.1| septum formation initiator domain-containing protein [Bradyrhizobium sp. BTAi1] gi|146407995|gb|ABQ36501.1| putative exported protein of unknown function with septum formation initiator domain [Bradyrhizobium sp. BTAi1] Length = 104 Score = 113 bits (283), Expect = 1e-23, Method: Composition-based stats. Identities = 29/104 (27%), Positives = 51/104 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K+ +A + YF +A G YGL A + L++ +I L LK+ Sbjct: 1 MVSRARLKSFLTGLALYTMAAAIIGYFGINAYTGRYGLTARQELDQEIISLTSELVRLKQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+ ER+V L+ ++ D+LDE+AR+ L + ++I Sbjct: 61 ERAEGERRVSLLRSDRVDPDMLDERARFQLGYANPHDLIRINRP 104 >gi|85716523|ref|ZP_01047494.1| septum formation initiator [Nitrobacter sp. Nb-311A] gi|85696712|gb|EAQ34599.1| septum formation initiator [Nitrobacter sp. Nb-311A] Length = 125 Score = 113 bits (283), Expect = 1e-23, Method: Composition-based stats. Identities = 28/99 (28%), Positives = 49/99 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ + +A V YF +A G YGL A + L++ +I L+ LK Sbjct: 21 MVSRSRLISLLTGLALYTMAAMIVGYFGVNAYTGKYGLNARQELDQEIIALTSELARLKA 80 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R+ E++V L+ ++ D+LDE+ RY L + ++I Sbjct: 81 ERAEGEKRVALLRSSGIDPDMLDERVRYQLGYANPRDLI 119 >gi|319407098|emb|CBI80735.1| conserved hypothetical protein [Bartonella sp. 1-1C] Length = 93 Score = 112 bits (282), Expect = 1e-23, Method: Composition-based stats. Identities = 28/83 (33%), Positives = 49/83 (59%) Query: 22 CCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDL 81 + YF+ H G YGL + + + +IE + L ++K R +E+++ L+ DG +EKD+ Sbjct: 2 GVLGYFSYHIYHGKYGLYSRSKINQHIIELKEELHQVKAERISIEKRISLLRDGHIEKDM 61 Query: 82 LDEKARYSLNLSRSDEIILFYSD 104 LDE R +LN S+ +E+ + S Sbjct: 62 LDEHVRKNLNFSKPNELTILISP 84 >gi|15965197|ref|NP_385550.1| hypothetical protein SMc01029 [Sinorhizobium meliloti 1021] gi|15074377|emb|CAC46023.1| Conserved hypothetical protein [Sinorhizobium meliloti 1021] Length = 93 Score = 111 bits (278), Expect = 3e-23, Method: Composition-based stats. Identities = 44/90 (48%), Positives = 65/90 (72%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + ++A + YF H+I G YGL+A K ++ + ER+ L EL + R LE++V+LMSD Sbjct: 2 VVPLLAVAFLSYFGYHSIHGGYGLEATKEFDRQIAERQARLDELTQTRKILEKEVELMSD 61 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 GSLE+D+LDEKAR +LN+SRSDEI++F+ Sbjct: 62 GSLERDMLDEKARLALNMSRSDEIVIFHHP 91 >gi|118589908|ref|ZP_01547312.1| Septum formation initiator [Stappia aggregata IAM 12614] gi|118437405|gb|EAV44042.1| Septum formation initiator [Stappia aggregata IAM 12614] Length = 97 Score = 111 bits (278), Expect = 4e-23, Method: Composition-based stats. Identities = 32/89 (35%), Positives = 48/89 (53%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I IA + YF HA+ G+ G+ +E+ + E E L+ L R L KV L+ Sbjct: 2 ITPAIAIAALGYFGFHAMSGELGMVGRAMIERQVSELESELAVLTAQRQELVAKVSLLRP 61 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYS 103 SL+ D+LDE+AR +LNL DE+++ Sbjct: 62 ESLDPDMLDERARLNLNLVHPDELVVLRP 90 >gi|209963465|ref|YP_002296380.1| septum formation initiator, putative [Rhodospirillum centenum SW] gi|209956931|gb|ACI97567.1| septum formation initiator, putative [Rhodospirillum centenum SW] Length = 120 Score = 111 bits (278), Expect = 4e-23, Method: Composition-based stats. Identities = 30/96 (31%), Positives = 52/96 (54%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 F + I V+ V YF H + GD GL A L+ + E R L+E++ R +LE Sbjct: 9 NRAFRQIIGPVLGASVVAYFAYHTVQGDRGLVALTHLQGEVEEASRVLAEVRHEREQLEH 68 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + +L+ +L+ D+L+E+AR LN + D++++ Sbjct: 69 RARLLRPDNLDPDMLEERARLLLNKTHPDDLVILLP 104 >gi|115524618|ref|YP_781529.1| septum formation initiator [Rhodopseudomonas palustris BisA53] gi|115518565|gb|ABJ06549.1| Septum formation initiator [Rhodopseudomonas palustris BisA53] Length = 105 Score = 109 bits (272), Expect = 2e-22, Method: Composition-based stats. Identities = 27/99 (27%), Positives = 52/99 (52%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + K+ +IA + YF ++A G YGL A + L++ +I L LK Sbjct: 1 MVSHTRLKSLLTVLALYMIAAAVIGYFGSNAYTGKYGLHAQQELDQEIIALTSELQRLKH 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R+ E++V L+ L+ D+LD++ R+ L+ + ++++ Sbjct: 61 ERAEGEKRVSLLRSDRLDPDMLDQRVRFQLDYAHPNDLV 99 >gi|75676011|ref|YP_318432.1| septum formation initiator [Nitrobacter winogradskyi Nb-255] gi|74420881|gb|ABA05080.1| septum formation initiator [Nitrobacter winogradskyi Nb-255] Length = 105 Score = 108 bits (271), Expect = 2e-22, Method: Composition-based stats. Identities = 29/99 (29%), Positives = 51/99 (51%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ ++ +A V YF +A G YGL A + L++ +I L+ LK Sbjct: 1 MVSRSRLRSLLTGLALYAMAAMIVGYFGVNAYTGKYGLNARQDLDQEIIALTSELARLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R+ E++V L+ ++ D+LDE+ RY L+ + E+I Sbjct: 61 ERAEGEKRVALLRASGIDPDMLDERVRYQLHYANPHELI 99 >gi|304391613|ref|ZP_07373555.1| septum formation initiator [Ahrensia sp. R2A130] gi|303295842|gb|EFL90200.1| septum formation initiator [Ahrensia sp. R2A130] Length = 106 Score = 108 bits (270), Expect = 3e-22, Method: Composition-based stats. Identities = 33/98 (33%), Positives = 56/98 (57%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 +K R I + + YF HA G YG++A +++ + E+ L++ R +LE Sbjct: 6 RKRPLTRFIAPLATLMILGYFGFHAFNGQYGIRAKIAMDVQTAKLEKKLAQRTAVREKLE 65 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +V ++ DG+LEKD++DE R LN++R DEI+L + Sbjct: 66 ARVAMLRDGNLEKDMVDEYVRRQLNMAREDEIVLMNPE 103 >gi|239947290|ref|ZP_04699043.1| septum formation initiator [Rickettsia endosymbiont of Ixodes scapularis] gi|239921566|gb|EER21590.1| septum formation initiator [Rickettsia endosymbiont of Ixodes scapularis] Length = 107 Score = 107 bits (268), Expect = 5e-22, Method: Composition-based stats. Identities = 29/102 (28%), Positives = 48/102 (47%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + NH + I + + YF H I G+ G+ A + + L + L L+ R Sbjct: 1 MIIHLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRAER 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 LE VKL+ SL KD+L+E+A+ L ++ +E + D Sbjct: 61 VELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFTIKD 102 >gi|157825708|ref|YP_001493428.1| hypothetical protein A1C_03170 [Rickettsia akari str. Hartford] gi|157799666|gb|ABV74920.1| hypothetical protein A1C_03170 [Rickettsia akari str. Hartford] Length = 107 Score = 106 bits (265), Expect = 1e-21, Method: Composition-based stats. Identities = 29/99 (29%), Positives = 48/99 (48%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 + NH + I + + YF H I G+ G+ A + + L + L L+ R L Sbjct: 4 HLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRAERVEL 63 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 E VKL+ SL KD+L+E+A+ L ++ +E + D Sbjct: 64 EHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFTIKD 102 >gi|157803819|ref|YP_001492368.1| hypothetical protein A1E_03240 [Rickettsia canadensis str. McKiel] gi|157785082|gb|ABV73583.1| hypothetical protein A1E_03240 [Rickettsia canadensis str. McKiel] Length = 111 Score = 105 bits (264), Expect = 1e-21, Method: Composition-based stats. Identities = 28/100 (28%), Positives = 48/100 (48%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 + N+ + I + + YF H I G+ G+ A + + L + L L+ R L Sbjct: 8 HLNNNSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRAERVEL 67 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 E VKL+ SL KD+L+E+A+ L ++ +E + D Sbjct: 68 EHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVFTTKDI 107 >gi|288958363|ref|YP_003448704.1| septum formation initiator [Azospirillum sp. B510] gi|288910671|dbj|BAI72160.1| septum formation initiator [Azospirillum sp. B510] Length = 123 Score = 105 bits (264), Expect = 2e-21, Method: Composition-based stats. Identities = 32/98 (32%), Positives = 56/98 (57%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K+ +AI + C V YF +A+ GD GL A K ++ + + E L++L+ R +ER Sbjct: 16 KSALRQAIMPALCACVVAYFAYYAVHGDRGLVAMKQIQGQIAQAETVLNQLRTEREDMER 75 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 + +L+ L++D+L+E+AR LN S S ++I+ Sbjct: 76 RAQLLRGDGLDRDMLEERARLMLNFSSSRDVIVKLPKL 113 >gi|157964506|ref|YP_001499330.1| septum formation initiator [Rickettsia massiliae MTU5] gi|157844282|gb|ABV84783.1| Septum formation initiator [Rickettsia massiliae MTU5] Length = 103 Score = 105 bits (264), Expect = 2e-21, Method: Composition-based stats. Identities = 29/100 (29%), Positives = 49/100 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M+ + NH + I + + YF H I G+ G+ A + + L + L L+ Sbjct: 1 MYMIIHLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 R LE VKL+ SL KD+L+E+A+ L ++ +E + Sbjct: 61 ARVELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVF 100 >gi|209885411|ref|YP_002289268.1| septum formation initiator [Oligotropha carboxidovorans OM5] gi|209873607|gb|ACI93403.1| septum formation initiator [Oligotropha carboxidovorans OM5] Length = 111 Score = 105 bits (263), Expect = 2e-21, Method: Composition-based stats. Identities = 29/99 (29%), Positives = 49/99 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K IA + YF +A G YG+ A LEK L+ LK Sbjct: 8 MVSRARFKAFLTGLALYAIAAGFITYFGVNAYTGRYGINARIELEKEAATLSAELARLKA 67 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 +R+ E++V L+ ++ D+LDE+ARY L+ + +++ Sbjct: 68 DRAEEEKRVALLRSDKVDPDMLDERARYQLDYAHPRDLV 106 >gi|144898637|emb|CAM75501.1| Septum formation initiator [Magnetospirillum gryphiswaldense MSR-1] Length = 101 Score = 105 bits (263), Expect = 2e-21, Method: Composition-based stats. Identities = 30/95 (31%), Positives = 51/95 (53%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 + + +I + YF H + GD G+ A L+K ++ E L+ + R LE Sbjct: 5 LNRYLRHVMGPLIGVGALAYFAYHTVEGDRGVLAWVRLDKEILAAEMQLANVSTERQALE 64 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +V L+ L+ D+L+E+AR LN+ RSDE+++F Sbjct: 65 HRVLLLRPDHLDPDMLEERARAMLNMGRSDEMVIF 99 >gi|67459046|ref|YP_246670.1| hypothetical protein RF_0654 [Rickettsia felis URRWXCal2] gi|67004579|gb|AAY61505.1| unknown [Rickettsia felis URRWXCal2] Length = 107 Score = 105 bits (262), Expect = 2e-21, Method: Composition-based stats. Identities = 29/102 (28%), Positives = 47/102 (46%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + NH + I + + YF H I G+ G+ A + + L + L L+ R Sbjct: 1 MIIHLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRAER 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 LE VKL+ SL KD+L+E+A+ L ++ E + D Sbjct: 61 VELEHNVKLLRTESLNKDMLEEQAKKVLGVADPKEQVFTIKD 102 >gi|299134959|ref|ZP_07028150.1| Septum formation initiator [Afipia sp. 1NLS2] gi|298589936|gb|EFI50140.1| Septum formation initiator [Afipia sp. 1NLS2] Length = 104 Score = 105 bits (262), Expect = 3e-21, Method: Composition-based stats. Identities = 30/99 (30%), Positives = 46/99 (46%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K IA + YF +A G YGL A LEK L+ LK Sbjct: 1 MVSRARFKAILTGLALYAIAAGFITYFGVNAYTGRYGLNARVELEKEAATLTTELARLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 R+ E+ V L+ ++ D+LDE+ARY L + +++ Sbjct: 61 QRADEEKHVALLRSDRVDPDMLDEEARYQLGYANPRDLV 99 >gi|91205562|ref|YP_537917.1| septum formation initiator [Rickettsia bellii RML369-C] gi|157827278|ref|YP_001496342.1| septum formation initiator [Rickettsia bellii OSU 85-389] gi|91069106|gb|ABE04828.1| Septum formation initiator [Rickettsia bellii RML369-C] gi|157802582|gb|ABV79305.1| Septum formation initiator [Rickettsia bellii OSU 85-389] Length = 108 Score = 104 bits (261), Expect = 3e-21, Method: Composition-based stats. Identities = 29/93 (31%), Positives = 46/93 (49%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 N+ + I + + YF H I G+ G+ A + + L + L L+ R LE Sbjct: 10 NNNTKKIILNIFLALLLGYFVFHCIYGNKGVIAYLKVNRQLEKAYDELKLLQAERVELEH 69 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 VKL+ SL+KD+LDE+AR L ++ E + Sbjct: 70 NVKLLRTESLDKDMLDEQARKVLGIAAPSEQVF 102 >gi|15892511|ref|NP_360225.1| hypothetical protein RC0588 [Rickettsia conorii str. Malish 7] gi|34580496|ref|ZP_00141976.1| hypothetical protein [Rickettsia sibirica 246] gi|229586701|ref|YP_002845202.1| Septum formation initiator [Rickettsia africae ESF-5] gi|15619671|gb|AAL03126.1| unknown [Rickettsia conorii str. Malish 7] gi|28261881|gb|EAA25385.1| unknown [Rickettsia sibirica 246] gi|228021751|gb|ACP53459.1| Septum formation initiator [Rickettsia africae ESF-5] Length = 101 Score = 104 bits (261), Expect = 4e-21, Method: Composition-based stats. Identities = 28/98 (28%), Positives = 48/98 (48%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + NH + I ++ + YF H I G+ G+ A + + L + L L+ R Sbjct: 1 MIIHLNNHAKKIILNIVLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRAER 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 LE VKL+ SL KD+L+E+A+ L ++ +E + Sbjct: 61 VELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVF 98 >gi|157828460|ref|YP_001494702.1| hypothetical protein A1G_03315 [Rickettsia rickettsii str. 'Sheila Smith'] gi|165933178|ref|YP_001649967.1| septum formation initiator [Rickettsia rickettsii str. Iowa] gi|238650887|ref|YP_002916743.1| septum formation initiator [Rickettsia peacockii str. Rustic] gi|157800941|gb|ABV76194.1| hypothetical protein A1G_03315 [Rickettsia rickettsii str. 'Sheila Smith'] gi|165908265|gb|ABY72561.1| septum formation initiator [Rickettsia rickettsii str. Iowa] gi|238624985|gb|ACR47691.1| septum formation initiator [Rickettsia peacockii str. Rustic] Length = 101 Score = 104 bits (259), Expect = 6e-21, Method: Composition-based stats. Identities = 28/98 (28%), Positives = 47/98 (47%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + NH + I + + YF H I G+ G+ A + + L + L L+ R Sbjct: 1 MIIHLNNHSKKIILNIFLALLLGYFVFHCIYGNKGIIAYLKVNRQLEKAYDELKGLRAER 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 LE VKL+ SL KD+L+E+A+ L ++ +E + Sbjct: 61 VELEHNVKLLRTESLNKDMLEEQAKKVLGVAAPNEQVF 98 >gi|15604288|ref|NP_220804.1| hypothetical protein RP423 [Rickettsia prowazekii str. Madrid E] gi|6647962|sp|Q9ZDA9|Y423_RICPR RecName: Full=Uncharacterized protein RP423 gi|3860980|emb|CAA14880.1| unknown [Rickettsia prowazekii] gi|292572037|gb|ADE29952.1| Septum formation initiator [Rickettsia prowazekii Rp22] Length = 107 Score = 102 bits (256), Expect = 1e-20, Method: Composition-based stats. Identities = 29/103 (28%), Positives = 48/103 (46%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + H + I + +VYF H I G+ G+ A + + L + L L+ R Sbjct: 1 MIIHFNKHSKKIILNIFLALLLVYFIFHCIYGNKGIIAYLKVNRQLEKAYDELKNLRAER 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 LE VKL+ SL KD+L+E+A+ L ++ +E + D Sbjct: 61 VELEHNVKLLRTESLNKDMLEEQAKKILGIAAPNEQVFTIKDI 103 >gi|154247810|ref|YP_001418768.1| septum formation initiator [Xanthobacter autotrophicus Py2] gi|154161895|gb|ABS69111.1| Septum formation initiator [Xanthobacter autotrophicus Py2] Length = 104 Score = 102 bits (255), Expect = 2e-20, Method: Composition-based stats. Identities = 32/103 (31%), Positives = 53/103 (51%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ ++ + A + YF HA GD+GL A ++ E+ + E L+ LK Sbjct: 1 MQSRSRLQSILATLALHLGAAALIGYFAYHAYNGDHGLVAKRNYEQEMKALEAELAGLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R +E KV L++ L+ D+LDE+AR LN +++L S Sbjct: 61 QRRAMENKVSLLAPTQLDPDMLDEEARRQLNFINGKDLVLLRS 103 >gi|86749889|ref|YP_486385.1| septum formation initiator [Rhodopseudomonas palustris HaA2] gi|86572917|gb|ABD07474.1| Septum formation initiator [Rhodopseudomonas palustris HaA2] Length = 105 Score = 101 bits (253), Expect = 3e-20, Method: Composition-based stats. Identities = 30/104 (28%), Positives = 51/104 (49%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ K+ IA + YF +A G YGL A + L++ +I L LK Sbjct: 1 MVTRSRLKSILAGVALYAIAAAAIAYFGINAYTGRYGLTAQQELDQEIIALTSELVRLKH 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R+ E++V L+ L+ D+LDE+ RY L+ + +++ + Sbjct: 61 ERAEGEKRVALLRSDRLDPDMLDERVRYQLDFANPADLVRMHPQ 104 >gi|51473611|ref|YP_067368.1| hypothetical protein RT0409 [Rickettsia typhi str. Wilmington] gi|51459923|gb|AAU03886.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington] Length = 107 Score = 100 bits (250), Expect = 7e-20, Method: Composition-based stats. Identities = 28/103 (27%), Positives = 47/103 (45%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + H + I + +VYF H I G+ G+ A + + L + L L+ R Sbjct: 1 MIIHFNKHSKKIILNIFLALLLVYFIFHCIYGNKGIIAYLKVNRQLEKAYDELKILRAKR 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 LE VKL+ SL KD+L+E+ + L ++ +E + D Sbjct: 61 VELEHNVKLLRTESLNKDMLEEQVKKILGIAAPNEQVFTIKDI 103 >gi|298291780|ref|YP_003693719.1| septum formation initiator [Starkeya novella DSM 506] gi|296928291|gb|ADH89100.1| Septum formation initiator [Starkeya novella DSM 506] Length = 113 Score = 99.4 bits (247), Expect = 1e-19, Method: Composition-based stats. Identities = 28/103 (27%), Positives = 47/103 (45%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + ++ + A + YF G YGL A +S E+ + L+ Sbjct: 1 MIIRTRWRSILQTVTLHLGAAALIGYFAFQGYNGQYGLLARRSFEQQHANLTQERDRLRS 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R L+ KV+L+S ++ D+LDE+AR LNL +++L Sbjct: 61 QREALQAKVRLLSPERVDADMLDEQARSLLNLVNPKDLVLLLP 103 >gi|154253582|ref|YP_001414406.1| septum formation initiator [Parvibaculum lavamentivorans DS-1] gi|154157532|gb|ABS64749.1| Septum formation initiator [Parvibaculum lavamentivorans DS-1] Length = 117 Score = 99.1 bits (246), Expect = 2e-19, Method: Composition-based stats. Identities = 26/92 (28%), Positives = 51/92 (55%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 +A+ + + YF HA+ G +G + ++ + E L+E++ R +L+R+V Sbjct: 14 RLRQALIPFVCIIVLGYFAYHAVYGRHGFISWLDIQNRIDTLEHQLTEVETKRMQLDRQV 73 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 L+ SL+ DLLDE+AR +L ++++ +F Sbjct: 74 ALLRPESLDPDLLDERARAALGYGGANDVTIF 105 >gi|114704543|ref|ZP_01437451.1| hypothetical protein FP2506_06401 [Fulvimarina pelagi HTCC2506] gi|114539328|gb|EAU42448.1| hypothetical protein FP2506_06401 [Fulvimarina pelagi HTCC2506] Length = 92 Score = 98.7 bits (245), Expect = 3e-19, Method: Composition-based stats. Identities = 34/91 (37%), Positives = 57/91 (62%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 R I ++ + YF H GDYGL + LE+ L ++ L+ L+ R+ L ++V+ Sbjct: 1 MIRLIIPTLSAAVLAYFAIHVQTGDYGLSSKAELERRLNVKKAELASLERERTALAQRVE 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 L+S G+LE+D+LDE+AR++LN+ DEI++ Sbjct: 61 LLSSGTLERDMLDERARWALNVVAEDEIVIL 91 >gi|163793247|ref|ZP_02187223.1| Septum formation initiator [alpha proteobacterium BAL199] gi|159181893|gb|EDP66405.1| Septum formation initiator [alpha proteobacterium BAL199] Length = 123 Score = 97.1 bits (241), Expect = 7e-19, Method: Composition-based stats. Identities = 28/100 (28%), Positives = 47/100 (47%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M K + +I V YF HA+ GD G++A + L+ + E L Sbjct: 1 MTLIPELKRRARHVVGPLIGSLLVAYFAYHAVEGDRGIRAWQRLDGEVAEARAVRDRLSG 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 ++ E++V ++ L+ DLL+E+AR L SD +I+ Sbjct: 61 EQAAFEKRVSMLRPDGLDPDLLEERARLVLGFVPSDGLIM 100 >gi|162147710|ref|YP_001602171.1| septum formation initiator protein [Gluconacetobacter diazotrophicus PAl 5] gi|209542334|ref|YP_002274563.1| Septum formation initiator [Gluconacetobacter diazotrophicus PAl 5] gi|161786287|emb|CAP55869.1| putative septum formation initiator protein [Gluconacetobacter diazotrophicus PAl 5] gi|209530011|gb|ACI49948.1| Septum formation initiator [Gluconacetobacter diazotrophicus PAl 5] Length = 109 Score = 96.7 bits (240), Expect = 9e-19, Method: Composition-based stats. Identities = 28/103 (27%), Positives = 49/103 (47%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + I + YF + + GD+GL++ K+ + L E + Sbjct: 1 MQIGRMIRRAIRMVIPPALFIGLTAYFGWNVMQGDHGLQSYKAQLQLLAEARAAQQDAMA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + R+V+ + + +L+ D LDE+AR LNLSR DE+++ Y Sbjct: 61 EQQVWVRRVRGLKESALDSDTLDERARAMLNLSRPDELVVPYG 103 >gi|83310757|ref|YP_421021.1| septum formation initiator [Magnetospirillum magneticum AMB-1] gi|82945598|dbj|BAE50462.1| Septum formation initiator [Magnetospirillum magneticum AMB-1] Length = 88 Score = 96.0 bits (238), Expect = 2e-18, Method: Composition-based stats. Identities = 30/84 (35%), Positives = 50/84 (59%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +I V YFT H + GD G+ A L+ ++E E LS + R+ +E +V+L+ L Sbjct: 1 MIGLGAVAYFTYHTVEGDRGVLAYFRLQAEILEAEMHLSRVASERTEMEHRVQLLRPDHL 60 Query: 78 EKDLLDEKARYSLNLSRSDEIILF 101 + D+L+E+AR LN+ R E+++F Sbjct: 61 DPDMLEERARIMLNMGRDGEVVVF 84 >gi|91977283|ref|YP_569942.1| septum formation initiator [Rhodopseudomonas palustris BisB5] gi|91683739|gb|ABE40041.1| Septum formation initiator [Rhodopseudomonas palustris BisB5] Length = 105 Score = 95.6 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 29/103 (28%), Positives = 50/103 (48%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M ++ K+ IA + YF +A G YGL A + L++ +I L LK Sbjct: 1 MVSRSRLKSILAGIALYAIAAAAIGYFGINAYTGRYGLTAQQELDQEIIALTSELVRLKN 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R+ E++V L+ L+ D+LDE+ RY L+ + +++ Sbjct: 61 ERAEGEKRVALLRSERLDPDMLDERVRYQLDFANPADLVRKIP 103 >gi|148284143|ref|YP_001248233.1| hypothetical protein OTBS_0266 [Orientia tsutsugamushi str. Boryong] gi|189184296|ref|YP_001938081.1| hypothetical protein OTT_1389 [Orientia tsutsugamushi str. Ikeda] gi|146739582|emb|CAM79332.1| conserved hypothetical protein [Orientia tsutsugamushi str. Boryong] gi|189181067|dbj|BAG40847.1| hypothetical protein OTT_1389 [Orientia tsutsugamushi str. Ikeda] Length = 99 Score = 95.6 bits (237), Expect = 2e-18, Method: Composition-based stats. Identities = 30/88 (34%), Positives = 50/88 (56%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R +F V+ ++YF HA+ G+ GL + ++ + + L +LK R LE++V L+ Sbjct: 3 RILFSVVLIGLLIYFAFHAVYGNRGLISYIEFNNNVDQSLKKLYKLKAERLELEQRVNLL 62 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 SL+ D+LDE+ R L L+ S+E I Sbjct: 63 RLQSLDLDMLDEQVRKKLGLAHSNEKIF 90 >gi|46201561|ref|ZP_00054821.2| COG2919: Septum formation initiator [Magnetospirillum magnetotacticum MS-1] Length = 88 Score = 95.2 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 29/84 (34%), Positives = 50/84 (59%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 +I V YFT H + GD G+ A L+ +++ E LS + R+ +E +V+L+ L Sbjct: 1 MIGLGAVAYFTYHTVEGDRGVLAYFRLQAEILDAEMHLSRVASERTEMEHRVQLLRPDHL 60 Query: 78 EKDLLDEKARYSLNLSRSDEIILF 101 + D+L+E+AR LN+ R E+++F Sbjct: 61 DPDMLEERARIMLNMGREGEVVVF 84 >gi|182678480|ref|YP_001832626.1| septum formation initiator [Beijerinckia indica subsp. indica ATCC 9039] gi|182634363|gb|ACB95137.1| Septum formation initiator [Beijerinckia indica subsp. indica ATCC 9039] Length = 106 Score = 95.2 bits (236), Expect = 3e-18, Method: Composition-based stats. Identities = 26/103 (25%), Positives = 48/103 (46%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + F I + YF HA+ G+ GLK + + E L+ LKE Sbjct: 1 MVIRKRMRAILFPLILYAASAALSSYFLWHALNGERGLKTRDEYARQIALLEGQLTALKE 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + + ++ LM + ++++DLLDE R L +D++++ Sbjct: 61 EHEQWQHRIGLMHNNAVDRDLLDEATRTRLGRIGADDLMVILP 103 >gi|330994776|ref|ZP_08318698.1| septum formation initiator [Gluconacetobacter sp. SXCC-1] gi|329758037|gb|EGG74559.1| septum formation initiator [Gluconacetobacter sp. SXCC-1] Length = 100 Score = 93.3 bits (231), Expect = 1e-17, Method: Composition-based stats. Identities = 28/90 (31%), Positives = 47/90 (52%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I + YF +A+ G++GL + + L E + + R+V+ + + Sbjct: 6 IPPALFIGLTAYFGWNAMRGEHGLHSYATQLHLLDEARSAQKDATAEQEVWLRRVRGLKE 65 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 G+L+ DLLDE+AR NL+R DEI++ Y D Sbjct: 66 GALDTDLLDERARSMQNLARQDEIVVPYGD 95 >gi|296445307|ref|ZP_06887266.1| Septum formation initiator [Methylosinus trichosporium OB3b] gi|296257262|gb|EFH04330.1| Septum formation initiator [Methylosinus trichosporium OB3b] Length = 111 Score = 92.5 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 25/86 (29%), Positives = 42/86 (48%) Query: 20 AFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEK 79 A YF H + G GLKA + + L ER + L R + ER++ L+ ++ Sbjct: 19 AGLVASYFVWHGVNGQRGLKAGEEYAERLAALEREHAGLVAERKQWERRIALLRGDVIDA 78 Query: 80 DLLDEKARYSLNLSRSDEIILFYSDF 105 D+LDE+AR +L +E+++ Sbjct: 79 DMLDEQARVTLGRIHRNEVVILAPQL 104 >gi|329113362|ref|ZP_08242143.1| Hypothetical protein APO_0127 [Acetobacter pomorum DM001] gi|326697187|gb|EGE48847.1| Hypothetical protein APO_0127 [Acetobacter pomorum DM001] Length = 109 Score = 92.5 bits (229), Expect = 2e-17, Method: Composition-based stats. Identities = 24/102 (23%), Positives = 51/102 (50%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + + ++ YF +A GD+G++A K L + ++ + Sbjct: 1 MQIGRFIRRTVRAVVPPLVFLGIAGYFGWNATQGDHGIQAYKQQLGLLEQAKQSKQDAIA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 ++ R+V + + SL+ D+LDE+AR LN++ ++I++ Y Sbjct: 61 EQAAWHRRVNGLREQSLDTDILDERARAMLNMADRNDIVVPY 102 >gi|83593217|ref|YP_426969.1| septum formation initiator [Rhodospirillum rubrum ATCC 11170] gi|83576131|gb|ABC22682.1| Septum formation initiator [Rhodospirillum rubrum ATCC 11170] Length = 107 Score = 92.1 bits (228), Expect = 2e-17, Method: Composition-based stats. Identities = 30/93 (32%), Positives = 48/93 (51%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K+ + ++A + YF H I GD G+ + L K + E L + + L+ Sbjct: 6 KSRLRGFLGSLLALLVIAYFGYHGIQGDRGVLSLARLTKEIEEARHLLDLRRAEEAALQA 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 V +S S+++DLLDE+AR LN R DE+I+ Sbjct: 66 SVTRLSPESVDRDLLDERARIMLNRIRPDEVII 98 >gi|258542193|ref|YP_003187626.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-01] gi|256633271|dbj|BAH99246.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-01] gi|256636330|dbj|BAI02299.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-03] gi|256639383|dbj|BAI05345.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-07] gi|256642439|dbj|BAI08394.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-22] gi|256645494|dbj|BAI11442.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-26] gi|256648547|dbj|BAI14488.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-32] gi|256651600|dbj|BAI17534.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-01-42C] gi|256654591|dbj|BAI20518.1| septum formation inhibitor Maf [Acetobacter pasteurianus IFO 3283-12] Length = 109 Score = 91.7 bits (227), Expect = 3e-17, Method: Composition-based stats. Identities = 23/102 (22%), Positives = 51/102 (50%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + + ++ YF +A GD+G++A + L + ++ + Sbjct: 1 MQIGRFIRRTVRAVVPPLVFLGIAGYFGWNATQGDHGIQAYRQQLGLLEQAKQSKQDAIA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 ++ R+V + + SL+ D+LDE+AR LN++ ++I++ Y Sbjct: 61 EQAAWHRRVNGLREQSLDTDILDERARAMLNMADRNDIVVPY 102 >gi|332185266|ref|ZP_08387015.1| septum formation initiator family protein [Sphingomonas sp. S17] gi|332014990|gb|EGI57046.1| septum formation initiator family protein [Sphingomonas sp. S17] Length = 96 Score = 90.2 bits (223), Expect = 8e-17, Method: Composition-based stats. Identities = 26/95 (27%), Positives = 46/95 (48%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 RA + V +F +A++G GL A ++ L++RE L + R+ L+ + Sbjct: 2 RTMRRAALPALGLTIVAFFGAYAVLGRNGLLAYGEYQRQLVKREHDYVLLDKRRTILKNR 61 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 V L+ D++DE R LN++ DE+I+ Sbjct: 62 VALLDPDHANPDMVDEMVRKELNVAHPDEVIVPLK 96 >gi|296116170|ref|ZP_06834788.1| Septum formation initiator [Gluconacetobacter hansenii ATCC 23769] gi|295977276|gb|EFG84036.1| Septum formation initiator [Gluconacetobacter hansenii ATCC 23769] Length = 109 Score = 90.2 bits (223), Expect = 9e-17, Method: Composition-based stats. Identities = 25/104 (24%), Positives = 49/104 (47%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + A+ + YF + + G++GL + + + L E + Sbjct: 1 MQIGKIIRRVVGSALPPALFIGLTAYFGWNVMGGEHGLHSYAAQLRLLDEANSAQKDAYA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + R+V+ + + +L++DL+DE+AR NL+R DEI++ Y Sbjct: 61 EQQVWLRRVRGLKENTLDRDLMDERARSMQNLARQDEIVVPYGP 104 >gi|188582153|ref|YP_001925598.1| septum formation initiator [Methylobacterium populi BJ001] gi|179345651|gb|ACB81063.1| Septum formation initiator [Methylobacterium populi BJ001] Length = 103 Score = 89.8 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 24/103 (23%), Positives = 50/103 (48%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + A+ ++ V YF + A G GL+A ++L+ + L+ K Sbjct: 1 MVIRRRVRAIVVPAVLWTVSALVVGYFVHQAESGSRGLEAKRALKVEAYGLTQELNVAKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R+ E +V L+ +++DLL+E+AR L ++++++ Sbjct: 61 ERATWEHRVSLLRSEQIDRDLLEERARVVLGRVHANDLVIIGP 103 >gi|163852204|ref|YP_001640247.1| septum formation initiator [Methylobacterium extorquens PA1] gi|218530963|ref|YP_002421779.1| septum formation initiator [Methylobacterium chloromethanicum CM4] gi|240139534|ref|YP_002964010.1| Septum formation initiator [Methylobacterium extorquens AM1] gi|254561950|ref|YP_003069045.1| Septum formation initiator [Methylobacterium extorquens DM4] gi|163663809|gb|ABY31176.1| Septum formation initiator [Methylobacterium extorquens PA1] gi|218523266|gb|ACK83851.1| Septum formation initiator [Methylobacterium chloromethanicum CM4] gi|240009507|gb|ACS40733.1| Septum formation initiator [Methylobacterium extorquens AM1] gi|254269228|emb|CAX25194.1| Septum formation initiator [Methylobacterium extorquens DM4] Length = 103 Score = 89.8 bits (222), Expect = 1e-16, Method: Composition-based stats. Identities = 24/103 (23%), Positives = 49/103 (47%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + A+ ++ V YF + A G GL+A + L+ + L+ K Sbjct: 1 MVIRRRVRAIVVPAVLWTVSALVVGYFVHQAESGSRGLEAKRVLKVEAYGLTQELNAAKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 R+ E +V L+ +++DLL+E+AR L ++++++ Sbjct: 61 ERATWEHRVSLLRSEQIDRDLLEERARVVLGRVHANDLVIIGP 103 >gi|295689364|ref|YP_003593057.1| septum formation initiator [Caulobacter segnis ATCC 21756] gi|295431267|gb|ADG10439.1| Septum formation initiator [Caulobacter segnis ATCC 21756] Length = 100 Score = 89.4 bits (221), Expect = 1e-16, Method: Composition-based stats. Identities = 25/95 (26%), Positives = 43/95 (45%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + F + YF HA+ GD GL + L + + L +++ R LE + Sbjct: 3 ARLQPFLPTAAIFFLIFYFAFHALTGDRGLLSISQRNADLAAKTKELRKIRAERMDLEAR 62 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +L+ GSL DLL+E+AR L + + ++ Sbjct: 63 ARLLRSGSLSADLLEERARSLLGYADPRDYVIRVK 97 >gi|170747419|ref|YP_001753679.1| septum formation initiator [Methylobacterium radiotolerans JCM 2831] gi|170653941|gb|ACB22996.1| Septum formation initiator [Methylobacterium radiotolerans JCM 2831] Length = 103 Score = 89.4 bits (221), Expect = 2e-16, Method: Composition-based stats. Identities = 23/88 (26%), Positives = 46/88 (52%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 ++ V YF A G+ GL+A K+L+ + L+ +K R+ E +V L+ Sbjct: 16 LWTLSALVVGYFVWQAESGNRGLEAKKALKIRAYGLSQELAAVKAERAVWEHRVNLLKSD 75 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYS 103 +++DLL+E+AR L ++++++ Sbjct: 76 QIDRDLLEERARIVLGRVHANDVVIITP 103 >gi|146277142|ref|YP_001167301.1| septum formation initiator [Rhodobacter sphaeroides ATCC 17025] gi|145555383|gb|ABP69996.1| Septum formation initiator [Rhodobacter sphaeroides ATCC 17025] Length = 100 Score = 88.3 bits (218), Expect = 3e-16, Method: Composition-based stats. Identities = 26/93 (27%), Positives = 46/93 (49%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + +++ +AF YFT A+ GDYG+ ++ ++ + Sbjct: 7 RPAIGASLYFALAFSLSAYFTFAAVQGDYGVFRQVQIKAEAEALRAERDQIAAELDEMRN 66 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 K + +SD L+ DLLDE+AR +L R+DEI++ Sbjct: 67 KTRRLSDSYLDVDLLDEQARATLGYVRADEIVI 99 >gi|16125969|ref|NP_420533.1| hypothetical protein CC_1725 [Caulobacter crescentus CB15] gi|221234734|ref|YP_002517170.1| septum formation initiator [Caulobacter crescentus NA1000] gi|13423141|gb|AAK23701.1| conserved hypothetical protein [Caulobacter crescentus CB15] gi|220963906|gb|ACL95262.1| septum formation initiator [Caulobacter crescentus NA1000] Length = 100 Score = 87.5 bits (216), Expect = 5e-16, Method: Composition-based stats. Identities = 26/95 (27%), Positives = 43/95 (45%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + F + YF HA+ GD GL + L + R L +++ R LE + Sbjct: 3 ARLQPFLPTTAIFFLIFYFAFHALTGDRGLLSISQRNADLAAKTRELRKIRAERMDLEAR 62 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +L+ GSL DLL+E+AR L + + ++ Sbjct: 63 ARLLRSGSLSADLLEERARSLLGYADPRDYVIRVK 97 >gi|167646723|ref|YP_001684386.1| septum formation initiator [Caulobacter sp. K31] gi|167349153|gb|ABZ71888.1| Septum formation initiator [Caulobacter sp. K31] Length = 98 Score = 87.1 bits (215), Expect = 8e-16, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 41/92 (44%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + + YF HA+ G+ GL + L + L +++ R LE + Sbjct: 3 ARLQPFLPTAALLLLITYFVFHALTGERGLLSTSQRNADLAAKTLELKKIRAERMDLEAR 62 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +L+ GSL DLL+E+AR L + + ++ Sbjct: 63 ARLLRSGSLSADLLEERARSLLGYADPKDYVI 94 >gi|217976705|ref|YP_002360852.1| septum formation initiator [Methylocella silvestris BL2] gi|217502081|gb|ACK49490.1| septum formation initiator [Methylocella silvestris BL2] Length = 107 Score = 86.7 bits (214), Expect = 1e-15, Method: Composition-based stats. Identities = 23/103 (22%), Positives = 49/103 (47%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + F + ++ YF HA+ G+ GLK N + + + L LK Sbjct: 1 MVIRRRIRAIVFPLLLYCVSGAAGGYFVWHALNGERGLKTNDEYQLKIAGFQTELDGLKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + R++ L++ +++DLLDE+AR + + +++++ Sbjct: 61 ESALWRRRIALINGAIVDRDLLDEEARALIGRADKNDLVVMLP 103 >gi|89069558|ref|ZP_01156902.1| hypothetical protein OG2516_03243 [Oceanicola granulosus HTCC2516] gi|89044893|gb|EAR50983.1| hypothetical protein OG2516_03243 [Oceanicola granulosus HTCC2516] Length = 99 Score = 86.3 bits (213), Expect = 1e-15, Method: Composition-based stats. Identities = 28/95 (29%), Positives = 48/95 (50%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 + + ++ V A YF A+ GDYG+ ++ E L+ L+ + + Sbjct: 4 KTRMPYGAILYFVGALLLSFYFVFAAVQGDYGVFRRAEVDAEARELRAELALLQAEVAEM 63 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E + +SD L+ DL+DE+AR L L R+DEI++ Sbjct: 64 ENLARRLSDAYLDLDLVDERARDVLGLIRADEIVV 98 >gi|114327846|ref|YP_745003.1| septum formation initiator [Granulibacter bethesdensis CGDNIH1] gi|114316020|gb|ABI62080.1| septum formation initiator [Granulibacter bethesdensis CGDNIH1] Length = 109 Score = 86.0 bits (212), Expect = 1e-15, Method: Composition-based stats. Identities = 22/96 (22%), Positives = 48/96 (50%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + A+ + + YF+ + G+ GL++ + +++ + L K + + ER Sbjct: 8 RRKLKSAVAPTVFLALLGYFSWNVTRGNLGLQSYHEHQADMMQAAKDLEAAKADLASWER 67 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 ++K + L+ D LDE++R LNL+ +I++ Y Sbjct: 68 RIKGLGSSRLDTDSLDERSRAMLNLADPTDIVVMYP 103 >gi|254469492|ref|ZP_05082897.1| septum formation initiator [Pseudovibrio sp. JE062] gi|211961327|gb|EEA96522.1| septum formation initiator [Pseudovibrio sp. JE062] Length = 88 Score = 86.0 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 31/87 (35%), Positives = 49/87 (56%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 IA + YF HA+ G GL +E ++ E L EL+ R +L+R+V L+ Sbjct: 1 MPGIAIGALCYFAFHALNGKLGLVGRPQIEHEILALEVELEELRAERLQLQRRVMLLDPE 60 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFY 102 SL+ D++DE+AR SLNL+ +E+ + Sbjct: 61 SLDPDMVDERARASLNLAHVNEVAIMR 87 >gi|220926284|ref|YP_002501586.1| Septum formation initiator [Methylobacterium nodulans ORS 2060] gi|219950891|gb|ACL61283.1| Septum formation initiator [Methylobacterium nodulans ORS 2060] Length = 103 Score = 86.0 bits (212), Expect = 2e-15, Method: Composition-based stats. Identities = 24/103 (23%), Positives = 47/103 (45%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + + V YF A G GL+A ++L+ ++ L K Sbjct: 1 MVVRRRARALLLPLGLYAASILAVGYFLREAESGSRGLQAKRALKIQAYNLQQELDAAKA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +R+ ER+V L+ +++DLL+E+AR L +++++ Sbjct: 61 DRAEWERRVALLRSDQIDRDLLEERARIVLGRVHPNDVVIINP 103 >gi|323136510|ref|ZP_08071592.1| Septum formation initiator [Methylocystis sp. ATCC 49242] gi|322398584|gb|EFY01104.1| Septum formation initiator [Methylocystis sp. ATCC 49242] Length = 110 Score = 84.8 bits (209), Expect = 4e-15, Method: Composition-based stats. Identities = 22/91 (24%), Positives = 40/91 (43%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 +A YF H + G GLK + E+ L + LK R + E ++ L+ Sbjct: 14 PFTLYCVAGTVAGYFVWHGVHGQRGLKTGEEYEQKLAQLRLERDILKLQRMQWESRLALI 73 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +++ D+LDE+ R L +E+++ Sbjct: 74 KGENIDADILDEETRKRLGRVHRNEVVILLP 104 >gi|294083774|ref|YP_003550531.1| hypothetical protein SAR116_0204 [Candidatus Puniceispirillum marinum IMCC1322] gi|292663346|gb|ADE38447.1| hypothetical protein SAR116_0204 [Candidatus Puniceispirillum marinum IMCC1322] Length = 106 Score = 83.7 bits (206), Expect = 8e-15, Method: Composition-based stats. Identities = 28/94 (29%), Positives = 54/94 (57%), Gaps = 1/94 (1%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 KK+ F L++A +F H I G+ G+ A LE+ ++ E L+ L++++S L Sbjct: 5 KKSLAFIGSLLLLA-TMASFFMFHTIAGERGILAQPELERKILIAEEQLALLEKHQSHLH 63 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +++ LM + +++ D+L E AR L L +++I+ Sbjct: 64 QRISLMQNDAIDADMLAETARAELGLYTPNDVIV 97 >gi|254504137|ref|ZP_05116288.1| Septum formation initiator subfamily [Labrenzia alexandrii DFL-11] gi|222440208|gb|EEE46887.1| Septum formation initiator subfamily [Labrenzia alexandrii DFL-11] Length = 77 Score = 82.9 bits (204), Expect = 1e-14, Method: Composition-based stats. Identities = 24/73 (32%), Positives = 38/73 (52%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 + G+ G+ +E+ + E E L L R L +V L+ SL+ D+LDE+AR LN Sbjct: 1 MNGELGVVGRAMIERQVAELEGELQLLVAERRELAARVSLLRPESLDPDMLDERARLYLN 60 Query: 92 LSRSDEIILFYSD 104 L DE+++ Sbjct: 61 LVHPDELVVLKPQ 73 >gi|149201830|ref|ZP_01878804.1| Septum formation initiator [Roseovarius sp. TM1035] gi|149144878|gb|EDM32907.1| Septum formation initiator [Roseovarius sp. TM1035] Length = 115 Score = 82.5 bits (203), Expect = 2e-14, Method: Composition-based stats. Identities = 36/94 (38%), Positives = 53/94 (56%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 + + IF +IAF YFT A+ GDYGL ++ +E + L L +R+E Sbjct: 21 RSRPWGLLIFFLIAFFLGAYFTFAAVQGDYGLFRRAEIDAQSVELQAQLDALNVRVARME 80 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SDG L+ DLLD++AR L L RSDEI++ Sbjct: 81 NLTRRLSDGYLDLDLLDQQAREVLGLLRSDEIVI 114 >gi|197105208|ref|YP_002130585.1| septum formation initiator [Phenylobacterium zucineum HLK1] gi|196478628|gb|ACG78156.1| septum formation initiator [Phenylobacterium zucineum HLK1] Length = 98 Score = 81.7 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 25/96 (26%), Positives = 46/96 (47%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + + YF HA G+ GL + ++L+ ++R LS+++ R LE + Sbjct: 3 ARLRPYLSTAALALLIFYFAFHAFTGEGGLLRSNQRGETLLAKQRELSQVRAKREDLEAR 62 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +L+ D SL DLL+E+AR L + + ++ Sbjct: 63 AQLLRDQSLSADLLEERARSLLGFADPRDYVIRMKP 98 >gi|170743959|ref|YP_001772614.1| septum formation initiator [Methylobacterium sp. 4-46] gi|168198233|gb|ACA20180.1| Septum formation initiator [Methylobacterium sp. 4-46] Length = 103 Score = 81.7 bits (201), Expect = 3e-14, Method: Composition-based stats. Identities = 23/84 (27%), Positives = 44/84 (52%) Query: 20 AFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEK 79 + V YF A G GL+A ++L+ ++ L K +R+ ER+V L+ +++ Sbjct: 20 SVLAVGYFLREAESGSRGLQAKRALKIQAYNLQKELDAAKADRAEWERRVALLRSDQIDR 79 Query: 80 DLLDEKARYSLNLSRSDEIILFYS 103 DLL+E+AR L +++++ Sbjct: 80 DLLEERARLMLGRVHPNDVVIINP 103 >gi|312114100|ref|YP_004011696.1| septum formation initiator [Rhodomicrobium vannielii ATCC 17100] gi|311219229|gb|ADP70597.1| Septum formation initiator [Rhodomicrobium vannielii ATCC 17100] Length = 108 Score = 81.3 bits (200), Expect = 4e-14, Method: Composition-based stats. Identities = 33/103 (32%), Positives = 50/103 (48%), Gaps = 1/103 (0%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T + L I Y A+ G +GL AN+ L + + R L+ LK R Sbjct: 2 TPGRNGRLLRQFGLLAIFLSLTAYVAADAVRGPHGLIANELLRAKIADLNRDLTALKRER 61 Query: 63 SRLERKVKLMSD-GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +RLER L+ S DLLDE+AR L+L+R +I++ ++ Sbjct: 62 ARLERDADLLGPKASTHSDLLDEQARALLDLARPADIVIVNAE 104 >gi|326405303|ref|YP_004285385.1| septum formation initiator family protein [Acidiphilium multivorum AIU301] gi|325052165|dbj|BAJ82503.1| septum formation initiator family protein [Acidiphilium multivorum AIU301] Length = 112 Score = 79.0 bits (194), Expect = 2e-13, Method: Composition-based stats. Identities = 22/86 (25%), Positives = 45/86 (52%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 V+ YF +AI G G+ A + + L++ + L+++ R R + +V + Sbjct: 2 LPVLFLVVTAYFVFNAINGSRGIIAQRHDQAVLVKDRQSLTDVTARRDRWQARVDALHHH 61 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILF 101 ++ D+L+E+AR LNL+ D++ + Sbjct: 62 AIAPDMLNEQARAVLNLADPDDLAVP 87 >gi|302383093|ref|YP_003818916.1| septum formation initiator [Brevundimonas subvibrioides ATCC 15264] gi|302193721|gb|ADL01293.1| Septum formation initiator [Brevundimonas subvibrioides ATCC 15264] Length = 109 Score = 78.6 bits (193), Expect = 3e-13, Method: Composition-based stats. Identities = 25/91 (27%), Positives = 42/91 (46%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 + Y A+ G+ GL + + + L RE L+ L E R+ LE +V Sbjct: 4 RMKPYALSAFLLLLIGYLGVQALTGERGLLSGAARDARLDAREAQLAALAEQRADLEVRV 63 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + + GSL +DLL+E+A L S + ++ Sbjct: 64 RYLRTGSLSRDLLEERASAVLGFSDPRDYVI 94 >gi|254512341|ref|ZP_05124408.1| septum formation initiator [Rhodobacteraceae bacterium KLH11] gi|221536052|gb|EEE39040.1| septum formation initiator [Rhodobacteraceae bacterium KLH11] Length = 91 Score = 78.3 bits (192), Expect = 3e-13, Method: Composition-based stats. Identities = 34/90 (37%), Positives = 49/90 (54%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 IF +AF VYFT A+ GDYGL + + L++LK+ R+E Sbjct: 1 MGAFIFFSVAFMLGVYFTFAAVQGDYGLFRRVEIAAERDALSQDLNQLKDEIVRMENLTH 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLD++AR L + RSDEI++ Sbjct: 61 RLSDTYLDLDLLDQQARSVLGMIRSDEIVI 90 >gi|315499907|ref|YP_004088710.1| septum formation initiator [Asticcacaulis excentricus CB 48] gi|315417919|gb|ADU14559.1| Septum formation initiator [Asticcacaulis excentricus CB 48] Length = 104 Score = 77.9 bits (191), Expect = 4e-13, Method: Composition-based stats. Identities = 23/92 (25%), Positives = 45/92 (48%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + I + Y + GD G + ++ + L E+++ LS+L R LE + Sbjct: 3 QKLRPYLPTAIIAIFLTYCGVQYLTGDKGFFSQETRQVELAEKQKLLSDLAAERQDLEAR 62 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + + +L K+LL+E+AR L L+ +E ++ Sbjct: 63 ARYLRTDNLSKELLEERARVLLGLNAPNEYVI 94 >gi|254476889|ref|ZP_05090275.1| septum formation initiator [Ruegeria sp. R11] gi|214031132|gb|EEB71967.1| septum formation initiator [Ruegeria sp. R11] Length = 99 Score = 77.9 bits (191), Expect = 4e-13, Method: Composition-based stats. Identities = 34/93 (36%), Positives = 48/93 (51%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + F IAF YFT A+ GD+GL ++ + L ELK +R+E Sbjct: 6 RPSLGAFAFSTIAFALSAYFTFAAVQGDFGLFRRVEIQAEAEALRQDLDELKRETARMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+AR L L R+DEI++ Sbjct: 66 LTHRLSDNYLDLDLLDEQARTVLGLLRADEIVI 98 >gi|296532890|ref|ZP_06895556.1| probable septum formation initiator protein [Roseomonas cervicalis ATCC 49957] gi|296266788|gb|EFH12747.1| probable septum formation initiator protein [Roseomonas cervicalis ATCC 49957] Length = 107 Score = 77.9 bits (191), Expect = 4e-13, Method: Composition-based stats. Identities = 24/98 (24%), Positives = 45/98 (45%), Gaps = 1/98 (1%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDY-GLKANKSLEKSLIERERFLSELKENRSRLE 66 K ++ + +F +A+ G G A ++ + L+E + R +E Sbjct: 5 KRAIQVLWLPLVFAGLIWHFAWYAVHGPRVGSLAREAKASEIAAARITLAEAEAERDSIE 64 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 RKV + +++D LDE+AR LN+ DE+++ Y Sbjct: 65 RKVAGLRGDRIDRDQLDERARALLNMVGKDELVVPYGQ 102 >gi|83858353|ref|ZP_00951875.1| hypothetical protein OA2633_02601 [Oceanicaulis alexandrii HTCC2633] gi|83853176|gb|EAP91028.1| hypothetical protein OA2633_02601 [Oceanicaulis alexandrii HTCC2633] Length = 110 Score = 77.9 bits (191), Expect = 5e-13, Method: Composition-based stats. Identities = 23/94 (24%), Positives = 48/94 (51%), Gaps = 4/94 (4%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 R I L+ + Y + HA+ G+ G + ++ + E L++++ R ++E +V Sbjct: 5 LKRFIPLIGLAIVISYLSYHALHGEQGYLNHLRIQAQISAAEAELADVRSTREQMEDRVA 64 Query: 71 LMS----DGSLEKDLLDEKARYSLNLSRSDEIIL 100 + D +++ D L+E+AR L + DEI++ Sbjct: 65 RLKAEGPDAAVDVDYLEERARAVLRFAHPDEIVV 98 >gi|58040703|ref|YP_192667.1| hypothetical protein GOX2278 [Gluconobacter oxydans 621H] gi|58003117|gb|AAW62011.1| Hypothetical protein GOX2278 [Gluconobacter oxydans 621H] Length = 109 Score = 77.5 bits (190), Expect = 6e-13, Method: Composition-based stats. Identities = 20/97 (20%), Positives = 46/97 (47%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K YF + + G +G+ A + + + + + + ++ R Sbjct: 8 KRGVRAVAPPAFFLSLTAYFGWNVLHGAHGIHAYQEQMQLQKDALQARQDADDEQNVWRR 67 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +V + + +L+ D+LDE+AR ++NL+RS ++++ Y Sbjct: 68 RVVALKEKALDADMLDERARATMNLTRSGDLVVPYGP 104 >gi|329889604|ref|ZP_08267947.1| septum formation initiator family protein [Brevundimonas diminuta ATCC 11568] gi|328844905|gb|EGF94469.1| septum formation initiator family protein [Brevundimonas diminuta ATCC 11568] Length = 106 Score = 76.7 bits (188), Expect = 1e-12, Method: Composition-based stats. Identities = 23/77 (29%), Positives = 40/77 (51%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 + Y A+ G+ GL + + L +R+ L L E R LE +V+ + SL KDLL+ Sbjct: 14 IAYLGVQALTGERGLLSGGERDALLAQRQTQLMRLAEQRQDLEVRVRYLRTESLSKDLLE 73 Query: 84 EKARYSLNLSRSDEIIL 100 E+AR + + + ++ Sbjct: 74 ERARAVIGFADPRDYVV 90 >gi|159044700|ref|YP_001533494.1| hypothetical protein Dshi_2157 [Dinoroseobacter shibae DFL 12] gi|157912460|gb|ABV93893.1| hypothetical protein Dshi_2157 [Dinoroseobacter shibae DFL 12] Length = 100 Score = 76.3 bits (187), Expect = 1e-12, Method: Composition-based stats. Identities = 34/98 (34%), Positives = 48/98 (48%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T K + A+ +IAF YF HA+ G+YGL E L+ L+ Sbjct: 2 TSKPKHSAVHGAVVTLIAFLVGTYFVFHAVQGEYGLFNRVQAEAEEARLRAELALLQGEL 61 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 LE K +SD L+ DLLDE+AR L +R +EI++ Sbjct: 62 RALENKTLRLSDQFLDLDLLDERARDVLGYARPNEIVI 99 >gi|260433373|ref|ZP_05787344.1| septum formation initiator [Silicibacter lacuscaerulensis ITI-1157] gi|260417201|gb|EEX10460.1| septum formation initiator [Silicibacter lacuscaerulensis ITI-1157] Length = 91 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 33/90 (36%), Positives = 47/90 (52%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 +F +AF VYFT A+ GDYGL + R L+ L R+E + Sbjct: 1 MGAVLFFSVAFLLGVYFTFAAVQGDYGLLRRVEIAAERDALSRDLAALNTEIVRMENLTR 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+AR L + R+DEI++ Sbjct: 61 RLSDTYLDLDLLDEQARSVLGMIRADEIVI 90 >gi|163742728|ref|ZP_02150113.1| hypothetical protein RG210_15325 [Phaeobacter gallaeciensis 2.10] gi|161383983|gb|EDQ08367.1| hypothetical protein RG210_15325 [Phaeobacter gallaeciensis 2.10] Length = 138 Score = 75.9 bits (186), Expect = 2e-12, Method: Composition-based stats. Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 1/98 (1%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T+ + + +F IAF YFT A+ GD+GL ++ + L +LK Sbjct: 41 TRSNRPS-LGAFVFSTIAFALSAYFTFAAVQGDFGLFRRVEIQAEAEALRQDLDQLKRET 99 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +++E +SD L+ DLLDE+AR L L R+DEI++ Sbjct: 100 AQMENLTHRLSDDYLDLDLLDEQARSVLGLLRADEIVI 137 >gi|294011434|ref|YP_003544894.1| septum formation initiator [Sphingobium japonicum UT26S] gi|292674764|dbj|BAI96282.1| septum formation initiator [Sphingobium japonicum UT26S] Length = 103 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 24/101 (23%), Positives = 46/101 (45%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + F A IA +++F + ++G G+ A ++ L L +++ Sbjct: 1 MAHIAKLRILLFSAFGPAIAVLLLLFFAGYVVLGSNGVLAWGDYKRQLHHARAELKQVQA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +R L+ +V L+ ++ DL DE R L + DE+I+ Sbjct: 61 SRQELKNRVDLLDPRRVDPDLSDELIRRELGVVHPDEVIVP 101 >gi|304321946|ref|YP_003855589.1| hypothetical protein PB2503_12019 [Parvularcula bermudensis HTCC2503] gi|303300848|gb|ADM10447.1| hypothetical protein PB2503_12019 [Parvularcula bermudensis HTCC2503] Length = 125 Score = 75.2 bits (184), Expect = 3e-12, Method: Composition-based stats. Identities = 26/88 (29%), Positives = 40/88 (45%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 Y + D GL + LE + R L+ L+ ++ LE + + + L Sbjct: 4 AFLVVTTGYNALLTVNSDEGLIVAERLEADIAARRDHLAALQSQKTALEERTDRLREDRL 63 Query: 78 EKDLLDEKARYSLNLSRSDEIILFYSDF 105 +KDLLDEK R L L+R DE ++ D Sbjct: 64 DKDLLDEKVRSVLGLARPDEYLVRMEDL 91 >gi|163736624|ref|ZP_02144043.1| hypothetical protein RGBS107_15871 [Phaeobacter gallaeciensis BS107] gi|161390494|gb|EDQ14844.1| hypothetical protein RGBS107_15871 [Phaeobacter gallaeciensis BS107] Length = 138 Score = 74.8 bits (183), Expect = 3e-12, Method: Composition-based stats. Identities = 33/98 (33%), Positives = 52/98 (53%), Gaps = 1/98 (1%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T+ + + +F IAF YFT A+ GD+GL ++ + L +LK Sbjct: 41 TRSNRPS-LGAFVFSTIAFALSAYFTFAAVQGDFGLFRRVEIQAEAEALRQDLDQLKRET 99 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +++E +SD L+ DLLDE+AR L L R+DEI++ Sbjct: 100 AQMENLTHRLSDDYLDLDLLDEQARSVLGLLRADEIVI 137 >gi|85706347|ref|ZP_01037441.1| hypothetical protein ROS217_15670 [Roseovarius sp. 217] gi|85669120|gb|EAQ23987.1| hypothetical protein ROS217_15670 [Roseovarius sp. 217] Length = 98 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 36/94 (38%), Positives = 52/94 (55%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 + + IF VIAF YFT A+ GDYGL ++ +E + L L +R+E Sbjct: 4 RSRPWGLLIFFVIAFFLGAYFTFAAVQGDYGLFRRAEIDAQSVELQAQLDALDARVARME 63 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLD++AR L L RSDEI++ Sbjct: 64 NLTRRLSDSYLDLDLLDQQAREVLGLLRSDEIVI 97 >gi|307295439|ref|ZP_07575275.1| Septum formation initiator [Sphingobium chlorophenolicum L-1] gi|306878478|gb|EFN09698.1| Septum formation initiator [Sphingobium chlorophenolicum L-1] Length = 103 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 24/101 (23%), Positives = 48/101 (47%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + F A IA + +F + ++G G+ A ++ L + + L +++ Sbjct: 1 MAHIAKLRMLLFSAFGPAIAVLLLFFFAGYVVLGSNGVLAWGDYKRQLHQAQGELKQVQA 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +R L+ +V L++ ++ DL DE R L + DE+I+ Sbjct: 61 HRQELKNRVDLLNPRRVDPDLSDELIRRELGVVHHDEVIVP 101 >gi|103486017|ref|YP_615578.1| septum formation initiator [Sphingopyxis alaskensis RB2256] gi|98976094|gb|ABF52245.1| Septum formation initiator [Sphingopyxis alaskensis RB2256] Length = 107 Score = 74.4 bits (182), Expect = 5e-12, Method: Composition-based stats. Identities = 26/105 (24%), Positives = 44/105 (41%), Gaps = 2/105 (1%) Query: 1 MWTKYYKKNHFFRAIFLVIA-FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELK 59 M ++ + RA +A + AI G GL A +S+ ++ LSEL Sbjct: 1 MTQRHKLRKSMRRATGPALAVIAVLAMLGY-AIFGPTGLYAWGEYSQSVEKKRVVLSELV 59 Query: 60 ENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + L+ +V L+ ++ DL +E R L DE+I+ Sbjct: 60 KKERELQNRVNLLDQRRVDPDLAEEYVRSKLGAYHPDEVIIPMEP 104 >gi|254461306|ref|ZP_05074722.1| septum formation initiator [Rhodobacterales bacterium HTCC2083] gi|206677895|gb|EDZ42382.1| septum formation initiator [Rhodobacteraceae bacterium HTCC2083] Length = 100 Score = 72.9 bits (178), Expect = 2e-11, Method: Composition-based stats. Identities = 33/93 (35%), Positives = 49/93 (52%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K I+ AF YFT A+ GDYG+ + + + LS+LK + +E Sbjct: 7 KPALGALIYFAAAFSLATYFTFAAVQGDYGVFRRAEIVVLARDLDVQLSQLKSEVAEMEN 66 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 K +SD L+ DLLD++AR L L R+DEI++ Sbjct: 67 LTKRLSDTYLDLDLLDQQARDVLGLLRADEIVV 99 >gi|254420950|ref|ZP_05034674.1| Septum formation initiator subfamily [Brevundimonas sp. BAL3] gi|196187127|gb|EDX82103.1| Septum formation initiator subfamily [Brevundimonas sp. BAL3] Length = 103 Score = 72.1 bits (176), Expect = 2e-11, Method: Composition-based stats. Identities = 25/76 (32%), Positives = 39/76 (51%) Query: 28 TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKAR 87 A+ G+ GL + S + + RE L+ L E R LE +V+ + SL KDLL+E+AR Sbjct: 22 GVQALTGERGLLSGSSRDALMGRRENQLAHLTEQRRDLETRVRYLRTDSLSKDLLEERAR 81 Query: 88 YSLNLSRSDEIILFYS 103 L S + ++ Sbjct: 82 AVLGFSDPRDYVIRVP 97 >gi|148261800|ref|YP_001235927.1| septum formation initiator [Acidiphilium cryptum JF-5] gi|146403481|gb|ABQ32008.1| Septum formation initiator [Acidiphilium cryptum JF-5] Length = 120 Score = 71.7 bits (175), Expect = 3e-11, Method: Composition-based stats. Identities = 23/94 (24%), Positives = 47/94 (50%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K + V+ YF +AI G G+ A + + L++ + L+++ R R + Sbjct: 2 KRRLRALVLPVLFLVVTAYFVFNAINGSRGIIAQRHDQAVLVKDRQSLTDVTARRDRWQA 61 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +V + ++ D+L+E+AR LNL+ D++ + Sbjct: 62 RVDALHHHAIAPDMLNEQARAVLNLADPDDLAVP 95 >gi|310815651|ref|YP_003963615.1| septum formation initiator [Ketogulonicigenium vulgare Y25] gi|308754386|gb|ADO42315.1| septum formation initiator [Ketogulonicigenium vulgare Y25] Length = 97 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 43/93 (46%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 + I++ A +YF AI GDYGL L L L+ +S LE Sbjct: 3 RTRPALGFIYIAAAVMAALYFMFAAIQGDYGLFRRIELNAEADALRTELGALRAEQSNLE 62 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 +SD L+ DLLDE+AR L R+DE++ Sbjct: 63 NLTHRLSDAYLDLDLLDERARNVLGYVRADEVV 95 >gi|254452318|ref|ZP_05065755.1| septum formation initiator [Octadecabacter antarcticus 238] gi|198266724|gb|EDY90994.1| septum formation initiator [Octadecabacter antarcticus 238] Length = 98 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 27/95 (28%), Positives = 49/95 (51%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 ++ ++ A +YFT A+ GD+G+ ++ + L+ L+ +L Sbjct: 3 RRRAPMGVLLYFAGALMLGLYFTFAAVQGDFGVFKRAEIDAEGRALTQELAILQMQVDQL 62 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E + +SD L+ DLLDE+AR L + R+DEI++ Sbjct: 63 ENLTRRLSDTYLDLDLLDEQARDMLGMVRADEIVI 97 >gi|225677021|ref|ZP_03788033.1| hypothetical protein WUni_005100 [Wolbachia endosymbiont of Muscidifurax uniraptor] gi|225590932|gb|EEH12147.1| hypothetical protein WUni_005100 [Wolbachia endosymbiont of Muscidifurax uniraptor] Length = 104 Score = 71.3 bits (174), Expect = 4e-11, Method: Composition-based stats. Identities = 25/97 (25%), Positives = 46/97 (47%) Query: 5 YYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSR 64 KK ++ +YF+ I G GL L+K + E L ++ + + Sbjct: 4 SKKKQKLLCLSVTLLISSLTLYFSISTITGKRGLLTLIDLKKEIEYNELLLKDVSSEKEK 63 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 L+ KV + + SL+ DLLDE+A+ +L +E+++ Sbjct: 64 LDNKVFGLYEKSLDLDLLDEQAKNALGYVNPNELMVV 100 >gi|56416781|ref|YP_153855.1| hypothetical protein AM594 [Anaplasma marginale str. St. Maries] gi|222475144|ref|YP_002563560.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Florida] gi|56388013|gb|AAV86600.1| hypothetical protein AM594 [Anaplasma marginale str. St. Maries] gi|222419281|gb|ACM49304.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Florida] Length = 119 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 26/92 (28%), Positives = 45/92 (48%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R +++A Y A+ G+ GL A L + L E LS + + + ++R+ L+ Sbjct: 27 RLCVILVACVVTCYLGAGAMFGERGLLAMLRLRQELRRYESDLSRIVQLKEEMKRRNALL 86 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + SL DLLDE++R L DE+++ Sbjct: 87 YEDSLSLDLLDERSRSVLGHVEPDELVVILKP 118 >gi|86138770|ref|ZP_01057342.1| hypothetical protein MED193_03342 [Roseobacter sp. MED193] gi|85824417|gb|EAQ44620.1| hypothetical protein MED193_03342 [Roseobacter sp. MED193] Length = 99 Score = 70.9 bits (173), Expect = 6e-11, Method: Composition-based stats. Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 1/98 (1%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T+ + + F V+AF YFT A+ GD+GL ++ E L LK Sbjct: 2 TRSNRPS-LGSFTFFVVAFALGAYFTFAAVQGDFGLFRRVEIQAEADELRLDLDRLKVEI 60 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +E +SD L+ DLLDE+AR L L R+DEI++ Sbjct: 61 AEIENLTHRLSDDYLDLDLLDEQARSVLGLLRADEIVI 98 >gi|255262304|ref|ZP_05341646.1| septum formation initiator [Thalassiobium sp. R2A62] gi|255104639|gb|EET47313.1| septum formation initiator [Thalassiobium sp. R2A62] Length = 120 Score = 70.2 bits (171), Expect = 9e-11, Method: Composition-based stats. Identities = 27/99 (27%), Positives = 48/99 (48%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKEN 61 K+ F ++ F +YFT A+ GD+G+ ++ L+E++ Sbjct: 21 QMTLRKRPAFGALMYFSCIFMLGLYFTFAAVQGDFGVFKRAQVDAEADTLAVELAEVQAQ 80 Query: 62 RSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +E + +SD L+ DLLD +AR L + R+DEI++ Sbjct: 81 VDTMENLTQRLSDKYLDLDLLDTQARDVLGMIRADEIVI 119 >gi|254437248|ref|ZP_05050742.1| Septum formation initiator subfamily [Octadecabacter antarcticus 307] gi|198252694|gb|EDY77008.1| Septum formation initiator subfamily [Octadecabacter antarcticus 307] Length = 98 Score = 69.8 bits (170), Expect = 1e-10, Method: Composition-based stats. Identities = 28/95 (29%), Positives = 49/95 (51%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 ++ ++ A +YFT A+ GD+G+ ++ + L+ L+ RL Sbjct: 3 RRRAPIGVLLYFSGALMLGLYFTFAAVQGDFGVFKRAEIDAEGRALTQELALLQTQVDRL 62 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E + +SD L+ DLLDE+AR L + R+DEI++ Sbjct: 63 ENLTRRLSDTFLDLDLLDEQARDMLGMIRTDEIVI 97 >gi|254994982|ref|ZP_05277172.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Mississippi] gi|255003126|ref|ZP_05278090.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Puerto Rico] gi|255004252|ref|ZP_05279053.1| Conserved family - Septum formation initiator [Anaplasma marginale str. Virginia] Length = 103 Score = 69.4 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 26/92 (28%), Positives = 45/92 (48%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R +++A Y A+ G+ GL A L + L E LS + + + ++R+ L+ Sbjct: 11 RLCVILVACVVTCYLGAGAMFGERGLLAMLRLRQELRRYESDLSRIVQLKEEMKRRNALL 70 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + SL DLLDE++R L DE+++ Sbjct: 71 YEDSLSLDLLDERSRSVLGHVEPDELVVILKP 102 >gi|84503370|ref|ZP_01001439.1| hypothetical protein OB2597_04485 [Oceanicola batsensis HTCC2597] gi|84388280|gb|EAQ01231.1| hypothetical protein OB2597_04485 [Oceanicola batsensis HTCC2597] Length = 99 Score = 69.4 bits (169), Expect = 1e-10, Method: Composition-based stats. Identities = 32/93 (34%), Positives = 49/93 (52%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + F I+ FC +YFT A+ G+ GL +E L L+ + +R+E Sbjct: 6 RPAFSGLIYFAGVFCVGMYFTFSAVQGEMGLFRRTEIEADRDALIEQLDVLQADIARMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLD++AR L L RSDEI++ Sbjct: 66 LTERLSDEYLDLDLLDQQARDVLGLMRSDEIVI 98 >gi|114569964|ref|YP_756644.1| septum formation initiator [Maricaulis maris MCS10] gi|114340426|gb|ABI65706.1| Septum formation initiator [Maricaulis maris MCS10] Length = 122 Score = 69.4 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 24/89 (26%), Positives = 40/89 (44%) Query: 12 FRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKL 71 R + + YF HA+ G+ G+ +E + E E L+ R LE Sbjct: 26 KRFSTTALLTVAIAYFGYHALTGEQGVLNWIVVETEISEAEAELALAVAERESLEVTAAR 85 Query: 72 MSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + SL+ D ++E+AR LN++ E I+ Sbjct: 86 LRSDSLDLDYVEERARDILNVAHPREFIV 114 >gi|148554143|ref|YP_001261725.1| septum formation initiator [Sphingomonas wittichii RW1] gi|148499333|gb|ABQ67587.1| Septum formation initiator [Sphingomonas wittichii RW1] Length = 102 Score = 69.4 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 25/94 (26%), Positives = 37/94 (39%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 A +A + YF + A++G GL A L + L + R RL Sbjct: 8 QIARSAALPAVAILIIGYFASAALIGPNGLLALGGYRTQLQAKSDELHRTEAVRDRLRHH 67 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 KL+ ++ D +E R S R DEII+ Sbjct: 68 AKLLDPSRVDPDFGEELVRRSTGQVRPDEIIIPR 101 >gi|77463043|ref|YP_352547.1| hypothetical protein RSP_4046 [Rhodobacter sphaeroides 2.4.1] gi|126461918|ref|YP_001043032.1| septum formation initiator [Rhodobacter sphaeroides ATCC 17029] gi|221638901|ref|YP_002525163.1| septum formation initiator [Rhodobacter sphaeroides KD131] gi|332557919|ref|ZP_08412241.1| Septum formation initiator precursor [Rhodobacter sphaeroides WS8N] gi|77387461|gb|ABA78646.1| conserved hypothetical protein [Rhodobacter sphaeroides 2.4.1] gi|126103582|gb|ABN76260.1| Septum formation initiator [Rhodobacter sphaeroides ATCC 17029] gi|221159682|gb|ACM00662.1| Septum formation initiator precursor [Rhodobacter sphaeroides KD131] gi|332275631|gb|EGJ20946.1| Septum formation initiator precursor [Rhodobacter sphaeroides WS8N] Length = 100 Score = 69.4 bits (169), Expect = 2e-10, Method: Composition-based stats. Identities = 27/93 (29%), Positives = 47/93 (50%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + +++ +AF VYFT A+ GDYG+ ++ + + +E Sbjct: 7 RPAIGASLYFALAFSLSVYFTFAAVQGDYGVFRQVQIQAEAEALRSERDRIAAELADMEN 66 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + + +SD L+ DLLDE+AR L R+DEI++ Sbjct: 67 RTRRLSDSYLDLDLLDEQARSVLGYVRADEIVI 99 >gi|42520224|ref|NP_966139.1| hypothetical protein WD0343 [Wolbachia endosymbiont of Drosophila melanogaster] gi|225630233|ref|YP_002727024.1| hypothetical protein WRi_004450 [Wolbachia sp. wRi] gi|42409962|gb|AAS14073.1| conserved hypothetical protein [Wolbachia endosymbiont of Drosophila melanogaster] gi|225592214|gb|ACN95233.1| hypothetical protein WRi_004450 [Wolbachia sp. wRi] Length = 104 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 24/97 (24%), Positives = 46/97 (47%) Query: 5 YYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSR 64 KK ++ +YF+ I G GL L+K + + L ++ + + Sbjct: 4 SKKKQKLLCLSAALLISSLTLYFSISTITGKRGLLTLIDLKKEIEYNKLLLKDVSSEKEK 63 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 L+ KV + + SL+ DLLDE+A+ +L +E+++ Sbjct: 64 LDNKVFGLYEKSLDLDLLDEQAKNALGYVNPNELMVV 100 >gi|149913851|ref|ZP_01902383.1| Septum formation initiator [Roseobacter sp. AzwK-3b] gi|149812135|gb|EDM71966.1| Septum formation initiator [Roseobacter sp. AzwK-3b] Length = 91 Score = 69.0 bits (168), Expect = 2e-10, Method: Composition-based stats. Identities = 32/90 (35%), Positives = 46/90 (51%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 I+ +IAF YFT A+ GDYGL ++ L +L +R+E Sbjct: 1 MGLFIYSLIAFGLGAYFTFAAVQGDYGLFRRAEIDAETDALRAQLKDLSVQVARMENLTL 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLD++AR L L R DEI++ Sbjct: 61 RLSDDFLDTDLLDQQARDVLGLLRPDEIVI 90 >gi|110680206|ref|YP_683213.1| hypothetical protein RD1_3010 [Roseobacter denitrificans OCh 114] gi|109456322|gb|ABG32527.1| conserved hypothetical protein [Roseobacter denitrificans OCh 114] Length = 99 Score = 67.9 bits (165), Expect = 4e-10, Method: Composition-based stats. Identities = 28/93 (30%), Positives = 46/93 (49%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + F IF +A YFT A+ GD+G+ + + LS ++ + +E Sbjct: 6 RPAFGTFIFFTLALGLATYFTFAAVQGDFGVFKRAEITAEANVLRQQLSAVQADVQEMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+ R L + R+DEI++ Sbjct: 66 LTLRLSDDYLDLDLLDEQVRRVLGMIRADEIVI 98 >gi|163731360|ref|ZP_02138807.1| hypothetical protein RLO149_18689 [Roseobacter litoralis Och 149] gi|161394814|gb|EDQ19136.1| hypothetical protein RLO149_18689 [Roseobacter litoralis Och 149] Length = 99 Score = 67.9 bits (165), Expect = 5e-10, Method: Composition-based stats. Identities = 28/93 (30%), Positives = 45/93 (48%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + F IF +A YFT A+ GD+G+ + + L +K + +E Sbjct: 6 RPAFGTFIFFALALGLGTYFTFAAVQGDFGVFKRAEITAEASMLRQQLHAVKADVDEMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+ R L + R+DEI++ Sbjct: 66 LTLRLSDDYLDLDLLDEQVRRVLGMIRADEIVI 98 >gi|87200026|ref|YP_497283.1| septum formation initiator [Novosphingobium aromaticivorans DSM 12444] gi|87135707|gb|ABD26449.1| Septum formation initiator [Novosphingobium aromaticivorans DSM 12444] Length = 102 Score = 67.5 bits (164), Expect = 6e-10, Method: Composition-based stats. Identities = 21/70 (30%), Positives = 38/70 (54%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 I G GL A + L +R+ +++L R RL+ +V L+ + DL+ E R +LN Sbjct: 30 IAGPSGLLAWGENARLLDQRQHEIAQLTAERDRLKNRVALLDPRHADPDLVGELLRSNLN 89 Query: 92 LSRSDEIILF 101 ++ DE+++ Sbjct: 90 VAHPDELVIP 99 >gi|83950363|ref|ZP_00959096.1| hypothetical protein ISM_04675 [Roseovarius nubinhibens ISM] gi|83838262|gb|EAP77558.1| hypothetical protein ISM_04675 [Roseovarius nubinhibens ISM] Length = 114 Score = 67.1 bits (163), Expect = 7e-10, Method: Composition-based stats. Identities = 34/95 (35%), Positives = 49/95 (51%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 K I+ I F +YFT A+ GD+GL +E E L L+ +R+ Sbjct: 19 RKPPAMGVLIYFAITFALGLYFTFAAVQGDFGLFRRAEIEAETRALEARLEALESQVARM 78 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E + +SD L+ DLLD++AR L L RSDEI++ Sbjct: 79 ENLTRRLSDSYLDLDLLDQQARDVLGLMRSDEIVI 113 >gi|300023189|ref|YP_003755800.1| hypothetical protein Hden_1672 [Hyphomicrobium denitrificans ATCC 51888] gi|299525010|gb|ADJ23479.1| hypothetical protein Hden_1672 [Hyphomicrobium denitrificans ATCC 51888] Length = 109 Score = 67.1 bits (163), Expect = 8e-10, Method: Composition-based stats. Identities = 29/98 (29%), Positives = 47/98 (47%), Gaps = 1/98 (1%) Query: 4 KYYKKNHFFRAIFLVIA-FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + + H R IF+++A YF HA G +G +A L + + L+ R Sbjct: 9 RRNRHRHLTRQIFVLLACLTSTSYFVYHARYGRHGFEARTRLIERSALLDFENRGLESVR 68 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 ++L R V L+S DL++E AR L RS++ I+ Sbjct: 69 AKLRRDVALLSPEVPNSDLVEEIARDVLGYVRSNDKIV 106 >gi|260576742|ref|ZP_05844727.1| Septum formation initiator [Rhodobacter sp. SW2] gi|259020994|gb|EEW24305.1| Septum formation initiator [Rhodobacter sp. SW2] Length = 100 Score = 66.7 bits (162), Expect = 9e-10, Method: Composition-based stats. Identities = 27/100 (27%), Positives = 46/100 (46%), Gaps = 1/100 (1%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + + I + A YFT A+ GD+G+ ++ LK+ Sbjct: 1 MTIRSNRPAISNALILMA-AVLIGGYFTFAAVQGDFGVFRQVQIKAEAEALRAERDRLKQ 59 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + ++ + +SD L+ DLLDE+AR L R+DEI++ Sbjct: 60 ALAEMQNRTLRLSDAYLDLDLLDEQARDVLGYIRADEIVI 99 >gi|126735931|ref|ZP_01751675.1| Septum formation initiator [Roseobacter sp. CCS2] gi|126714488|gb|EBA11355.1| Septum formation initiator [Roseobacter sp. CCS2] Length = 99 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 27/95 (28%), Positives = 46/95 (48%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 + + + +YFT A+ GDYGL ++ L+ L+ +R+ Sbjct: 4 RSRPQLGALFYFLGMIMLGLYFTFAAVQGDYGLFKRIEVKAEGDALAVELAALQTEVARM 63 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E +SD L+ DLLD++AR L + R+DEI++ Sbjct: 64 ENLTTRLSDNFLDLDLLDQQARDVLGMIRADEIVI 98 >gi|83943193|ref|ZP_00955653.1| hypothetical protein EE36_13468 [Sulfitobacter sp. EE-36] gi|83954328|ref|ZP_00963048.1| hypothetical protein NAS141_18519 [Sulfitobacter sp. NAS-14.1] gi|83841365|gb|EAP80535.1| hypothetical protein NAS141_18519 [Sulfitobacter sp. NAS-14.1] gi|83846201|gb|EAP84078.1| hypothetical protein EE36_13468 [Sulfitobacter sp. EE-36] Length = 99 Score = 66.7 bits (162), Expect = 1e-09, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 50/93 (53%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K F +F IAF +YF AI G+YGL + + L++++ + +R+E Sbjct: 6 KPAFGTLLFFAIAFALSLYFAFAAIQGNYGLFRRAEIVAEAQDLRVQLAQVQIDVARMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+ R L + R+DEI++ Sbjct: 66 LTHRLSDEYLDLDLLDEQTRKVLGMIRADEIVI 98 >gi|149184586|ref|ZP_01862904.1| Septum formation initiator [Erythrobacter sp. SD-21] gi|148831906|gb|EDL50339.1| Septum formation initiator [Erythrobacter sp. SD-21] Length = 104 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 21/68 (30%), Positives = 35/68 (51%) Query: 37 GLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD 96 GL A + L +RE L L++ R+ L+ KV L+ + D++ E R LN+ D Sbjct: 37 GLLAWSENLRLLDQREAQLEALQKERAALQNKVALLHPDHADPDMVGELLRSQLNVVHPD 96 Query: 97 EIILFYSD 104 E+++ D Sbjct: 97 EVVIKLED 104 >gi|85374109|ref|YP_458171.1| hypothetical protein ELI_06410 [Erythrobacter litoralis HTCC2594] gi|84787192|gb|ABC63374.1| hypothetical protein ELI_06410 [Erythrobacter litoralis HTCC2594] Length = 117 Score = 65.9 bits (160), Expect = 2e-09, Method: Composition-based stats. Identities = 19/71 (26%), Positives = 33/71 (46%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G A E+ L +R+ ++ L E R L +V + + D++ E R +LN+ Sbjct: 45 GPSGALAWSEYEQLLDQRQDQIAALNEERDELRNRVAALDPEGADPDMVGELLRKNLNVV 104 Query: 94 RSDEIILFYSD 104 DE++L Sbjct: 105 HPDEVVLPIEP 115 >gi|56697102|ref|YP_167465.1| hypothetical protein SPO2239 [Ruegeria pomeroyi DSS-3] gi|56678839|gb|AAV95505.1| conserved hypothetical protein [Ruegeria pomeroyi DSS-3] Length = 99 Score = 65.5 bits (159), Expect = 3e-09, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 51/93 (54%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + +F ++F +YFT A+ GD+GL + R L++++E R+E Sbjct: 6 RPSIGAIVFFAVSFALAIYFTFAAVQGDFGLFRRVEIAAEREVLSRDLAKVEEQIVRMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLDE+AR L L R+DEI++ Sbjct: 66 LTRRLSDDYLDLDLLDEQARSVLGLLRADEIVI 98 >gi|84517286|ref|ZP_01004640.1| hypothetical protein SKA53_05620 [Loktanella vestfoldensis SKA53] gi|84508766|gb|EAQ05229.1| hypothetical protein SKA53_05620 [Loktanella vestfoldensis SKA53] Length = 82 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 29/80 (36%), Positives = 43/80 (53%) Query: 21 FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 +YFT A+ GDYGL + L+ L+ +R+E +SD L+ D Sbjct: 2 IVLGLYFTFAAVQGDYGLFKRVEVRAESAALRLELAGLQAEVARMENLTTRLSDNFLDLD 61 Query: 81 LLDEKARYSLNLSRSDEIIL 100 LLDE+AR+ L L R+DEI++ Sbjct: 62 LLDEQARHLLGLIRADEIVI 81 >gi|163746653|ref|ZP_02154010.1| hypothetical protein OIHEL45_14659 [Oceanibulbus indolifex HEL-45] gi|161379767|gb|EDQ04179.1| hypothetical protein OIHEL45_14659 [Oceanibulbus indolifex HEL-45] Length = 99 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 51/93 (54%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + F +F IAF +YFT A+ GD+GL + + L+E++ +R+E Sbjct: 6 RPAFGTLLFFAIAFALSLYFTFAAVQGDFGLFRRTEIVAENQKLSDRLAEVRAEVARMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLDE+ R L + R+DEI++ Sbjct: 66 LTRRLSDDYLDLDLLDERTRKVLGMVRTDEIVI 98 >gi|114767395|ref|ZP_01446198.1| hypothetical protein 1100011001252_R2601_23525 [Pelagibaca bermudensis HTCC2601] gi|114540512|gb|EAU43590.1| hypothetical protein R2601_23525 [Roseovarius sp. HTCC2601] Length = 99 Score = 65.2 bits (158), Expect = 3e-09, Method: Composition-based stats. Identities = 31/95 (32%), Positives = 47/95 (49%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 +K F I+ I YF A+ GD+GL +E L L+ +R+ Sbjct: 4 RRKPAFGVVIYTAITLSLSGYFVFAAVQGDFGLFRRAEIEVEGDRLAGELKSLEGEVARM 63 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E + +SD L+ DLLD++AR L + RSDEI++ Sbjct: 64 ENLTRRLSDDYLDLDLLDQQARDVLGVMRSDEIVV 98 >gi|296284154|ref|ZP_06862152.1| hypothetical protein CbatJ_11046 [Citromicrobium bathyomarinum JL354] Length = 113 Score = 64.8 bits (157), Expect = 4e-09, Method: Composition-based stats. Identities = 23/73 (31%), Positives = 41/73 (56%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 I G G+ A K+L ERE +++L++ R+ L ++V + + + D++ E R +LN Sbjct: 37 IAGPSGIFAWSDASKALAEREARIAKLQDQRADLRQRVDALDPDNADPDMVVEMMRRNLN 96 Query: 92 LSRSDEIILFYSD 104 + DE+IL D Sbjct: 97 VVHPDEVILPKPD 109 >gi|269958808|ref|YP_003328596.1| hypothetical protein ACIS_00720 [Anaplasma centrale str. Israel] gi|269848638|gb|ACZ49282.1| hypothetical protein ACIS_00720 [Anaplasma centrale str. Israel] Length = 119 Score = 64.4 bits (156), Expect = 5e-09, Method: Composition-based stats. Identities = 24/81 (29%), Positives = 39/81 (48%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 Y + GD GL A L + L E LS + + + ++R+ L+ + SL DLLD Sbjct: 38 TCYLGASVMFGDRGLLAMLRLRQELRRYEGDLSRMVQLKEEMQRRNALLYESSLNLDLLD 97 Query: 84 EKARYSLNLSRSDEIILFYSD 104 E++R L DE+++ Sbjct: 98 ERSRSVLGHVEPDELVVILKP 118 >gi|254486390|ref|ZP_05099595.1| septum formation initiator [Roseobacter sp. GAI101] gi|214043259|gb|EEB83897.1| septum formation initiator [Roseobacter sp. GAI101] Length = 99 Score = 64.0 bits (155), Expect = 7e-09, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 48/93 (51%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 + F +F IAF +YF AI G++GL + + L+ +K + R+E Sbjct: 6 RPAFGTLLFFAIAFALSLYFAFAAIQGNFGLFRRAEIVAEAQDLRLQLTSVKADVLRMEN 65 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +SD L+ DLLDE+ R L + RSDEI++ Sbjct: 66 LTARLSDDYLDLDLLDEQTRKVLGMIRSDEIVI 98 >gi|126728749|ref|ZP_01744564.1| hypothetical protein SSE37_07978 [Sagittula stellata E-37] gi|126710679|gb|EBA09730.1| hypothetical protein SSE37_07978 [Sagittula stellata E-37] Length = 87 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 28/85 (32%), Positives = 46/85 (54%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 F + YFT A+ GD+GL + + E+ L+ ++ ++E + +SD Sbjct: 2 FFAVTLSLSAYFTFAAVQGDFGLFRRAEIVVEGQKLEQELAAVQAEVLQMENLTRRLSDD 61 Query: 76 SLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLD++AR L L RSDEI++ Sbjct: 62 FLDLDLLDQQARDVLGLVRSDEIVV 86 >gi|94498559|ref|ZP_01305114.1| hypothetical protein SKA58_08299 [Sphingomonas sp. SKA58] gi|94422002|gb|EAT07048.1| hypothetical protein SKA58_08299 [Sphingomonas sp. SKA58] Length = 103 Score = 63.6 bits (154), Expect = 8e-09, Method: Composition-based stats. Identities = 22/101 (21%), Positives = 43/101 (42%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M + A IA ++ F + ++G G+ A + L + L + ++ Sbjct: 1 MAHIAKLRLLLVSAFGPAIALLLLLTFAGYVVLGSNGVLAWGDYSRQLHGAKLELKKTQQ 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 R+ L +V ++ ++ DL DE R L + DE+I+ Sbjct: 61 ARAELRNRVDALNPRRVDPDLADELVRRQLGVIHHDEVIVP 101 >gi|85708701|ref|ZP_01039767.1| hypothetical protein NAP1_05660 [Erythrobacter sp. NAP1] gi|85690235|gb|EAQ30238.1| hypothetical protein NAP1_05660 [Erythrobacter sp. NAP1] Length = 99 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 24/74 (32%), Positives = 38/74 (51%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSL 90 AI G GL A + L +R+ ++ LKE R L+ +V+L+ + DL+ E R L Sbjct: 25 AIAGPTGLLAWAENGEVLEQRQVRITLLKEKRDALKNRVELLDPEGADPDLVSELVREDL 84 Query: 91 NLSRSDEIILFYSD 104 + DEI++ D Sbjct: 85 GVIHPDEIVITLED 98 >gi|114800148|ref|YP_760678.1| septum formation initiator family protein [Hyphomonas neptunium ATCC 15444] gi|114740322|gb|ABI78447.1| septum formation initiator family protein [Hyphomonas neptunium ATCC 15444] Length = 101 Score = 63.2 bits (153), Expect = 1e-08, Method: Composition-based stats. Identities = 23/83 (27%), Positives = 40/83 (48%) Query: 22 CCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDL 81 V+YF HA G+ GL + L R+ L E+++ RL ++ ++ GS++ D Sbjct: 14 LLVLYFAFHAFAGEKGLGRWTDAQIELETRKTELVEMQQEIERLRVDIRRLTPGSVDPDY 73 Query: 82 LDEKARYSLNLSRSDEIILFYSD 104 ++ AR L EI+L + Sbjct: 74 VEALARDKLAFVYPGEIVLLTPE 96 >gi|259418956|ref|ZP_05742873.1| septum formation initiator [Silicibacter sp. TrichCH4B] gi|259345178|gb|EEW57032.1| septum formation initiator [Silicibacter sp. TrichCH4B] Length = 99 Score = 62.5 bits (151), Expect = 2e-08, Method: Composition-based stats. Identities = 29/76 (38%), Positives = 44/76 (57%) Query: 25 VYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDE 84 YFT A+ GD+GL L+ + L L+ +R+E + +SD L+ DLLDE Sbjct: 23 AYFTFAAVQGDFGLFRRVELQAEADGLTKDLERLELEIARMENLTRRLSDDYLDLDLLDE 82 Query: 85 KARYSLNLSRSDEIIL 100 +AR L ++R+DEII+ Sbjct: 83 QARSMLGMARADEIIV 98 >gi|89054183|ref|YP_509634.1| septum formation initiator [Jannaschia sp. CCS1] gi|88863732|gb|ABD54609.1| Septum formation initiator [Jannaschia sp. CCS1] Length = 104 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 33/91 (36%), Positives = 46/91 (50%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 RAI I F VYFT A+ G+ GL +E L+ L+ +R+E + Sbjct: 14 LTRAIMPGILFLVGVYFTFAAVQGNNGLFQRIQVEAERDRLVEELARLEMQTARMEILTR 73 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +SD L+ DLLDE+ R L +R DE+IL Sbjct: 74 RLSDDYLDLDLLDERVRNVLGYARPDEVILP 104 >gi|99080922|ref|YP_613076.1| septum formation initiator [Ruegeria sp. TM1040] gi|99037202|gb|ABF63814.1| Septum formation initiator [Ruegeria sp. TM1040] Length = 99 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 29/76 (38%), Positives = 44/76 (57%) Query: 25 VYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDE 84 YFT A+ GD+GL L+ + L L+ +R+E + +SD L+ DLLDE Sbjct: 23 AYFTFAAVQGDFGLFRRVELQAEADGLAKDLERLEVEIARMENLTRRLSDDYLDLDLLDE 82 Query: 85 KARYSLNLSRSDEIIL 100 +AR L ++R+DEII+ Sbjct: 83 QARSVLGMARADEIII 98 >gi|260427253|ref|ZP_05781232.1| septum formation initiator [Citreicella sp. SE45] gi|260421745|gb|EEX14996.1| septum formation initiator [Citreicella sp. SE45] Length = 99 Score = 62.1 bits (150), Expect = 2e-08, Method: Composition-based stats. Identities = 30/95 (31%), Positives = 48/95 (50%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 + F I+ I YF A+ GD+GL +E L +L+++ +R+ Sbjct: 4 RRNPPFGIVIYAAITLSLSAYFVFAAVQGDFGLFRRAEIEIEGEHLAEELVQLEKDVARM 63 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 E +SD L+ DLLD++AR L L R+DEI++ Sbjct: 64 ENLTLRLSDDYLDLDLLDQQARDVLGLMRADEIVV 98 >gi|326387835|ref|ZP_08209441.1| septum formation initiator [Novosphingobium nitrogenifigens DSM 19370] gi|326207881|gb|EGD58692.1| septum formation initiator [Novosphingobium nitrogenifigens DSM 19370] Length = 92 Score = 62.1 bits (150), Expect = 3e-08, Method: Composition-based stats. Identities = 22/72 (30%), Positives = 38/72 (52%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSL 90 AI G G+ A + L + +R +++L R RL +V+L+ + DL+ E R L Sbjct: 17 AIAGPSGMLAWTENARMLEQDQREIAKLTAQRDRLHNRVELLDPHHADPDLVGELLRRDL 76 Query: 91 NLSRSDEIILFY 102 N++ DE++L Sbjct: 77 NVAHPDEVVLPR 88 >gi|126725376|ref|ZP_01741218.1| hypothetical protein RB2150_04208 [Rhodobacterales bacterium HTCC2150] gi|126704580|gb|EBA03671.1| hypothetical protein RB2150_04208 [Rhodobacterales bacterium HTCC2150] Length = 100 Score = 60.5 bits (146), Expect = 8e-08, Method: Composition-based stats. Identities = 31/93 (33%), Positives = 51/93 (54%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K+ I++ A +YFT A+ GD+GL +E E R ++L+ + +E Sbjct: 7 KSGIGGLIYVSGALALGMYFTFGAVQGDFGLFRRVQIEAEKQELIRERNDLERQLASIEN 66 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 K + +SD L+ DLLD++AR L + R +EII+ Sbjct: 67 KTRRLSDDYLDLDLLDQQARDILGVMRPNEIII 99 >gi|254463766|ref|ZP_05077177.1| septum formation initiator [Rhodobacterales bacterium Y4I] gi|206684674|gb|EDZ45156.1| septum formation initiator [Rhodobacterales bacterium Y4I] Length = 99 Score = 59.0 bits (142), Expect = 2e-07, Method: Composition-based stats. Identities = 29/78 (37%), Positives = 41/78 (52%) Query: 23 CVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 YFT A+ GD+GL ++ E L L N +E + +SD L+ DLL Sbjct: 21 LSAYFTFAAVQGDFGLFRRVEIQAEAEELRLDLGRLHSNIGDMENLTRRLSDDYLDLDLL 80 Query: 83 DEKARYSLNLSRSDEIIL 100 DE+AR L L R+DEI++ Sbjct: 81 DEQARSVLGLVRADEIVI 98 >gi|114768959|ref|ZP_01446585.1| hypothetical protein OM2255_04495 [alpha proteobacterium HTCC2255] gi|114549876|gb|EAU52757.1| hypothetical protein OM2255_04495 [alpha proteobacterium HTCC2255] Length = 101 Score = 58.2 bits (140), Expect = 4e-07, Method: Composition-based stats. Identities = 28/77 (36%), Positives = 40/77 (51%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 YF AI GDYG +E L LK R +L+ K +SDG L+ DLLD Sbjct: 24 TSYFVFAAIQGDYGHIKRIQVESEERRLVLRLEALKLEREQLKNKTYRLSDGYLDLDLLD 83 Query: 84 EKARYSLNLSRSDEIIL 100 E+ R L ++R +++I+ Sbjct: 84 ERVRKVLGMARVNDVII 100 >gi|254294051|ref|YP_003060074.1| septum formation initiator [Hirschia baltica ATCC 49814] gi|254042582|gb|ACT59377.1| Septum formation initiator [Hirschia baltica ATCC 49814] Length = 94 Score = 57.1 bits (137), Expect = 9e-07, Method: Composition-based stats. Identities = 22/82 (26%), Positives = 40/82 (48%) Query: 19 IAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE 78 + + Y +A+ GD GL +L+K E L ++ + + K+ + +L+ Sbjct: 9 VLSLVLFYLAYNALAGDQGLAKWTNLQKREKELILELEVIQGEKDVVYEKIHRLRPETLD 68 Query: 79 KDLLDEKARYSLNLSRSDEIIL 100 D ++E AR L +R DE+IL Sbjct: 69 LDYIEEIARKKLAYAREDEVIL 90 >gi|84687412|ref|ZP_01015290.1| hypothetical protein 1099457000250_RB2654_05210 [Maritimibacter alkaliphilus HTCC2654] gi|84664570|gb|EAQ11056.1| hypothetical protein RB2654_05210 [Rhodobacterales bacterium HTCC2654] Length = 88 Score = 56.7 bits (136), Expect = 1e-06, Method: Composition-based stats. Identities = 28/86 (32%), Positives = 45/86 (52%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 ++L+ YFT ++ GDYGL ++ + L + LE K + +SD Sbjct: 2 LYLLGLISAGTYFTFASVQGDYGLFRRVRIDAEAQTLAQERDRLAAEIATLENKTRRISD 61 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 L+ DLLD++AR L L R+DE++L Sbjct: 62 DFLDLDLLDQQARDVLGLVRADEVVL 87 >gi|119386600|ref|YP_917655.1| septum formation initiator [Paracoccus denitrificans PD1222] gi|119377195|gb|ABL71959.1| Septum formation initiator [Paracoccus denitrificans PD1222] Length = 97 Score = 55.5 bits (133), Expect = 3e-06, Method: Composition-based stats. Identities = 29/87 (33%), Positives = 43/87 (49%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 IF ++ VYF A+ G G+ L+ E + L+ R+ + +S Sbjct: 10 LIFFIVMILLGVYFAYAAVQGPSGILRRVQLQAETQELIQQRDRLQAEVDRMRNLTRRLS 69 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIIL 100 D L+ DLLDE+AR L L R+DEII+ Sbjct: 70 DEYLDLDLLDERARDVLGLVRADEIII 96 >gi|329850653|ref|ZP_08265498.1| septum formation initiator [Asticcacaulis biprosthecum C19] gi|328840968|gb|EGF90539.1| septum formation initiator [Asticcacaulis biprosthecum C19] Length = 63 Score = 55.1 bits (132), Expect = 3e-06, Method: Composition-based stats. Identities = 19/54 (35%), Positives = 29/54 (53%) Query: 50 ERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + L++LK RS LE + K + +L +DLL+E+AR L LS I+ Sbjct: 3 AKTEQLAQLKAERSDLEARAKYLRTDNLSRDLLEERARVLLGLSEPKAYIIRQP 56 >gi|114777195|ref|ZP_01452206.1| hypothetical protein SPV1_09018 [Mariprofundus ferrooxydans PV-1] gi|114552340|gb|EAU54823.1| hypothetical protein SPV1_09018 [Mariprofundus ferrooxydans PV-1] Length = 117 Score = 53.6 bits (128), Expect = 1e-05, Method: Composition-based stats. Identities = 16/95 (16%), Positives = 36/95 (37%), Gaps = 3/95 (3%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 R + V Y + + D+G ++ + L + ++ LK+ R L ++ Sbjct: 3 RIVIRWLLWSAGLMAVAYMSWTLVFSDHGYLVYRNEAQQLQQLRAEVARLKQQREALAKE 62 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + + + + D L++ L DE +L Sbjct: 63 ILHLRN---DPDALEKLVHRDLGYVYPDEFMLIMP 94 >gi|294677243|ref|YP_003577858.1| septum formation initiator [Rhodobacter capsulatus SB 1003] gi|294476063|gb|ADE85451.1| septum formation initiator [Rhodobacter capsulatus SB 1003] Length = 99 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 23/91 (25%), Positives = 42/91 (46%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 +F A + F A+ G G+ ++ + + +L+ ++R+ Sbjct: 8 RVVPFVFYSAATVLGLNFAFAAMQGPNGIFHRVQVDAEIEKLTVERDKLEAEKARMANLT 67 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + +SD L+ DLLDE+AR L R DEI++ Sbjct: 68 RRLSDDYLDLDLLDERAREVLGTLRGDEIVI 98 >gi|260753834|ref|YP_003226727.1| septum formation initiator [Zymomonas mobilis subsp. mobilis NCIMB 11163] gi|258553197|gb|ACV76143.1| Septum formation initiator [Zymomonas mobilis subsp. mobilis NCIMB 11163] Length = 122 Score = 52.5 bits (125), Expect = 2e-05, Method: Composition-based stats. Identities = 25/104 (24%), Positives = 45/104 (43%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M K + F AI + + F +A++G GL A + + R+ L+ L+ Sbjct: 18 MSLIRSKNSLFRAAIGPALMVVVLGVFVGNALLGANGLLALDGYRQKMAVRKAELAALEH 77 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +L + L++ + + D +E R R DE+I+ S Sbjct: 78 QRDQLANSIALLNPKATDPDYAEELVRKETRQIRPDEVIILDSQ 121 >gi|283856509|ref|YP_163342.2| septum formation initiator [Zymomonas mobilis subsp. mobilis ZM4] gi|283775513|gb|AAV90231.2| Septum formation initiator [Zymomonas mobilis subsp. mobilis ZM4] Length = 105 Score = 51.7 bits (123), Expect = 3e-05, Method: Composition-based stats. Identities = 25/104 (24%), Positives = 45/104 (43%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M K + F AI + + F +A++G GL A + + R+ L+ L+ Sbjct: 1 MSLIRSKNSLFRAAIGPALMVVVLGVFVGNALLGANGLLALDGYRQKMAVRKAELAALEH 60 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 R +L + L++ + + D +E R R DE+I+ S Sbjct: 61 QRDQLANSIALLNPKATDPDYAEELVRKETRQIRPDEVIILDSQ 104 >gi|322435254|ref|YP_004217466.1| Septum formation initiator [Acidobacterium sp. MP5ACTX9] gi|321162981|gb|ADW68686.1| Septum formation initiator [Acidobacterium sp. MP5ACTX9] Length = 117 Score = 50.9 bits (121), Expect = 5e-05, Method: Composition-based stats. Identities = 17/76 (22%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Query: 29 NHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 H + G GL + + I +R L++L + RL+ V + + + ++ +AR Sbjct: 40 YHVVFGHNGLTVYEQKRQETISLDRQLNDLNRDNDRLQGHVDRLQS---DPNAIEHQARE 96 Query: 89 SLNLSRSDEIILFYSD 104 L+ +R E+I+ Sbjct: 97 ELHYTRPGEVIITLPP 112 >gi|322419460|ref|YP_004198683.1| Septum formation initiator [Geobacter sp. M18] gi|320125847|gb|ADW13407.1| Septum formation initiator [Geobacter sp. M18] Length = 138 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 24/88 (27%), Positives = 42/88 (47%), Gaps = 6/88 (6%) Query: 17 LVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGS 76 ++YFT + GD GL L + L + ++ LSELKE +L+R++ + Sbjct: 9 PAAVISFILYFT---VFGDRGLLRINHLHRDLDDTQKRLSELKEENDKLKREIAALQS-- 63 Query: 77 LEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ L+ AR L R +E+I + Sbjct: 64 -DRRYLESIARRDFGLVRGNEVIYQFPP 90 >gi|94968779|ref|YP_590827.1| cell division protein FtsB [Candidatus Koribacter versatilis Ellin345] gi|94550829|gb|ABF40753.1| cell division protein FtsB [Candidatus Koribacter versatilis Ellin345] Length = 121 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/103 (16%), Positives = 37/103 (35%), Gaps = 9/103 (8%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKEN 61 W ++ +K L A H + G G + + + +L Sbjct: 11 WEQWKRKAAIVATALLTCAVF------YHVVFGANGWMVYQKKKAEYQRLQGEFQKLNTE 64 Query: 62 RSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + L++ VK + +K ++ +AR L+ +R E++ Sbjct: 65 NAALQKDVKSLKS---DKSAIEREAREQLHYTRPGEVVYVMPQ 104 >gi|189424204|ref|YP_001951381.1| septum formation initiator [Geobacter lovleyi SZ] gi|189420463|gb|ACD94861.1| Septum formation initiator [Geobacter lovleyi SZ] Length = 99 Score = 49.8 bits (118), Expect = 1e-04, Method: Composition-based stats. Identities = 17/91 (18%), Positives = 39/91 (42%), Gaps = 6/91 (6%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 + I +++FT + G+ GL + + E +++L+ +L ++ + Sbjct: 11 WLIPAICLAFILFFT---VFGERGLLRIYEMRQEKQRIEHTVADLRIENQKLRSSIEALR 67 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ L+ AR L L R +E+I + Sbjct: 68 S---DRHQLERIARKELGLVRPNEVIYQFPP 95 >gi|320107230|ref|YP_004182820.1| Septum formation initiator [Terriglobus saanensis SP1PR4] gi|319925751|gb|ADV82826.1| Septum formation initiator [Terriglobus saanensis SP1PR4] Length = 135 Score = 49.4 bits (117), Expect = 2e-04, Method: Composition-based stats. Identities = 19/99 (19%), Positives = 37/99 (37%), Gaps = 7/99 (7%) Query: 5 YYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSR 64 Y ++ V+A H + G GL A + + L +L + R Sbjct: 38 YQRRRRMATGAVGVLALML----GYHVVFGRNGLTAFQQKRMDTKSLDAQLGDLTKENER 93 Query: 65 LERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 L V+ + + + ++ +AR L+ +R E+I Sbjct: 94 LHAHVERLKS---DPNAIEHEAREELHYTRPGEVIYTLP 129 >gi|126739337|ref|ZP_01755030.1| hypothetical protein RSK20926_20510 [Roseobacter sp. SK209-2-6] gi|126719437|gb|EBA16146.1| hypothetical protein RSK20926_20510 [Roseobacter sp. SK209-2-6] Length = 70 Score = 48.2 bits (114), Expect = 4e-04, Method: Composition-based stats. Identities = 26/69 (37%), Positives = 40/69 (57%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 + GD+GL ++ E L+ L+ S++E + +SD L+ DLLDE+AR L Sbjct: 1 MQGDFGLFKRVEIQAESEELRLDLARLQGEISQMENLTQRLSDDYLDLDLLDEQARSVLG 60 Query: 92 LSRSDEIIL 100 L RSDEI++ Sbjct: 61 LLRSDEIVI 69 >gi|197118666|ref|YP_002139093.1| septum formation initiator family protein [Geobacter bemidjiensis Bem] gi|197088026|gb|ACH39297.1| septum formation initiator family protein [Geobacter bemidjiensis Bem] Length = 128 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 + +++ + GD GL L + L + ++ LSELKE +L+R++ + Sbjct: 5 LFFVPLAVIIFILYFTVFGDRGLLRINHLHRDLDDTQKRLSELKEENDQLKREIAALQS- 63 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ L+ AR L RS+E++ + Sbjct: 64 --DRRYLESIARRDFGLVRSNEVVYQFPP 90 >gi|222056009|ref|YP_002538371.1| Septum formation initiator [Geobacter sp. FRC-32] gi|221565298|gb|ACM21270.1| Septum formation initiator [Geobacter sp. FRC-32] Length = 99 Score = 46.7 bits (110), Expect = 0.001, Method: Composition-based stats. Identities = 24/92 (26%), Positives = 39/92 (42%), Gaps = 3/92 (3%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R L+I +V+ I GD GL L K E L LK +L+R+++ + Sbjct: 2 RKRMLLIPAGIIVFILFFTIFGDRGLLRIYHLNKDNKEIREHLQSLKTENEKLKREIEAL 61 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ L+ AR L R +E+I + Sbjct: 62 RS---DRRYLESIARRDFGLVRQNEVIYQFPP 90 >gi|253700560|ref|YP_003021749.1| septum formation initiator [Geobacter sp. M21] gi|251775410|gb|ACT17991.1| Septum formation initiator [Geobacter sp. M21] Length = 133 Score = 46.3 bits (109), Expect = 0.002, Method: Composition-based stats. Identities = 21/89 (23%), Positives = 42/89 (47%), Gaps = 3/89 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 + +++ + GD GL L + L + ++ LSELKE +L+R++ + Sbjct: 5 LFFVPLAVIIFILYFTVFGDRGLLRINHLHRDLDDTQKRLSELKEENDQLKREIAALQS- 63 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ L+ AR L RS+E++ + Sbjct: 64 --DRRYLESIARRDFGLVRSNEVVYQFPP 90 >gi|241762254|ref|ZP_04760336.1| Septum formation initiator [Zymomonas mobilis subsp. mobilis ATCC 10988] gi|241373301|gb|EER62920.1| Septum formation initiator [Zymomonas mobilis subsp. mobilis ATCC 10988] Length = 86 Score = 45.9 bits (108), Expect = 0.002, Method: Composition-based stats. Identities = 14/61 (22%), Positives = 28/61 (45%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + + R+ L+ L+ R +L + L++ + + D +E R R DE+I+ S Sbjct: 25 YRQKMAVRKAELAALEHQRDQLANSIALLNPKATDPDYAEELVRKETRQIRPDEVIILDS 84 Query: 104 D 104 Sbjct: 85 Q 85 >gi|148264352|ref|YP_001231058.1| septum formation initiator [Geobacter uraniireducens Rf4] gi|146397852|gb|ABQ26485.1| cell division protein FtsB [Geobacter uraniireducens Rf4] Length = 96 Score = 45.5 bits (107), Expect = 0.003, Method: Composition-based stats. Identities = 21/91 (23%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R +I +++ + GD GL L K E + L LK +L+R+++ + Sbjct: 2 RKRMFLIPAGVIIFILFFTVFGDRGLLRIYHLSKEKKEIQGNLETLKSENEKLKREIEAL 61 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 ++ L+ AR L R +E+I + Sbjct: 62 RT---DRRYLESIARRDFGLVRQNEVIYQFP 89 >gi|225871834|ref|YP_002753288.1| putative cell division protein FtsL [Acidobacterium capsulatum ATCC 51196] gi|225794500|gb|ACO34590.1| putative cell division protein FtsL [Acidobacterium capsulatum ATCC 51196] Length = 118 Score = 45.1 bits (106), Expect = 0.003, Method: Composition-based stats. Identities = 14/96 (14%), Positives = 41/96 (42%), Gaps = 9/96 (9%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 + ++ + + + + + G GLK+ + ++ + L++ Sbjct: 6 RLRRRAATVAIVLMAVCI------GYYVVAGQNGLKSYEQKRHEAEHLQQQIEHLQQENG 59 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 +L+++V + + D ++ +AR L+ +R E+I Sbjct: 60 QLQQQVHALQS---DPDAIEHEARERLHYARPGEVI 92 >gi|295094511|emb|CBK83602.1| Septum formation initiator. [Coprococcus sp. ART55/1] Length = 106 Score = 44.4 bits (104), Expect = 0.006, Method: Composition-based stats. Identities = 25/99 (25%), Positives = 43/99 (43%), Gaps = 5/99 (5%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKS-LEKSLIERERFLSELKEN 61 +K K N + +V+ C++ + LKA K L+ E + L KE+ Sbjct: 8 SKSKKNNKITTKLGMVLVVSCLILLAVVVLYKAQSLKAQKESLQVQAAELQEQLDSAKED 67 Query: 62 RSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +LE + K M + +++ AR L L DEI++ Sbjct: 68 YKKLEEREKYMQTD----EYVEDVARSQLGLIYPDEIVV 102 >gi|78222644|ref|YP_384391.1| cell division protein FtsB [Geobacter metallireducens GS-15] gi|78193899|gb|ABB31666.1| cell division protein FtsB [Geobacter metallireducens GS-15] Length = 110 Score = 43.6 bits (102), Expect = 0.009, Method: Composition-based stats. Identities = 16/91 (17%), Positives = 41/91 (45%), Gaps = 3/91 (3%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R ++ C+++ + G+ GL L + E ++E++ +L+R+++ + Sbjct: 2 RKRMYLVPAGCILFILFFTVFGERGLLRIYHLSREKQEIAEKVTEVRGENEKLKREIEAL 61 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 ++ L+ AR L R +E++ + Sbjct: 62 KT---DRRYLESIARKDFGLVRPNEVVYQFP 89 >gi|91789045|ref|YP_549997.1| cell division protein FtsB [Polaromonas sp. JS666] gi|91698270|gb|ABE45099.1| cell division protein FtsB [Polaromonas sp. JS666] Length = 91 Score = 43.6 bits (102), Expect = 0.010, Method: Composition-based stats. Identities = 16/85 (18%), Positives = 42/85 (49%), Gaps = 3/85 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 I +V F +G + + + +++ L E+ ++ + + +L +V+ + +G Sbjct: 6 IPAILIALLVLFHAQLWIGRGSVPSVREMQQRLDEQLAKNAQAQVSNEQLAAEVRDLREG 65 Query: 76 SLEKDLLDEKARYSLNLSRSDEIIL 100 ++++EKAR L + + +EI + Sbjct: 66 ---LEMVEEKARMELGMVKPNEIFV 87 >gi|169824695|ref|YP_001692306.1| hypothetical protein FMG_0998 [Finegoldia magna ATCC 29328] gi|167831500|dbj|BAG08416.1| conserved hypothetical protein [Finegoldia magna ATCC 29328] Length = 124 Score = 43.2 bits (101), Expect = 0.013, Method: Composition-based stats. Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 13/100 (13%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K K + FR I I I + + + +++ + K Sbjct: 10 KRRKNVNKFRIIVSAITI-------FACITLLFTIFKQQIQIRNINNVKIEQQNKKAE-- 60 Query: 64 RLERKVKLMSDGSLEKD---LLDEKARYSLNLSRSDEIIL 100 LE+++ +SD S D L+++ AR L + + +EI++ Sbjct: 61 -LEKEIVKLSDDSKNLDNPKLIEKYAREKLGMVKPNEILI 99 >gi|39996913|ref|NP_952864.1| septum formation initiator family protein [Geobacter sulfurreducens PCA] gi|39983801|gb|AAR35191.1| septum formation initiator family protein [Geobacter sulfurreducens PCA] gi|298505926|gb|ADI84649.1| septum formation initiator family protein [Geobacter sulfurreducens KN400] Length = 111 Score = 43.2 bits (101), Expect = 0.014, Method: Composition-based stats. Identities = 16/94 (17%), Positives = 39/94 (41%), Gaps = 6/94 (6%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 + ++YFT + G+ GL L + + + +++ +L+R++ Sbjct: 2 RKRMYLIPTGCILFILYFT---VFGERGLLRIYHLSNERDQIRQKVGVVRDENEKLKREI 58 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + + ++ L+ AR L R +EI+ + Sbjct: 59 EALKS---DRRYLESIARKDFGLVRPNEIVYQFP 89 >gi|117927005|ref|YP_867622.1| cell division protein FtsB [Magnetococcus sp. MC-1] gi|117610761|gb|ABK46216.1| cell division protein FtsB [Magnetococcus sp. MC-1] Length = 126 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ A + + L ++ + ++ + +R++ L+ + +L+E AR +L L Sbjct: 39 GQQGIVAWRHTSQQLDATKKEIEKVSARIEKRKREIILVKREAT---ILEEVARRNLGLV 95 Query: 94 RSDEIILFYS 103 DEII + Sbjct: 96 YPDEIIFVFP 105 >gi|212702980|ref|ZP_03311108.1| hypothetical protein DESPIG_01018 [Desulfovibrio piger ATCC 29098] gi|212673568|gb|EEB34051.1| hypothetical protein DESPIG_01018 [Desulfovibrio piger ATCC 29098] Length = 109 Score = 42.8 bits (100), Expect = 0.017, Method: Composition-based stats. Identities = 19/92 (20%), Positives = 40/92 (43%), Gaps = 3/92 (3%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R I LV + + H I G GL A + L++ E ++ + L R ++L+ Sbjct: 5 RVIVLVAVWGINLIIFCHMIWGSEGLIAYRELKQKHAAIEAEIASIDAENRSLSRDIRLL 64 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ +++ R L+ +E++ + D Sbjct: 65 QT---DERYVEKMIRQRLHYVHENEVLYLFGD 93 >gi|134095371|ref|YP_001100446.1| cell division protein FtsB [Herminiimonas arsenicoxydans] gi|166216887|sp|A4G736|FTSB_HERAR RecName: Full=Cell division protein ftsB homolog gi|133739274|emb|CAL62323.1| Cell division protein FtsB [Herminiimonas arsenicoxydans] Length = 110 Score = 42.8 bits (100), Expect = 0.018, Method: Composition-based stats. Identities = 20/88 (22%), Positives = 43/88 (48%), Gaps = 4/88 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R I L +A + +G G L++ +I ++ EL+ ++L +V+ + Sbjct: 2 RLIILCLAALVL-LIQFPLWLGKGGWLRVWDLDQQVIAAQKKNDELRARNAKLNSEVQDL 60 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +G+ ++E+ARY L + + +EI + Sbjct: 61 KEGT---GAVEERARYELGMIKENEIFV 85 >gi|221633728|ref|YP_002522954.1| Septum formation initiator family [Thermomicrobium roseum DSM 5159] gi|221155381|gb|ACM04508.1| Septum formation initiator family [Thermomicrobium roseum DSM 5159] Length = 131 Score = 42.4 bits (99), Expect = 0.019, Method: Composition-based stats. Identities = 22/95 (23%), Positives = 42/95 (44%), Gaps = 8/95 (8%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANK--SLEKSLIERERFLSELKENRSRLE 66 + A+ + + F +YF +G +A + LE + ER L+ L R L Sbjct: 6 SWLRTAVLVALGFAIALYFVVA-----FGQQAWRARQLEMQVAERRAALARLVTERDTLA 60 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 ++ + + ++ ++ AR LNL+ E +LF Sbjct: 61 SQLADLQGEN-DRAYVERTARRELNLTYPGETVLF 94 >gi|302380168|ref|ZP_07268640.1| putative cell division protein FtsL [Finegoldia magna ACS-171-V-Col3] gi|302311951|gb|EFK93960.1| putative cell division protein FtsL [Finegoldia magna ACS-171-V-Col3] Length = 124 Score = 42.1 bits (98), Expect = 0.024, Method: Composition-based stats. Identities = 20/100 (20%), Positives = 40/100 (40%), Gaps = 13/100 (13%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K K + FR I I I + + + +++ + K Sbjct: 10 KRRKNVNKFRIIISAITI-------FACITLLFTIFKQQIQIRNINNVKLEQQNKKAE-- 60 Query: 64 RLERKVKLMSDGSLEKD---LLDEKARYSLNLSRSDEIIL 100 LE+++ +SD S D L+++ AR L + + +EI++ Sbjct: 61 -LEKEIVKLSDDSKNLDNPELIEKYAREKLGMVKPNEILI 99 >gi|302388701|ref|YP_003824522.1| Septum formation initiator [Thermosediminibacter oceani DSM 16646] gi|302199329|gb|ADL06899.1| Septum formation initiator [Thermosediminibacter oceani DSM 16646] Length = 95 Score = 42.1 bits (98), Expect = 0.026, Method: Composition-based stats. Identities = 25/99 (25%), Positives = 46/99 (46%), Gaps = 11/99 (11%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 K+ R IF +VYF V + + L + +E + +++L E R RL Sbjct: 4 KKQFKLGRIIF----VLFLVYFVYTFTVQQFKIN---ELRRQELELSQKMNQLAEERKRL 56 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 E++++L++ S +++ AR L L + EI+ S Sbjct: 57 EKEIELLNTKSY----IEKLARDQLGLVKPGEILYKISP 91 >gi|326316157|ref|YP_004233829.1| Septum formation initiator [Acidovorax avenae subsp. avenae ATCC 19860] gi|323372993|gb|ADX45262.1| Septum formation initiator [Acidovorax avenae subsp. avenae ATCC 19860] Length = 92 Score = 42.1 bits (98), Expect = 0.027, Method: Composition-based stats. Identities = 12/63 (19%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 + +++ + +++ ++ RL +V + DG D+++EKAR L + + +E+ + Sbjct: 32 QEMKERIAAQKQANDRARQENERLASEVSDLRDG---LDMVEEKARSELGMVKPNEVYVH 88 Query: 102 YSD 104 + Sbjct: 89 VAP 91 >gi|254448223|ref|ZP_05061685.1| Septum formation initiator subfamily [gamma proteobacterium HTCC5015] gi|198262090|gb|EDY86373.1| Septum formation initiator subfamily [gamma proteobacterium HTCC5015] Length = 103 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 19/88 (21%), Positives = 41/88 (46%), Gaps = 3/88 (3%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 R + + + C ++ G+ G+ L++ L +++R EL+ L+ +V+ Sbjct: 1 MKRNLLIGLLCCGILVLQFKLWFGEGGVPEWWHLKQELNQQQRENEELRARNQALQAEVR 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEI 98 + G D ++E+AR L + DE+ Sbjct: 61 DLKTG---LDAVEERARDDLGMIAEDEV 85 >gi|152981903|ref|YP_001352961.1| cell division protein FtsB [Janthinobacterium sp. Marseille] gi|166216888|sp|A6SXG4|FTSB_JANMA RecName: Full=Cell division protein ftsB homolog gi|151281980|gb|ABR90390.1| septum formation initiator [Janthinobacterium sp. Marseille] Length = 110 Score = 42.1 bits (98), Expect = 0.029, Method: Composition-based stats. Identities = 21/88 (23%), Positives = 43/88 (48%), Gaps = 4/88 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R I L +A VV +G G L+ ++ ++ ELK ++L +V+ + Sbjct: 2 RLIILCLA-ALVVLIQFPLWLGKGGWLRVWDLDHQVVAAQKKNDELKARNAKLNSEVQDL 60 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +G+ ++E+ARY L + + +E+ + Sbjct: 61 KEGT---GAVEERARYELGMIKENEVFV 85 >gi|297588665|ref|ZP_06947308.1| conserved hypothetical protein [Finegoldia magna ATCC 53516] gi|297574038|gb|EFH92759.1| conserved hypothetical protein [Finegoldia magna ATCC 53516] Length = 124 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 19/100 (19%), Positives = 39/100 (39%), Gaps = 13/100 (13%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K K + FR I I + L + + E + ++ Sbjct: 10 KRRKNVNKFRIIVSAITI-------FACVTL---LFTIFKQQIQIRNINNVKLEQQTKKA 59 Query: 64 RLERKVKLMSDGSLEKD---LLDEKARYSLNLSRSDEIIL 100 LE+++ +SD S D L+++ AR L + + +E+++ Sbjct: 60 ELEKEIVKLSDDSKNLDNPQLIEKYAREKLGMVKPNEVLI 99 >gi|92114757|ref|YP_574685.1| cell division protein FtsB [Chromohalobacter salexigens DSM 3043] gi|91797847|gb|ABE59986.1| cell division protein FtsB [Chromohalobacter salexigens DSM 3043] Length = 121 Score = 41.7 bits (97), Expect = 0.035, Method: Composition-based stats. Identities = 17/77 (22%), Positives = 31/77 (40%), Gaps = 3/77 (3%) Query: 29 NHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 H G+ G++ + E+ L+ RL +V + +G D ++E+AR Sbjct: 18 YHLWFGEGGVRELNHIRSRADVLEQENDRLQARNDRLAAEVIDLKNG---LDAIEERARS 74 Query: 89 SLNLSRSDEIILFYSDF 105 L + R DE + Sbjct: 75 DLGMVRQDEQFFWVPGV 91 >gi|240949324|ref|ZP_04753667.1| cell division protein FtsB-like protein [Actinobacillus minor NM305] gi|240296275|gb|EER46924.1| cell division protein FtsB-like protein [Actinobacillus minor NM305] Length = 93 Score = 41.7 bits (97), Expect = 0.036, Method: Composition-based stats. Identities = 15/84 (17%), Positives = 34/84 (40%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + +V + +F G G + + + ++ +L +E ++ + Sbjct: 3 LLIVFLIGLLSFFQYSFWFGKNGWTDYQEATAEVAQLKKEHEKLTARNELIEAEIHDLKT 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G + L+E+AR + +SDEI Sbjct: 63 G---VNALEERARLEREMVKSDEI 83 >gi|120610008|ref|YP_969686.1| cell division protein FtsB [Acidovorax citrulli AAC00-1] gi|120588472|gb|ABM31912.1| cell division protein FtsB [Acidovorax citrulli AAC00-1] Length = 92 Score = 41.7 bits (97), Expect = 0.039, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 + +++ + +++ + RL +V + DG D+++EKAR L + + +EI + Sbjct: 32 QEMKEKIAAQKQANDRARLENERLASEVSDLRDG---LDMVEEKARSELGMVKPNEIYVH 88 Query: 102 YSD 104 + Sbjct: 89 VAP 91 >gi|330446954|ref|ZP_08310605.1| essential cell division protein FtsB [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] gi|328491145|dbj|GAA05102.1| essential cell division protein FtsB [Photobacterium leiognathi subsp. mandapamensis svers.1.1.] Length = 92 Score = 40.9 bits (95), Expect = 0.053, Method: Composition-based stats. Identities = 17/83 (20%), Positives = 42/83 (50%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+++ + + G G+ ++E+S+ +E+ +EL + ++ ++K + Sbjct: 3 LFIIVLLGLLAWLQYDFWYGKNGMNEYTAVEESVALQEKANAELHQRNQQMYAEIKDLHG 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G K+ ++E+AR L L + E Sbjct: 63 G---KEAVEERARTDLGLVKPGE 82 >gi|118579455|ref|YP_900705.1| septum formation initiator [Pelobacter propionicus DSM 2379] gi|118502165|gb|ABK98647.1| cell division protein FtsB [Pelobacter propionicus DSM 2379] Length = 98 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 18/89 (20%), Positives = 36/89 (40%), Gaps = 3/89 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 +I C+ + + GD GL L + + + L + + L+R++ + Sbjct: 9 VYLILAGCITFILFFTVFGDKGLLRIFELRQDMARVQARLGDTRAVNETLKREIVALKGD 68 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ AR L RS+E+I +S Sbjct: 69 HR---YVESIARKDFGLVRSNEVIYQFSP 94 >gi|182420092|ref|ZP_02951326.1| septum formation initiator superfamily [Clostridium butyricum 5521] gi|237669541|ref|ZP_04529521.1| septum formation initiator [Clostridium butyricum E4 str. BoNT E BL5262] gi|182376129|gb|EDT73716.1| septum formation initiator superfamily [Clostridium butyricum 5521] gi|237654985|gb|EEP52545.1| septum formation initiator [Clostridium butyricum E4 str. BoNT E BL5262] Length = 98 Score = 40.9 bits (95), Expect = 0.059, Method: Composition-based stats. Identities = 21/84 (25%), Positives = 41/84 (48%), Gaps = 5/84 (5%) Query: 21 FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 F V++F + L K +E + ++ L E++E RL+ +V+ ++ S D Sbjct: 13 FAFVIFFGGSYMNQ---LITTKKIESEIENKQSQLEEIQEKNERLQEEVEKINSNS--AD 67 Query: 81 LLDEKARYSLNLSRSDEIILFYSD 104 L++ AR L + + E ++ SD Sbjct: 68 YLEKLARERLGMIKPGEKVVNSSD 91 >gi|315635246|ref|ZP_07890523.1| cell division protein FtsB [Aggregatibacter segnis ATCC 33393] gi|315475992|gb|EFU66747.1| cell division protein FtsB [Aggregatibacter segnis ATCC 33393] Length = 144 Score = 40.9 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 19/88 (21%), Positives = 39/88 (44%), Gaps = 3/88 (3%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 FF +FL + F +V F G G K+ K + ++ +L + + ++ Sbjct: 50 RFFMRLFLSLLFAVLVLFQYDFWFGKNGYWDYKNTTKEIAVHQQENEKLSQRNQIIAAEI 109 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDE 97 K + +G D ++E+AR + + +E Sbjct: 110 KDLKEG---VDAIEERARLQHEMVKPNE 134 >gi|303235062|ref|ZP_07321686.1| septum formation initiator [Finegoldia magna BVS033A4] gi|302493917|gb|EFL53699.1| septum formation initiator [Finegoldia magna BVS033A4] Length = 124 Score = 40.9 bits (95), Expect = 0.063, Method: Composition-based stats. Identities = 18/100 (18%), Positives = 40/100 (40%), Gaps = 13/100 (13%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K K + FR + I I + + + +++ + K Sbjct: 10 KRRKNVNKFRIVVSAITI-------FACITLLFTIFKQQIQIRNINNVKIEQQNKKAE-- 60 Query: 64 RLERKVKLMSDGSLEKD---LLDEKARYSLNLSRSDEIIL 100 LE+++ +SD + D L+++ AR L + + +EI++ Sbjct: 61 -LEKEIVKLSDDTKNLDNPKLIEKYAREKLGMVKPNEILI 99 >gi|289208643|ref|YP_003460709.1| septum formation initiator [Thioalkalivibrio sp. K90mix] gi|288944274|gb|ADC71973.1| Septum formation initiator [Thioalkalivibrio sp. K90mix] Length = 135 Score = 40.9 bits (95), Expect = 0.064, Method: Composition-based stats. Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 + L + + E+ +EL++ LE +V + G+ D ++E+AR L + R DE+ F Sbjct: 30 RDLREQVEEQRAANAELEQRNQALEAEVLDLRTGT---DAVEERARRDLGMIREDEVFFF 86 >gi|288940143|ref|YP_003442383.1| Septum formation initiator [Allochromatium vinosum DSM 180] gi|288895515|gb|ADC61351.1| Septum formation initiator [Allochromatium vinosum DSM 180] Length = 127 Score = 40.9 bits (95), Expect = 0.068, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G+ + SL++ + E L L+ L+ +V + +GS + ++E+AR L + Sbjct: 49 GEGSIAELHSLKREIAFEESELERLRTRNRELQAEVDDLREGS---EAIEERARSELGMI 105 Query: 94 RSDEIIL 100 + EI + Sbjct: 106 KPGEIFI 112 >gi|261493557|ref|ZP_05990077.1| putative septum formation initiator [Mannheimia haemolytica serotype A2 str. BOVINE] gi|261495395|ref|ZP_05991843.1| putative septum formation initiator [Mannheimia haemolytica serotype A2 str. OVINE] gi|261308900|gb|EEY10155.1| putative septum formation initiator [Mannheimia haemolytica serotype A2 str. OVINE] gi|261310739|gb|EEY11922.1| putative septum formation initiator [Mannheimia haemolytica serotype A2 str. BOVINE] Length = 92 Score = 40.5 bits (94), Expect = 0.072, Method: Composition-based stats. Identities = 13/84 (15%), Positives = 35/84 (41%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + + + +F G G + +++ + + ++L +E ++ + + Sbjct: 3 LLITFFALLLGFFQYSFWFGKNGWSDYQEVQEEIALLKVENTKLTSRNKLIEAEIYDLKN 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G D L+E+AR + + +EI Sbjct: 63 G---VDALEERARLEREMVKENEI 83 >gi|56478958|ref|YP_160547.1| cell division FtsB ortholog [Aromatoleum aromaticum EbN1] gi|81356474|sp|Q5NZ68|FTSB_AZOSE RecName: Full=Cell division protein ftsB homolog gi|56315001|emb|CAI09646.1| Cell division FtsB ortholog [Aromatoleum aromaticum EbN1] Length = 91 Score = 40.5 bits (94), Expect = 0.075, Method: Composition-based stats. Identities = 19/91 (20%), Positives = 41/91 (45%), Gaps = 6/91 (6%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 I L + + Y +G G +++ L + L++ + LE +V+ + Sbjct: 4 PLIVLAVLVIVLQYPLW---LGKGGWLRVWDVDRQLQAQRETNQRLEQRNAGLEAEVRDL 60 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 G+ + ++E+AR+ L L++ DEI + Sbjct: 61 KSGN---EAVEERARFELGLTKPDEIFVHTP 88 >gi|306817806|ref|ZP_07451547.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239] gi|307700572|ref|ZP_07637604.1| septum formation initiator [Mobiluncus mulieris FB024-16] gi|304649455|gb|EFM46739.1| conserved hypothetical protein [Mobiluncus mulieris ATCC 35239] gi|307614217|gb|EFN93454.1| septum formation initiator [Mobiluncus mulieris FB024-16] Length = 236 Score = 40.5 bits (94), Expect = 0.076, Method: Composition-based stats. Identities = 10/69 (14%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LK+ ++ E ++ K LE ++ + + + +AR L + E Sbjct: 132 LKSWMEQQQHARELAAEIARTKAENEALEDEIAR----YQDPEYVSRQARERLGFVKPGE 187 Query: 98 --IILFYSD 104 ++ Sbjct: 188 TTYVVVDPP 196 >gi|257464791|ref|ZP_05629162.1| cell division protein FtsB-like protein [Actinobacillus minor 202] gi|257450451|gb|EEV24494.1| cell division protein FtsB-like protein [Actinobacillus minor 202] Length = 93 Score = 40.5 bits (94), Expect = 0.079, Method: Composition-based stats. Identities = 14/84 (16%), Positives = 34/84 (40%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + +V + +F G G + + + ++ +L +E ++ + Sbjct: 3 LLIVFLIGLLSFFQYSFWFGKNGWADYQEATAEVAQLKKEHEKLTARNELIEAEIHDLKT 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G + L+E+AR + +SDE+ Sbjct: 63 G---VNALEERARLEREMVKSDEV 83 >gi|317120956|ref|YP_004100959.1| septum formation initiator [Thermaerobacter marianensis DSM 12885] gi|315590936|gb|ADU50232.1| Septum formation initiator [Thermaerobacter marianensis DSM 12885] Length = 176 Score = 40.1 bits (93), Expect = 0.093, Method: Composition-based stats. Identities = 15/61 (24%), Positives = 27/61 (44%), Gaps = 10/61 (16%) Query: 43 SLEKSLIERERFLSELKENRSRL---ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 + L +R L EL+ ++ L E++V + +DE AR L L + E + Sbjct: 97 QARQELRALDRQLQELRGQQAELRAAEQRVD-------DPAYVDETARQRLGLVKPGETV 149 Query: 100 L 100 + Sbjct: 150 I 150 >gi|254496232|ref|ZP_05109126.1| septum formation initiator [Legionella drancourtii LLAP12] gi|254354537|gb|EET13178.1| septum formation initiator [Legionella drancourtii LLAP12] Length = 82 Score = 40.1 bits (93), Expect = 0.094, Method: Composition-based stats. Identities = 21/65 (32%), Positives = 34/65 (52%), Gaps = 3/65 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 GD L SLEK L E E+ ++L LE +K + G + L+E+AR+ L + Sbjct: 15 GDGNLIQWISLEKKLAEHEQENNKLVARNKALEADIKELKSG---EQALEEQARHELGMI 71 Query: 94 RSDEI 98 + +E+ Sbjct: 72 KENEV 76 >gi|220904464|ref|YP_002479776.1| Septum formation initiator [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] gi|219868763|gb|ACL49098.1| Septum formation initiator [Desulfovibrio desulfuricans subsp. desulfuricans str. ATCC 27774] Length = 100 Score = 40.1 bits (93), Expect = 0.10, Method: Composition-based stats. Identities = 18/92 (19%), Positives = 41/92 (44%), Gaps = 4/92 (4%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 + I +V+ VV F+ + G GL + L++ E+ ++ L L R++ Sbjct: 2 FWRSFILVVLGLISVVLFS-RMVWGPTGLLEYRELKRQYAALEKQIAGLDAENMALSREI 60 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +L+ + +++ R L+ R +E++ Sbjct: 61 RLLQSDN---QYVEKVIRQRLHYVRDNEVLYL 89 >gi|119504833|ref|ZP_01626911.1| cell divison protein FtsB [marine gamma proteobacterium HTCC2080] gi|119459438|gb|EAW40535.1| cell divison protein FtsB [marine gamma proteobacterium HTCC2080] Length = 100 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 21/83 (25%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I V + + GD G+ + L++ + E +ELK RL +V + + Sbjct: 5 ILAVALLGLMSFLQYRLWFGDGGIAESVRLQEKIAIEEARNAELKARNDRLAHQVMELQN 64 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G L +++ AR L L + DE Sbjct: 65 GHL---AVEQHAREELGLVKEDE 84 >gi|152995329|ref|YP_001340164.1| septum formation initiator [Marinomonas sp. MWYL1] gi|150836253|gb|ABR70229.1| Septum formation initiator [Marinomonas sp. MWYL1] Length = 92 Score = 40.1 bits (93), Expect = 0.11, Method: Composition-based stats. Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + + C V Y + H G+ G+K + L K + +ER LK L +V + Sbjct: 4 LLIFFFVCAVGYQSYHLYFGEQGVKRQEELAKQIAYQERINLRLKHRNQALRAQVHDLR- 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 L ++ ++E R L + E+ Sbjct: 63 --LGEEAVEEHVRSELQYIKDGEV 84 >gi|270159826|ref|ZP_06188482.1| cell division protein FtsB [Legionella longbeachae D-4968] gi|289165416|ref|YP_003455554.1| cell division protein ftsB homolog [Legionella longbeachae NSW150] gi|269988165|gb|EEZ94420.1| cell division protein FtsB [Legionella longbeachae D-4968] gi|288858589|emb|CBJ12470.1| putative cell division protein ftsB homolog [Legionella longbeachae NSW150] Length = 89 Score = 39.7 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 GD L + L+K L E+ ++L LE +K + +G L+E+ARY L + Sbjct: 22 GDGNLIQWRELQKKLAAHEQENNKLATRNRSLEADIKELKNGD---QALEEQARYELGMI 78 Query: 94 RSDEI 98 + +E+ Sbjct: 79 KENEV 83 >gi|303326787|ref|ZP_07357229.1| septum formation initiator family protein [Desulfovibrio sp. 3_1_syn3] gi|302862775|gb|EFL85707.1| septum formation initiator family protein [Desulfovibrio sp. 3_1_syn3] Length = 107 Score = 39.7 bits (92), Expect = 0.12, Method: Composition-based stats. Identities = 17/94 (18%), Positives = 40/94 (42%), Gaps = 4/94 (4%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 + I + + VV F+ I G GL + L++ + ++ L L R++ Sbjct: 2 FWRVFILVALGLINVVLFS-RMIWGPTGLMEYRELKRQYAALQEQVAGLDAENLALSREI 60 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +L+ + +++ R L+ R +E++ + Sbjct: 61 RLLQSDN---QYVEKMIRQRLHYVRDNEVLYLFG 91 >gi|218885511|ref|YP_002434832.1| septum formation initiator [Desulfovibrio vulgaris str. 'Miyazaki F'] gi|218756465|gb|ACL07364.1| Septum formation initiator [Desulfovibrio vulgaris str. 'Miyazaki F'] Length = 109 Score = 39.7 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 19/94 (20%), Positives = 43/94 (45%), Gaps = 3/94 (3%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 F+R + + ++ V + D G+ A K+L++ E L +L L R+++ Sbjct: 2 FWRRLLIGLSLALNVVLLYRLVWSDQGMVAYKTLKQQCTAMEARLKDLDTRNLALSREIR 61 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 L+ + +++ R LN + +EI+ + + Sbjct: 62 LLQA---DGKYVEKMIRKRLNFVKDNEILYIFPE 92 >gi|197286089|ref|YP_002151961.1| cell division protein FtsB [Proteus mirabilis HI4320] gi|227356599|ref|ZP_03840986.1| septum formation initiator [Proteus mirabilis ATCC 29906] gi|194683576|emb|CAR44454.1| cell division protein FtsB [Proteus mirabilis HI4320] gi|227163355|gb|EEI48282.1| septum formation initiator [Proteus mirabilis ATCC 29906] Length = 106 Score = 39.7 bits (92), Expect = 0.13, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + + ++LK RL ++ ++ G ++ LDE+AR L + Sbjct: 32 GKNGIHDYNKVSQEVESALAQNAQLKSRNDRLFAEIDDLNGG---QEALDERARSELGMI 88 Query: 94 RSDE 97 + +E Sbjct: 89 KPNE 92 >gi|227876860|ref|ZP_03994969.1| hypothetical protein HMPREF0577_2270 [Mobiluncus mulieris ATCC 35243] gi|227842757|gb|EEJ52957.1| hypothetical protein HMPREF0577_2270 [Mobiluncus mulieris ATCC 35243] Length = 170 Score = 39.7 bits (92), Expect = 0.14, Method: Composition-based stats. Identities = 10/69 (14%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LK+ ++ E ++ K LE ++ + + + +AR L + E Sbjct: 66 LKSWMEQQQHARELAAEIARTKAENEALEDEIAR----YQDPEYVSRQARERLGFVKPGE 121 Query: 98 --IILFYSD 104 ++ Sbjct: 122 TTYVVVDPP 130 >gi|301062182|ref|ZP_07202864.1| septum formation initiator [delta proteobacterium NaphS2] gi|300443694|gb|EFK07777.1| septum formation initiator [delta proteobacterium NaphS2] Length = 101 Score = 39.7 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 21/94 (22%), Positives = 33/94 (35%), Gaps = 7/94 (7%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K +I C VV G+ G+ + EK + +L L Sbjct: 3 KKLKNILKIPLICLCFVVPIAVWIWYGEGGVNHLRQTEKERQACIARIRKLAAENQVLIE 62 Query: 68 KVKLMSDGSLEKDL--LDEKARYSLNLSRSDEII 99 +V D+ ++ AR LNL R +E+I Sbjct: 63 EVNRFRT-----DMKYVESVARNELNLIRENEVI 91 >gi|269977837|ref|ZP_06184794.1| septum formation initiator [Mobiluncus mulieris 28-1] gi|269934007|gb|EEZ90584.1| septum formation initiator [Mobiluncus mulieris 28-1] Length = 213 Score = 39.7 bits (92), Expect = 0.15, Method: Composition-based stats. Identities = 10/69 (14%), Positives = 24/69 (34%), Gaps = 6/69 (8%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LK+ ++ E ++ K LE ++ + + + +AR L + E Sbjct: 109 LKSWMEQQQHARELAAEIARTKAENEALEDEIAR----YQDPEYVSRQARERLGFVKPGE 164 Query: 98 --IILFYSD 104 ++ Sbjct: 165 TTYVVVDPP 173 >gi|254361119|ref|ZP_04977264.1| possible septum formation initiator [Mannheimia haemolytica PHL213] gi|153092605|gb|EDN73660.1| possible septum formation initiator [Mannheimia haemolytica PHL213] Length = 92 Score = 39.4 bits (91), Expect = 0.18, Method: Composition-based stats. Identities = 12/84 (14%), Positives = 35/84 (41%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + + + +F G G + +++ + + ++L +E ++ + + Sbjct: 3 LLITFFALLLGFFQYSFWFGKNGWSDYQEVQEEIALLKVENTKLTSRNKLIEAEIYDLKN 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G D L+E+AR + + +E+ Sbjct: 63 G---VDALEERARLEREMVKENEM 83 >gi|162452185|ref|YP_001614552.1| putative septum formation initiator protein [Sorangium cellulosum 'So ce 56'] gi|161162767|emb|CAN94072.1| putative septum formation initiator protein [Sorangium cellulosum 'So ce 56'] Length = 99 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 28/64 (43%), Gaps = 3/64 (4%) Query: 37 GLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD 96 GL + LE+ L + E +EL L KV + D + ++ AR +L R Sbjct: 35 GLPRLRELERELADVEEENAELGRQIEALRGKVARLRD---DPTAVERIARDNLGFVRQS 91 Query: 97 EIIL 100 E++ Sbjct: 92 EVVF 95 >gi|241764325|ref|ZP_04762353.1| Septum formation initiator [Acidovorax delafieldii 2AN] gi|241366281|gb|EER60824.1| Septum formation initiator [Acidovorax delafieldii 2AN] Length = 92 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 13/63 (20%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 + +++ L + + ++ RL +V + +G D+++EKAR L + + +E+ + Sbjct: 32 QEMQRQLDAQTAANDQARQVNERLSSEVHDLKEG---LDMVEEKARSELGMVKPNEVYVQ 88 Query: 102 YSD 104 Y Sbjct: 89 YMP 91 >gi|159899209|ref|YP_001545456.1| septum formation initiator [Herpetosiphon aurantiacus ATCC 23779] gi|159892248|gb|ABX05328.1| Septum formation initiator [Herpetosiphon aurantiacus ATCC 23779] Length = 151 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 12/85 (14%), Positives = 31/85 (36%), Gaps = 11/85 (12%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 A +V F + + G ++E+ E + L L + + Sbjct: 32 LAAFALYLMVLFGSLVVQG-------YTMEQQAQALEAENARLAAESQALRDRAAYVRSD 84 Query: 76 SLEKDLLDEKARYSLNLSRSDEIIL 100 + ++ AR L++++ +++L Sbjct: 85 AA----IELAARDMLDMAKPGDVVL 105 >gi|160941903|ref|ZP_02089230.1| hypothetical protein CLOBOL_06799 [Clostridium bolteae ATCC BAA-613] gi|158435400|gb|EDP13167.1| hypothetical protein CLOBOL_06799 [Clostridium bolteae ATCC BAA-613] Length = 517 Score = 39.0 bits (90), Expect = 0.22, Method: Composition-based stats. Identities = 12/50 (24%), Positives = 30/50 (60%) Query: 33 VGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 G+ G + + ++E ++ L+ +KE + RL++ V +++D ++ D+L Sbjct: 424 HGNLGTAFIERVNARIMELDKELASMKEEKKRLQKDVSVITDREIQVDML 473 >gi|218782242|ref|YP_002433560.1| septum formation initiator [Desulfatibacillum alkenivorans AK-01] gi|218763626|gb|ACL06092.1| Septum formation initiator [Desulfatibacillum alkenivorans AK-01] Length = 108 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 19/101 (18%), Positives = 42/101 (41%), Gaps = 10/101 (9%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K++ I + + F + + G+ GL +L++ +L++ Sbjct: 3 KFHNLAITGLLILVSVLFFFLAF-------GNRGLVDMYNLKREAARLHEANQDLEKEND 55 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 RL R + + + ++D L+ AR L + DE++ + D Sbjct: 56 RLRRTMYRLLE---DRDYLESVARKELGMVGKDELVYDFED 93 >gi|329903710|ref|ZP_08273586.1| Cell division protein ftsB-like protein [Oxalobacteraceae bacterium IMCC9480] gi|327548231|gb|EGF32930.1| Cell division protein ftsB-like protein [Oxalobacteraceae bacterium IMCC9480] Length = 115 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + + +LK ++L +V+ + G+ ++E+ARY L + Sbjct: 22 GKGGWLRVADLDQQVTAAVKKTEDLKARNAKLGSEVQDLKTGT---GAVEERARYELGMV 78 Query: 94 RSDEIIL 100 + +E+ + Sbjct: 79 KENEVFV 85 >gi|71083636|ref|YP_266356.1| septum formation initiator [Candidatus Pelagibacter ubique HTCC1062] gi|91763324|ref|ZP_01265288.1| Septum formation initiator [Candidatus Pelagibacter ubique HTCC1002] gi|71062749|gb|AAZ21752.1| Septum formation initiator [Candidatus Pelagibacter ubique HTCC1062] gi|91717737|gb|EAS84388.1| Septum formation initiator [Candidatus Pelagibacter ubique HTCC1002] Length = 100 Score = 39.0 bits (90), Expect = 0.25, Method: Composition-based stats. Identities = 19/88 (21%), Positives = 38/88 (43%), Gaps = 1/88 (1%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 FL+I+ ++YF + + G+ GL + ++ L+ + + L LE K L+S Sbjct: 10 FLLISTFLILYFFFNLLDGERGLFSYFKKKEILVNLKIEEANLSNKIKELEFKNSLLST- 68 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYS 103 L+ D ++ R + E + Sbjct: 69 KLDLDYVETLIREKFMFGKEGETLYIIK 96 >gi|150014987|ref|YP_001307241.1| septum formation initiator [Clostridium beijerinckii NCIMB 8052] gi|149901452|gb|ABR32285.1| Septum formation initiator [Clostridium beijerinckii NCIMB 8052] Length = 95 Score = 38.6 bits (89), Expect = 0.27, Method: Composition-based stats. Identities = 17/83 (20%), Positives = 38/83 (45%), Gaps = 5/83 (6%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 I +++F I ++K + ++ L+E+K+ RL+ +V ++ S Sbjct: 10 TIITGFIIFFAFSYIRQS---MTMNRIQKEIDSKQVQLNEIKQKNERLQDEVDKINSNS- 65 Query: 78 EKDLLDEKARYSLNLSRSDEIIL 100 D L++ AR L + + E ++ Sbjct: 66 -SDYLEKLARERLGMIKPGEKVV 87 >gi|148359612|ref|YP_001250819.1| septum formation initiator [Legionella pneumophila str. Corby] gi|148281385|gb|ABQ55473.1| septum formation initiator [Legionella pneumophila str. Corby] Length = 89 Score = 38.6 bits (89), Expect = 0.29, Method: Composition-based stats. Identities = 22/86 (25%), Positives = 38/86 (44%), Gaps = 4/86 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R IF+++ V + +GD + LEK L + +L LE +K + Sbjct: 2 RPIFIILIIALVA-LQHKLWLGDGNIIQWIKLEKKLEAHKSQNDKLAARNKALEADIKEL 60 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEI 98 G L+E+ARY L + + +E+ Sbjct: 61 KSGD---QALEEQARYELGMIKQNEV 83 >gi|52842255|ref|YP_096054.1| transmembrane protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|54294937|ref|YP_127352.1| hypothetical protein lpl2016 [Legionella pneumophila str. Lens] gi|54297966|ref|YP_124335.1| hypothetical protein lpp2021 [Legionella pneumophila str. Paris] gi|296107654|ref|YP_003619355.1| cell division protein FtsB [Legionella pneumophila 2300/99 Alcoy] gi|52629366|gb|AAU28107.1| transmembrane protein [Legionella pneumophila subsp. pneumophila str. Philadelphia 1] gi|53751751|emb|CAH13173.1| hypothetical protein lpp2021 [Legionella pneumophila str. Paris] gi|53754769|emb|CAH16256.1| hypothetical protein lpl2016 [Legionella pneumophila str. Lens] gi|295649556|gb|ADG25403.1| cell division protein FtsB [Legionella pneumophila 2300/99 Alcoy] gi|307610769|emb|CBX00380.1| hypothetical protein LPW_21021 [Legionella pneumophila 130b] Length = 89 Score = 38.6 bits (89), Expect = 0.31, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 29/65 (44%), Gaps = 3/65 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 GD + LEK L + +L LE +K + G L+E+ARY L + Sbjct: 22 GDGNIIQWIKLEKKLEAHKSQNDKLAARNKALEADIKELKSGD---QALEEQARYELGMI 78 Query: 94 RSDEI 98 + +E+ Sbjct: 79 KQNEV 83 >gi|119898434|ref|YP_933647.1| hypothetical protein azo2143 [Azoarcus sp. BH72] gi|166216881|sp|A1K7F5|FTSB_AZOSB RecName: Full=Cell division protein ftsB homolog gi|119670847|emb|CAL94760.1| conserved hypothetical membrane protein [Azoarcus sp. BH72] Length = 91 Score = 38.6 bits (89), Expect = 0.32, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G +++ L E+ + L+E + L+ +V+ + G+ + ++E+AR L L+ Sbjct: 22 GKGGWLRVWEVDRKLHEQREENTRLEERNAGLDAEVRDLKSGN---EAIEERARLELGLT 78 Query: 94 RSDEIILFYSD 104 + +EI + Sbjct: 79 KPNEIFVQVPQ 89 >gi|121609603|ref|YP_997410.1| septum formation initiator [Verminephrobacter eiseniae EF01-2] gi|121554243|gb|ABM58392.1| cell division protein FtsB [Verminephrobacter eiseniae EF01-2] Length = 92 Score = 38.2 bits (88), Expect = 0.35, Method: Composition-based stats. Identities = 12/61 (19%), Positives = 36/61 (59%), Gaps = 3/61 (4%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +++ + +E ++ ++ +RL +V+ + +G D+++E+AR L + + +EI + ++ Sbjct: 34 MQRQIDAQEAANAQAQQANARLASEVQDLREG---LDMVEEQARSELGMVKPNEIYVQFT 90 Query: 104 D 104 Sbjct: 91 P 91 >gi|257094876|ref|YP_003168517.1| Septum formation initiator [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] gi|257047400|gb|ACV36588.1| Septum formation initiator [Candidatus Accumulibacter phosphatis clade IIA str. UW-1] Length = 120 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G +++ L +++ +L+ + L+ +V+ + G D ++E+AR+ L + Sbjct: 22 GKGGWLRVWDVDRQLRQQQDTNKQLEMRNAGLDAEVRDLKQGY---DAIEERARFELGMV 78 Query: 94 RSDEIILFYSD 104 R DE+ + D Sbjct: 79 RQDEVFVQIPD 89 >gi|183600224|ref|ZP_02961717.1| hypothetical protein PROSTU_03766 [Providencia stuartii ATCC 25827] gi|188022519|gb|EDU60559.1| hypothetical protein PROSTU_03766 [Providencia stuartii ATCC 25827] Length = 99 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 15/82 (18%), Positives = 36/82 (43%), Gaps = 3/82 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 ++ + + +G G+ ++ + +E S LK +L ++ ++DG Sbjct: 4 LTLLLIAVLAWTQYSLWLGKNGIHDYVRVKDDVAAQEIINSRLKVRNEQLFAEINDLNDG 63 Query: 76 SLEKDLLDEKARYSLNLSRSDE 97 +D ++E+AR L + + E Sbjct: 64 ---QDAIEERARTELGMIKPGE 82 >gi|146308053|ref|YP_001188518.1| cell division protein FtsB [Pseudomonas mendocina ymp] gi|145576254|gb|ABP85786.1| cell division protein FtsB [Pseudomonas mendocina ymp] Length = 108 Score = 38.2 bits (88), Expect = 0.36, Method: Composition-based stats. Identities = 18/102 (17%), Positives = 42/102 (41%), Gaps = 3/102 (2%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 T+ ++ ++ + +GD L A L++ + E++ L E Sbjct: 10 TQSASRSMRSPYWLFIVLILLLAGLQYRLWIGDGSLAAASRLQQQIAEQQGENERLLERN 69 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 LE +V + G + ++E+AR+ L + + E + ++ Sbjct: 70 RILEAEVMELKRGM---ETVEERARHELGMLKEGETLYLLTE 108 >gi|291279479|ref|YP_003496314.1| cell division protein FtsB [Deferribacter desulfuricans SSM1] gi|290754181|dbj|BAI80558.1| cell division protein FtsB [Deferribacter desulfuricans SSM1] Length = 95 Score = 38.2 bits (88), Expect = 0.37, Method: Composition-based stats. Identities = 21/80 (26%), Positives = 37/80 (46%), Gaps = 17/80 (21%) Query: 32 IVGDYGLKANKSL-------EKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDE 84 I GDYG+ + L E+ ++E ++ + ELK+ L++ +KD L+ Sbjct: 20 IFGDYGILSYIRLVKIKHNYEQQIVEMDKKIKELKKEVEFLQK----------DKDYLEM 69 Query: 85 KARYSLNLSRSDEIILFYSD 104 R LNL + +E + D Sbjct: 70 IIRKELNLKKPNEDLFILDD 89 >gi|225851169|ref|YP_002731403.1| putative septum formation initiator [Persephonella marina EX-H1] gi|225646673|gb|ACO04859.1| putative septum formation initiator [Persephonella marina EX-H1] Length = 138 Score = 38.2 bits (88), Expect = 0.39, Method: Composition-based stats. Identities = 19/90 (21%), Positives = 33/90 (36%), Gaps = 3/90 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I V+Y G L EK I ++ +++L+ L K+ + Sbjct: 26 ILPFATLFLVIYAAYFLFFGKNNLFRFLEKEKQKITLQKDIAKLQRENRYLAEKIDYLKR 85 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +++KAR L L + +E I D Sbjct: 86 DIF---FIEKKAREDLGLIKDNEEIYIIVD 112 >gi|300312080|ref|YP_003776172.1| cell division protein FtsB [Herbaspirillum seropedicae SmR1] gi|300074865|gb|ADJ64264.1| cell division, septum formation initiator, FtsB protein [Herbaspirillum seropedicae SmR1] Length = 130 Score = 38.2 bits (88), Expect = 0.40, Method: Composition-based stats. Identities = 21/88 (23%), Positives = 40/88 (45%), Gaps = 4/88 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R I L ++F V +G G L++ + + ELKE ++L +V + Sbjct: 2 RLIILCLSFLLV-LIQYPLWLGKGGWFKVWELDRQVQLAHKKNDELKERNAKLASEVDDL 60 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIIL 100 K ++E+AR+ L + + +EI + Sbjct: 61 KQS---KGAVEERARFELGMIKQNEIFV 85 >gi|300867221|ref|ZP_07111884.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506] gi|300334835|emb|CBN57050.1| conserved hypothetical protein [Oscillatoria sp. PCC 6506] Length = 255 Score = 37.8 bits (87), Expect = 0.46, Method: Composition-based stats. Identities = 11/50 (22%), Positives = 23/50 (46%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 G+ L +++ E+ E+ ++ R R ER + + ++ DL D Sbjct: 206 GNLLLWSSEQAEQERQRAEQERQRAEQERQRAERLAAKLRELGIDPDLPD 255 >gi|87118606|ref|ZP_01074505.1| Septum formation initiator [Marinomonas sp. MED121] gi|86166240|gb|EAQ67506.1| Septum formation initiator [Marinomonas sp. MED121] Length = 95 Score = 37.8 bits (87), Expect = 0.47, Method: Composition-based stats. Identities = 18/83 (21%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I V+ +Y + G+ G K + L K + +E +L + + L ++ + + Sbjct: 8 IVSVLFAGMAIYLAYQLVYGEQGRKRQEELSKQVEFQELTNDKLSQRNAALRAQLSNLRN 67 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G +D ++EK R L + E Sbjct: 68 G---QDAVEEKIRIELQYIKEGE 87 >gi|158522337|ref|YP_001530207.1| septum formation initiator [Desulfococcus oleovorans Hxd3] gi|158511163|gb|ABW68130.1| Septum formation initiator [Desulfococcus oleovorans Hxd3] Length = 105 Score = 37.8 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 17/101 (16%), Positives = 37/101 (36%), Gaps = 4/101 (3%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 + KN+ R I L +A + + D G + L+ + +++ Sbjct: 1 MIQWLKNNVNR-ILLALAGLFACFMVGVILFADNGFLDYRRLQAKNEAVVQENIRMQQEN 59 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + R VK + + + D ++ AR L + +E + Sbjct: 60 MEMHRLVKRLKE---DLDYIEHVARKELGMVGRNEQVYTLK 97 >gi|46580253|ref|YP_011061.1| septum formation initiator family protein [Desulfovibrio vulgaris str. Hildenborough] gi|120602363|ref|YP_966763.1| septum formation initiator [Desulfovibrio vulgaris DP4] gi|46449670|gb|AAS96320.1| septum formation initiator family protein [Desulfovibrio vulgaris str. Hildenborough] gi|120562592|gb|ABM28336.1| Septum formation initiator [Desulfovibrio vulgaris DP4] gi|311233762|gb|ADP86616.1| Septum formation initiator [Desulfovibrio vulgaris RCH1] Length = 109 Score = 37.8 bits (87), Expect = 0.54, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 32/70 (45%), Gaps = 3/70 (4%) Query: 35 DYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSR 94 + G+ A + L+ + E + + L R+++L+ + +++ R LN R Sbjct: 28 EQGIVAYRELKAQHLALEDAVKKADAVNLSLSREIRLLQS---DDRYVEKMIRKRLNFVR 84 Query: 95 SDEIILFYSD 104 +EI+ + D Sbjct: 85 DNEIVYLFPD 94 >gi|71907982|ref|YP_285569.1| cell division protein FtsB [Dechloromonas aromatica RCB] gi|123627201|sp|Q47DI2|FTSB_DECAR RecName: Full=Cell division protein ftsB homolog gi|71847603|gb|AAZ47099.1| cell division protein FtsB [Dechloromonas aromatica RCB] Length = 94 Score = 37.8 bits (87), Expect = 0.56, Method: Composition-based stats. Identities = 18/90 (20%), Positives = 41/90 (45%), Gaps = 6/90 (6%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + L+ A + Y VG G ++ L +++ +L+ + L+ +V+ + Sbjct: 6 VGLLAAIGLLQYPLW---VGKGGWLKVWEYDRQLQQQKEVTRKLEIRNAGLDAEVRDLKQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 G D ++E+AR+ L + + DE + + Sbjct: 63 GY---DAIEERARFELGMVKQDETFVQIPE 89 >gi|218440337|ref|YP_002378666.1| hypothetical protein PCC7424_3403 [Cyanothece sp. PCC 7424] gi|218173065|gb|ACK71798.1| protein of unknown function DUF820 [Cyanothece sp. PCC 7424] Length = 256 Score = 37.4 bits (86), Expect = 0.61, Method: Composition-based stats. Identities = 10/48 (20%), Positives = 22/48 (45%) Query: 33 VGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 G+ L ++ E+ E+ ++ R R ER +L+ + ++ D Sbjct: 206 EGNLLLTGDEKAEQERQRAEQERQRAEQERQRAERLAQLLREQGIDPD 253 >gi|163802970|ref|ZP_02196857.1| cell divison protein FtsB [Vibrio sp. AND4] gi|159173260|gb|EDP58088.1| cell divison protein FtsB [Vibrio sp. AND4] Length = 93 Score = 37.4 bits (86), Expect = 0.63, Method: Composition-based stats. Identities = 16/83 (19%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF++ + G G+ ++E + +++ S+L+ + + ++ + Sbjct: 3 IFVIALTLLFGWLQYTLWFGKNGVSDYYTVEDEIEAQQQVNSKLQARNNEMFAEIDDLRQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR+ L L ++DE Sbjct: 63 G---LDAIEERARHELGLVKNDE 82 >gi|226328654|ref|ZP_03804172.1| hypothetical protein PROPEN_02549 [Proteus penneri ATCC 35198] gi|225203387|gb|EEG85741.1| hypothetical protein PROPEN_02549 [Proteus penneri ATCC 35198] Length = 106 Score = 37.4 bits (86), Expect = 0.68, Method: Composition-based stats. Identities = 14/64 (21%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + + ++LKE RL ++ ++ G ++ L+E+AR L + Sbjct: 32 GKNGIHDYNKVTQEVESALAQNTQLKERNDRLFAEIDDLNGG---QEALEERARSELGMI 88 Query: 94 RSDE 97 + +E Sbjct: 89 KPNE 92 >gi|114320989|ref|YP_742672.1| cell division protein FtsB [Alkalilimnicola ehrlichii MLHE-1] gi|122311409|sp|Q0A7K5|FTSB_ALHEH RecName: Full=Cell division protein ftsB homolog gi|114227383|gb|ABI57182.1| cell division protein FtsB [Alkalilimnicola ehrlichii MLHE-1] Length = 95 Score = 37.4 bits (86), Expect = 0.71, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G+ GL + L +S+ + + L++ LE +V + G + L+E+AR L + Sbjct: 22 GEGGLNDVRGLSRSVEAQREEVDRLRQRNQALEAEVNDLKTG---LEALEERARSELGMI 78 Query: 94 RSDE 97 R E Sbjct: 79 REGE 82 >gi|297538277|ref|YP_003674046.1| Septum formation initiator [Methylotenera sp. 301] gi|297257624|gb|ADI29469.1| Septum formation initiator [Methylotenera sp. 301] Length = 136 Score = 37.4 bits (86), Expect = 0.72, Method: Composition-based stats. Identities = 18/84 (21%), Positives = 34/84 (40%), Gaps = 6/84 (7%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + VI + Y +G L + L ++ S LK L+ +V+ + Sbjct: 6 LIFVILIALLQYPLW---LGKGSWLRVWDLSRQLATQQEKNSALKARNETLDAEVRDLKS 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G ++E+AR L + + DE+ Sbjct: 63 GRA---AIEERARSELGMIKQDEV 83 >gi|332685800|ref|YP_004455574.1| hypothetical protein MPTP_0267 [Melissococcus plutonius ATCC 35311] gi|332369809|dbj|BAK20765.1| hypothetical protein MPTP_0267 [Melissococcus plutonius ATCC 35311] Length = 158 Score = 37.4 bits (86), Expect = 0.75, Method: Composition-based stats. Identities = 23/106 (21%), Positives = 48/106 (45%), Gaps = 8/106 (7%) Query: 2 WTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIV--GDYGLKANKSLEKSLIERERFLSELK 59 + K K+ F R VI C + F GDY + ++ ++ + +++ Sbjct: 25 YEKRQKQLIFKRRRLAVIFTCAFIIFIFSGFQLIGDY--SRLNTFKQQELKVKNQSAKID 82 Query: 60 ENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 E R++L+++V L+ + D + + AR L S+++E I + Sbjct: 83 EQRTQLKQEVDLLKNE----DYVAKLARSRLYGSKNNEQIYTIPEL 124 >gi|262370259|ref|ZP_06063585.1| septum formation initiator [Acinetobacter johnsonii SH046] gi|262314601|gb|EEY95642.1| septum formation initiator [Acinetobacter johnsonii SH046] Length = 131 Score = 37.0 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 19/91 (20%), Positives = 39/91 (42%), Gaps = 3/91 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + L +A + F G+ G + + L + + ++ ++LKE L +V + + Sbjct: 12 VLLGLAIILIAGFQYLYWFGEGGYQDHLQLTQKIQQQTEINNDLKERNRVLAAEVYDLKN 71 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 G + ++E AR L L + E + S Sbjct: 72 GI---EAIEEHARLDLGLIKPRETFIQMSTI 99 >gi|53803283|ref|YP_114927.1| septum formation initiator family protein [Methylococcus capsulatus str. Bath] gi|53757044|gb|AAU91335.1| septum formation initiator family protein [Methylococcus capsulatus str. Bath] Length = 122 Score = 37.0 bits (85), Expect = 0.79, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 36/67 (53%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 GD L+ + L++ ++E + ++ + LE +++ + +G+ D ++E AR L + Sbjct: 22 GDGNLREMQRLQERIVELTEEGEKRRQRNAALEAEIRDLREGT---DAIEEHARRDLGMI 78 Query: 94 RSDEIIL 100 + E ++ Sbjct: 79 KEGETLV 85 >gi|301155315|emb|CBW14781.1| cell division protein [Haemophilus parainfluenzae T3T1] Length = 92 Score = 37.0 bits (85), Expect = 0.86, Method: Composition-based stats. Identities = 16/84 (19%), Positives = 39/84 (46%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+ I +V F G G K +E + E + +L + + +++ ++ Sbjct: 3 LFIGILVGILVLFQYDLWFGKNGYFDYKDVEAQIKENKAENEKLSQRNQMISAEIQGLTK 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G + ++E+AR S ++ + +E+ Sbjct: 63 GF---ESIEERARMSHDMVKPNEV 83 >gi|171057858|ref|YP_001790207.1| septum formation initiator [Leptothrix cholodnii SP-6] gi|170775303|gb|ACB33442.1| Septum formation initiator [Leptothrix cholodnii SP-6] Length = 94 Score = 37.0 bits (85), Expect = 0.90, Method: Composition-based stats. Identities = 19/70 (27%), Positives = 37/70 (52%), Gaps = 3/70 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ L++ + E+ E + RL +V+ + +G ++ ++EKAR L + Sbjct: 25 GHSGVPRVIELDRQVEEQRERNIEARMRNERLAAEVRDLREG---QETIEEKARGELGMI 81 Query: 94 RSDEIILFYS 103 R DEI++ Y+ Sbjct: 82 RPDEILVQYT 91 >gi|251793626|ref|YP_003008356.1| cell division protein FtsB [Aggregatibacter aphrophilus NJ8700] gi|247535023|gb|ACS98269.1| cell division protein FtsB [Aggregatibacter aphrophilus NJ8700] Length = 98 Score = 37.0 bits (85), Expect = 0.94, Method: Composition-based stats. Identities = 16/87 (18%), Positives = 38/87 (43%), Gaps = 3/87 (3%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 FF +F+ + ++ F G G K+ K + ++ +L + + ++K Sbjct: 5 FFMRLFISLLIAVLLLFQYDFWFGKNGYWDYKNTTKEIAVHQQENEKLSQRNQIIAAEIK 64 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDE 97 + +G D ++E+AR + + +E Sbjct: 65 DLKEG---VDAIEERARSQHEMVKPNE 88 >gi|328953068|ref|YP_004370402.1| Septum formation initiator [Desulfobacca acetoxidans DSM 11109] gi|328453392|gb|AEB09221.1| Septum formation initiator [Desulfobacca acetoxidans DSM 11109] Length = 145 Score = 37.0 bits (85), Expect = 0.94, Method: Composition-based stats. Identities = 13/66 (19%), Positives = 30/66 (45%), Gaps = 3/66 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G+ GL L + + LK+ RL + + + + +++ +++ R LN Sbjct: 49 GNKGLYHLYQLRQERERLFQANLSLKDENERLVKTIDRLQN---DREFIEDTIRKELNFI 105 Query: 94 RSDEII 99 + +E+I Sbjct: 106 KKNEVI 111 >gi|291570257|dbj|BAI92529.1| hypothetical protein [Arthrospira platensis NIES-39] Length = 298 Score = 37.0 bits (85), Expect = 0.95, Method: Composition-based stats. Identities = 9/42 (21%), Positives = 19/42 (45%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 + E++ +E ++ + R R ER +L+ + D L Sbjct: 257 RQRAERAEVELQQERQRAEAERQRAERLAELLRAQGINPDEL 298 >gi|261345863|ref|ZP_05973507.1| cell division protein FtsB [Providencia rustigianii DSM 4541] gi|282566353|gb|EFB71888.1| cell division protein FtsB [Providencia rustigianii DSM 4541] Length = 98 Score = 36.7 bits (84), Expect = 0.99, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ ++ + +E S LK+ +L ++ ++DG +D ++E+AR L + Sbjct: 22 GKNGIHDYVKVKDDVAAQEIVNSRLKQRNEQLFAEINDLNDG---QDAIEERARSELGMV 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|33597775|ref|NP_885418.1| cell division protein FtsB [Bordetella parapertussis 12822] gi|81426501|sp|Q7W5P0|FTSB_BORPA RecName: Full=Cell division protein ftsB homolog gi|33574204|emb|CAE38536.1| putative conserved inner membrane protein [Bordetella parapertussis] Length = 118 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + E+ L+ + LE +V+ ++ G ++E+AR L + Sbjct: 22 GKGGWFKVWDLQRQVAEQRETNDGLRARNTALEAEVRDLATG---VGAVEERARSELGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|194289293|ref|YP_002005200.1| cell division protein ftsb [Cupriavidus taiwanensis LMG 19424] gi|193223128|emb|CAQ69133.1| Septum formation initiator [Cupriavidus taiwanensis LMG 19424] Length = 152 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L + L E+ LK ++LE +V + DG+ ++E+ARY L + Sbjct: 61 GKGGWLRVWDLNRQLTEQGARNQTLKLRNAKLEGEVADLQDGT---GAIEERARYELGMV 117 Query: 94 RSDEIIL 100 R E+ + Sbjct: 118 REGEVFV 124 >gi|34498915|ref|NP_903130.1| hypothetical protein CV_3460 [Chromobacterium violaceum ATCC 12472] gi|81654728|sp|Q7NSG6|FTSB_CHRVO RecName: Full=Cell division protein ftsB homolog gi|34104764|gb|AAQ61121.1| conserved hypothetical protein [Chromobacterium violaceum ATCC 12472] Length = 100 Score = 36.7 bits (84), Expect = 1.0, Method: Composition-based stats. Identities = 16/56 (28%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 L+K L E+ +L + L+ +V+ + GS D ++E+AR L + R+ E+ Sbjct: 31 QLDKQLQEQRATTQKLVARNAALDAEVRDLKQGS---DAIEERARNELGMIRNGEV 83 >gi|159125482|gb|EDP50599.1| PHD finger domain protein, putative [Aspergillus fumigatus A1163] Length = 836 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 K E+ + E L + E + RLER +S+ L+ ++ EK R SL +SD+ +F Sbjct: 375 KERERKRLLHEAELQRIAEEQERLERGESRLSERQLKAEM--EKQRKSLEELQSDDHWIF 432 >gi|70993488|ref|XP_751591.1| PHD finger domain protein [Aspergillus fumigatus Af293] gi|66849225|gb|EAL89553.1| PHD finger domain protein, putative [Aspergillus fumigatus Af293] Length = 836 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 K E+ + E L + E + RLER +S+ L+ ++ EK R SL +SD+ +F Sbjct: 375 KERERKRLLHEAELQRIAEEQERLERGESRLSERQLKAEM--EKQRKSLEELQSDDHWIF 432 >gi|160900541|ref|YP_001566123.1| septum formation initiator [Delftia acidovorans SPH-1] gi|160366125|gb|ABX37738.1| Septum formation initiator [Delftia acidovorans SPH-1] Length = 92 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Query: 36 YGLKAN-KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSR 94 +G A K L++ + ++ + K RL +V + DG +++EKAR L + + Sbjct: 25 HGSVAYVKELQQQIHDQNVANALEKAENDRLASEVNDLKDG---LAMVEEKARSELGMVK 81 Query: 95 SDEIIL 100 +EI + Sbjct: 82 PNEIFV 87 >gi|253996916|ref|YP_003048980.1| Septum formation initiator [Methylotenera mobilis JLW8] gi|253983595|gb|ACT48453.1| Septum formation initiator [Methylotenera mobilis JLW8] Length = 109 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 16/84 (19%), Positives = 33/84 (39%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +I + +G L + + ++ + LK LE +V+ + Sbjct: 3 ALTLIFVILIALLQYPLWLGKGSWLRVWDLNRQVALQQEKNTTLKARNGTLEAEVRDLKS 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G K ++E+AR L + + DE+ Sbjct: 63 G---KAAIEERARSELGMIKQDEV 83 >gi|33593374|ref|NP_881018.1| cell division protein FtsB [Bordetella pertussis Tohama I] gi|33602677|ref|NP_890237.1| cell division protein FtsB [Bordetella bronchiseptica RB50] gi|81424830|sp|Q7VW80|FTSB_BORPE RecName: Full=Cell division protein ftsB homolog gi|81429960|sp|Q7WD76|FTSB_BORBR RecName: Full=Cell division protein ftsB homolog gi|33572730|emb|CAE42656.1| putative conserved inner membrane protein [Bordetella pertussis Tohama I] gi|33577119|emb|CAE35676.1| putative conserved inner membrane protein [Bordetella bronchiseptica RB50] gi|332382783|gb|AEE67630.1| cell division protein FtsB [Bordetella pertussis CS] Length = 118 Score = 36.7 bits (84), Expect = 1.1, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + E+ L+ + LE +V+ ++ G ++E+AR L + Sbjct: 22 GKGGWFKVWDLQRQVAEQRETNDGLRARNTALEAEVRDLATG---VGAVEERARSELGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|224369807|ref|YP_002603971.1| FtsB [Desulfobacterium autotrophicum HRM2] gi|223692524|gb|ACN15807.1| FtsB [Desulfobacterium autotrophicum HRM2] Length = 96 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 18/101 (17%), Positives = 41/101 (40%), Gaps = 10/101 (9%) Query: 7 KKNHFFRAIFL-VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 +K F R + I V+ F + + G L + +I+ + +L L Sbjct: 2 QKTIFQRLLLFSTIIVMVVILFM--IVYSENGFNDWCHLNREIIDIQSENKKLDLANREL 59 Query: 66 ERKVKLMSDGSLEKDL--LDEKARYSLNLSRSDEIILFYSD 104 R ++ + D+ ++ AR+ L ++ +EI+ + + Sbjct: 60 ARTIERLKT-----DMGYIEHVARHELGMTGKNEIVFRFKE 95 >gi|320355014|ref|YP_004196353.1| Septum formation initiator [Desulfobulbus propionicus DSM 2032] gi|320123516|gb|ADW19062.1| Septum formation initiator [Desulfobulbus propionicus DSM 2032] Length = 108 Score = 36.7 bits (84), Expect = 1.2, Method: Composition-based stats. Identities = 15/92 (16%), Positives = 33/92 (35%), Gaps = 3/92 (3%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K H R ++++ A G + L++ ++ + + L+ L Sbjct: 10 KRHDRRILWILGAVVVFFSLLWILFAPGRGFFHYRKLQQEIVTLTQENARLEAKNIELSE 69 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 +K + L+E AR L + +E + Sbjct: 70 DIKRLQSDDT---YLEEVARKKHGLLKKNETV 98 >gi|293604073|ref|ZP_06686484.1| cell division protein FtsB [Achromobacter piechaudii ATCC 43553] gi|292817555|gb|EFF76625.1| cell division protein FtsB [Achromobacter piechaudii ATCC 43553] Length = 144 Score = 36.7 bits (84), Expect = 1.3, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + E+ L+ + LE +V+ + GS ++E+AR L + Sbjct: 22 GKGGWFKVWDLQRQVAEQRETNEGLRARNAALEAEVRDLEGGS---GAIEERARGELGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|167629355|ref|YP_001679854.1| septum formation initiator family protein [Heliobacterium modesticaldum Ice1] gi|167592095|gb|ABZ83843.1| septum formation initiator family protein [Heliobacterium modesticaldum Ice1] Length = 120 Score = 36.3 bits (83), Expect = 1.3, Method: Composition-based stats. Identities = 13/86 (15%), Positives = 36/86 (41%), Gaps = 7/86 (8%) Query: 18 VIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSL 77 + +V F A+ + L + L +++ R +LE++ + ++ + Sbjct: 24 AMVAAVIVAFALAALPP---FLQQRQLARESDRLSAELEQVRAERRQLEKEKEWLASDAY 80 Query: 78 EKDLLDEKARYSLNLSRSDEIILFYS 103 +++ AR L L + E+++ + Sbjct: 81 ----VEQVARQQLGLVKPGEMMVVRT 102 >gi|329296038|ref|ZP_08253374.1| cell division protein FtsB [Plautia stali symbiont] Length = 105 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + + ++ ++LK +L ++ ++ GS + ++E+AR L + Sbjct: 22 GKNGIHDYTRVSEDVASQQANNAKLKARNDQLFAEIDDLNGGS---EAIEERARSELGMI 78 Query: 94 RSDE 97 R E Sbjct: 79 RPSE 82 >gi|89901427|ref|YP_523898.1| septum formation initiator [Rhodoferax ferrireducens T118] gi|89346164|gb|ABD70367.1| cell division protein FtsB [Rhodoferax ferrireducens T118] Length = 99 Score = 36.3 bits (83), Expect = 1.5, Method: Composition-based stats. Identities = 16/94 (17%), Positives = 39/94 (41%), Gaps = 3/94 (3%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 + +V +G L + L + L ++ + + RL +V+ Sbjct: 1 MGHRVVPAALIALLVILHAQLWLGRGSLPSVAHLTQQLSSQKELNQQAQLANDRLAAEVR 60 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + +G ++++EKAR L + + +EI + ++ Sbjct: 61 DLQEG---LEMVEEKARMELGMVKPNEIYVQIAN 91 >gi|323144157|ref|ZP_08078793.1| septum formation initiator [Succinatimonas hippei YIT 12066] gi|322416065|gb|EFY06763.1| septum formation initiator [Succinatimonas hippei YIT 12066] Length = 93 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 6/81 (7%) Query: 17 LVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGS 76 L+IA + Y G GLK + + +L++ ++ ++L++ + ++ + G+ Sbjct: 10 LLIAIGFLSY---DIWAGRNGLKQYEEISANLLKAQQQSAKLQDRNQAVIDELNDLKQGN 66 Query: 77 LEKDLLDEKARYSLNLSRSDE 97 ++E AR L L R DE Sbjct: 67 T---AIEELARTELGLIREDE 84 >gi|153870163|ref|ZP_01999618.1| Septum formation initiator [Beggiatoa sp. PS] gi|152073368|gb|EDN70379.1| Septum formation initiator [Beggiatoa sp. PS] Length = 90 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 18/84 (21%), Positives = 41/84 (48%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF+VI ++Y H +G + +L+K + ++++ +LK + +V + + Sbjct: 4 IFMVIFSLLLIYLQYHLWIGKDSYQEYNALKKMIAQQQQENMKLKTRNDMFKAEVNDLKN 63 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G + ++E AR L + + E+ Sbjct: 64 G---LESIEEHARLELGMIKRGEV 84 >gi|225181426|ref|ZP_03734869.1| Septum formation initiator [Dethiobacter alkaliphilus AHT 1] gi|225167824|gb|EEG76632.1| Septum formation initiator [Dethiobacter alkaliphilus AHT 1] Length = 116 Score = 36.3 bits (83), Expect = 1.6, Method: Composition-based stats. Identities = 15/95 (15%), Positives = 37/95 (38%), Gaps = 11/95 (11%) Query: 9 NHFFRAIFLVIAFCCVVYFT--NHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 + + + + + V+YF A ++L E + ++ + ++ Sbjct: 22 RPWQKRLIMGLILVVVLYFGLLFAAQY-----WRLVQFRQTLDEIDAQIAGARAQNEEMQ 76 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 +++ + L+E AR L + RS E++ F Sbjct: 77 AEIERLHS----PAYLEEMARQELGMVRSGELLFF 107 >gi|209523422|ref|ZP_03271977.1| protein of unknown function DUF820 [Arthrospira maxima CS-328] gi|209496164|gb|EDZ96464.1| protein of unknown function DUF820 [Arthrospira maxima CS-328] Length = 246 Score = 36.3 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 9/41 (21%), Positives = 20/41 (48%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 + LE+ ++ +L++ R R +R +L+ + L D Sbjct: 203 VTEQLEQERQAKQAATEQLEQERQRNQRLEQLLREAGLNPD 243 >gi|294827986|ref|YP_003573317.1| hypothetical protein LA_1951a [Leptospira interrogans serovar Lai str. 56601] gi|293385831|gb|ADE44193.1| hypothetical protein LA_1951a [Leptospira interrogans serovar Lai str. 56601] Length = 152 Score = 36.3 bits (83), Expect = 1.7, Method: Composition-based stats. Identities = 16/76 (21%), Positives = 32/76 (42%), Gaps = 6/76 (7%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 + + YF ++G+ G+ LE+SL + + L +LE K K++ Sbjct: 7 KIFLFSCFLSGLFYF---IVLGESGIVVRSQLEESLASLQLDIERLSYENRQLEEKQKIL 63 Query: 73 SDGSLEKDLLDEKARY 88 + + L+ +AR Sbjct: 64 KNDQV---ALEREARR 76 >gi|317401873|gb|EFV82481.1| cell division protein ftsB [Achromobacter xylosoxidans C54] Length = 107 Score = 35.9 bits (82), Expect = 1.7, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + + L+ + LE +V+ + +GS ++E+AR L + Sbjct: 22 GKGGWFKVWDLQRQVAAQRETNEGLRARNAALEAEVRDLDNGS---GAIEERARGELGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|268591363|ref|ZP_06125584.1| cell division protein FtsB [Providencia rettgeri DSM 1131] gi|291313340|gb|EFE53793.1| cell division protein FtsB [Providencia rettgeri DSM 1131] Length = 95 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ ++ + +E S LK +L ++ ++DG +D ++E+AR L + Sbjct: 22 GKNGIHDYVQVKDDVAAQEIVNSRLKMRNEQLFAEINDLNDG---QDAIEERARTELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|89075075|ref|ZP_01161516.1| hypothetical protein SKA34_21805 [Photobacterium sp. SKA34] gi|89049162|gb|EAR54727.1| hypothetical protein SKA34_21805 [Photobacterium sp. SKA34] Length = 92 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 15/86 (17%), Positives = 41/86 (47%), Gaps = 3/86 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+++ + + G G+ ++ +S+ ++ +EL + ++ ++K + Sbjct: 3 LFIIVLLVLIAWLQYDFWYGKNGMNEFTAVTESVSLQQAANAELHQRNQQMYAEIKDLHG 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 G K+ ++E+AR L L + E + Sbjct: 63 G---KEAVEERARTDLGLVKPGETFI 85 >gi|261867076|ref|YP_003254998.1| cell division protein FtsB [Aggregatibacter actinomycetemcomitans D11S-1] gi|293391448|ref|ZP_06635782.1| cell division protein FtsB [Aggregatibacter actinomycetemcomitans D7S-1] gi|261412408|gb|ACX81779.1| cell division protein FtsB [Aggregatibacter actinomycetemcomitans D11S-1] gi|290951982|gb|EFE02101.1| cell division protein FtsB [Aggregatibacter actinomycetemcomitans D7S-1] Length = 92 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/83 (16%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+ + ++ F G G K+ K + ++ +L + + ++K + + Sbjct: 3 LFISLLIAVLLLFQYDFWFGKNGYTDYKNTTKEIAVHQQENEKLSQRNQIIAAEIKDLKE 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR + + +E Sbjct: 63 G---VDAIEERARLQHEMVKPNE 82 >gi|332284906|ref|YP_004416817.1| hypothetical protein PT7_1653 [Pusillimonas sp. T7-7] gi|330428859|gb|AEC20193.1| hypothetical protein PT7_1653 [Pusillimonas sp. T7-7] Length = 82 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 14/59 (23%), Positives = 30/59 (50%), Gaps = 3/59 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + L+K + ++ L + L+ +V+ + G+ D ++E+AR L + R EI + Sbjct: 4 QELQKKVAAQQETNDALLARNNALQAEVQDLKSGT---DAIEERARGELGMIREGEIYV 59 >gi|90580339|ref|ZP_01236146.1| hypothetical protein VAS14_20446 [Vibrio angustum S14] gi|90438641|gb|EAS63825.1| hypothetical protein VAS14_20446 [Vibrio angustum S14] Length = 92 Score = 35.9 bits (82), Expect = 1.8, Method: Composition-based stats. Identities = 16/86 (18%), Positives = 42/86 (48%), Gaps = 3/86 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+++ + + G G+K ++ +S+ ++ +EL + ++ ++K + Sbjct: 3 LFIIVLLVLIAWLQYDFWYGKNGMKEFTAVTESVSLQQAANAELHQRNQQMYAEIKDLHG 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEIIL 100 G K+ ++E+AR L L + E + Sbjct: 63 G---KEAVEERARTDLGLVKPGETFI 85 >gi|295401973|ref|ZP_06811935.1| Septum formation initiator [Geobacillus thermoglucosidasius C56-YS93] gi|312109209|ref|YP_003987525.1| septum formation initiator [Geobacillus sp. Y4.1MC1] gi|294975975|gb|EFG51591.1| Septum formation initiator [Geobacillus thermoglucosidasius C56-YS93] gi|311214310|gb|ADP72914.1| Septum formation initiator [Geobacillus sp. Y4.1MC1] Length = 135 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 21/102 (20%), Positives = 43/102 (42%), Gaps = 12/102 (11%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIER---ERFLSELKENR 62 +K R F I + + + ++ +E L ++ E+ L +L++ + Sbjct: 30 RRKIAIVRFAFFGILLAALSSIFFYTLHSQ-----SQDIEAKLADKKRMEQQLDKLEKQQ 84 Query: 63 SRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +LE ++K + D + + E AR LS+ EII + Sbjct: 85 KQLEEEIKKLHDD----EYIAELARKKYYLSKEGEIIFVVPE 122 >gi|241662673|ref|YP_002981033.1| cell division protein FtsB [Ralstonia pickettii 12D] gi|240864700|gb|ACS62361.1| Septum formation initiator [Ralstonia pickettii 12D] Length = 124 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G ++K + + + +ELK+ ++LE +VK + +G+ ++E+ARY L + Sbjct: 35 GKGGWLRVWDMQKQVTAQNQRNAELKQRNTKLEGEVKDLKEGT---GAIEERARYELGMV 91 Query: 94 RSDE 97 + DE Sbjct: 92 KDDE 95 >gi|121535072|ref|ZP_01666889.1| Septum formation initiator [Thermosinus carboxydivorans Nor1] gi|121306322|gb|EAX47247.1| Septum formation initiator [Thermosinus carboxydivorans Nor1] Length = 98 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 18/98 (18%), Positives = 39/98 (39%), Gaps = 10/98 (10%) Query: 3 TKYYKKNHFFRA-IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKEN 61 + ++ +R F ++ + YF + G Y ++ + + L E+++ Sbjct: 1 MAHLRQGKKYRFNWFRLVMLGLIGYFGY-VLYGQY--TELAAIRQEMAATRARLEEVRQQ 57 Query: 62 RSRL-ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 L E + +L + +EK AR L L + E+ Sbjct: 58 NKALQEERQRLTTPAYVEK-----LAREELGLVKPGEV 90 >gi|45657811|ref|YP_001897.1| hypothetical protein LIC11952 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] gi|45601051|gb|AAS70534.1| hypothetical protein LIC_11952 [Leptospira interrogans serovar Copenhageni str. Fiocruz L1-130] Length = 166 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 17/85 (20%), Positives = 35/85 (41%), Gaps = 6/85 (7%) Query: 7 KKNHFFRAIFLVIAFCCVVYFT---NHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 +K + F F + + ++G+ G+ LE+SL + + L Sbjct: 9 RKQYKFMITLPTKIFLFSCFLSGLFYFIVLGESGIVVRSQLEESLASLQLDIERLSYENR 68 Query: 64 RLERKVKLMSDGSLEKDLLDEKARY 88 +LE K K++ + + L+ +AR Sbjct: 69 QLEEKQKILKNDQV---ALEREARR 90 >gi|209523420|ref|ZP_03271975.1| protein of unknown function DUF820 [Arthrospira maxima CS-328] gi|209496162|gb|EDZ96462.1| protein of unknown function DUF820 [Arthrospira maxima CS-328] Length = 239 Score = 35.9 bits (82), Expect = 1.9, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 20/40 (50%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 + LE+ ++ +L++ R R +R +L+ + L D Sbjct: 197 TEQLEQERQAKQAATEQLEQERQRNQRLEQLLREAGLNPD 236 >gi|325118182|emb|CBZ53733.1| conserved hypothetical protein [Neospora caninum Liverpool] Length = 1629 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 28/60 (46%), Gaps = 3/60 (5%) Query: 41 NKSLEKSLIERERFLSELKENRSRL---ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 N LEK + L++ R RL R+ + D +E D L E + L+LS+S E Sbjct: 817 NVELEKLRTKLAEQADLLRDARERLAIQRRRCARLRDDLVEADELTELVKGQLSLSQSQE 876 >gi|217970081|ref|YP_002355315.1| septum formation initiator [Thauera sp. MZ1T] gi|217507408|gb|ACK54419.1| Septum formation initiator [Thauera sp. MZ1T] Length = 90 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 15/71 (21%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G +++ L + L++ + L +V + G+ + ++E+AR+ L L+ Sbjct: 22 GKGGWLRVWEVDRQLHAQREENLRLEQRNAALAAEVNDLKSGN---EAIEERARFELGLT 78 Query: 94 RSDEIILFYSD 104 R EI + Sbjct: 79 RPGEIYVQIPQ 89 >gi|94986816|ref|YP_594749.1| hypothetical protein LI0372 [Lawsonia intracellularis PHE/MN1-00] gi|94731065|emb|CAJ54428.1| hypothetical protein LI0372 [Lawsonia intracellularis PHE/MN1-00] Length = 103 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 16/96 (16%), Positives = 39/96 (40%), Gaps = 3/96 (3%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 ++ F + L IA + + G + L + + L + L + + +RL Sbjct: 7 RSAFLKLGVLSIAILLNIILVVRLVWGAHSLISYRELILQHKSITQELQKYDDTIARLSH 66 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +++L+ +++ R LN + +EI+ + Sbjct: 67 EIQLLHS---NPSYIEKMIRQHLNFVKDNEILYLIT 99 >gi|257061635|ref|YP_003139523.1| hypothetical protein Cyan8802_3884 [Cyanothece sp. PCC 8802] gi|256591801|gb|ACV02688.1| hypothetical protein Cyan8802_3884 [Cyanothece sp. PCC 8802] Length = 265 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 7/44 (15%), Positives = 15/44 (34%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 + + E E + R R E+ + + ++ D L Sbjct: 222 QERQRAETEYQRAETEYQRAETERQRAEKLAAFLREQGIDPDTL 265 >gi|116328442|ref|YP_798162.1| hypothetical protein LBL_1784 [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116331170|ref|YP_800888.1| hypothetical protein LBJ_1560 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] gi|116121186|gb|ABJ79229.1| Hypothetical protein LBL_1784 [Leptospira borgpetersenii serovar Hardjo-bovis L550] gi|116124859|gb|ABJ76130.1| Hypothetical protein LBJ_1560 [Leptospira borgpetersenii serovar Hardjo-bovis JB197] Length = 152 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 30/69 (43%), Gaps = 6/69 (8%) Query: 20 AFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEK 79 + YF ++G+ G+ LE+SL + L +LE K K++ + + Sbjct: 15 FLGGLFYF---IVLGESGIVVRSQLEESLASLRLDVERLTYENRQLEEKQKILKNDQV-- 69 Query: 80 DLLDEKARY 88 L+ +AR Sbjct: 70 -ALEREARR 77 >gi|187928066|ref|YP_001898553.1| cell division protein FtsB [Ralstonia pickettii 12J] gi|226707151|sp|B2U9C4|FTSB_RALPJ RecName: Full=Cell division protein ftsB homolog gi|187724956|gb|ACD26121.1| Septum formation initiator [Ralstonia pickettii 12J] Length = 111 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G ++K + + + +ELK+ ++LE +VK + +G+ ++E+ARY L + Sbjct: 22 GKGGWLRVWDMQKQVTAQNQRNAELKQRNTKLEGEVKDLKEGT---GAIEERARYELGMV 78 Query: 94 RSDE 97 + DE Sbjct: 79 KDDE 82 >gi|317126802|ref|YP_004093084.1| septum formation initiator [Bacillus cellulosilyticus DSM 2522] gi|315471750|gb|ADU28353.1| Septum formation initiator [Bacillus cellulosilyticus DSM 2522] Length = 127 Score = 35.9 bits (82), Expect = 2.0, Method: Composition-based stats. Identities = 21/98 (21%), Positives = 37/98 (37%), Gaps = 6/98 (6%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 +K R F FT + + L + LEK + E L EL+ L Sbjct: 30 RRKGLIRRLTFFGCLIMGFFIFTGITLYNQHTLINEQELEKQ--QLEDKLLELENEEQNL 87 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + +++L+ + D + E AR L++ E + Sbjct: 88 KEEIELLH----DPDYIAEIARRDFYLTKPGETLFQLP 121 >gi|209523421|ref|ZP_03271976.1| protein of unknown function DUF820 [Arthrospira maxima CS-328] gi|209496163|gb|EDZ96463.1| protein of unknown function DUF820 [Arthrospira maxima CS-328] Length = 239 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 9/40 (22%), Positives = 20/40 (50%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 + LE+ ++ +L++ R R +R +L+ + L D Sbjct: 197 TEQLEQERQAKQAATEQLEQERQRNQRLEQLLREAGLNPD 236 >gi|212711371|ref|ZP_03319499.1| hypothetical protein PROVALCAL_02443 [Providencia alcalifaciens DSM 30120] gi|212686100|gb|EEB45628.1| hypothetical protein PROVALCAL_02443 [Providencia alcalifaciens DSM 30120] Length = 98 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ ++ + +E S LK+ +L ++ ++DG +D ++E+AR L + Sbjct: 22 GKNGIHDYVKVKDDVAAQEIVNSRLKQRNEQLFAEINDLNDG---QDAIEERARSELGML 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|297736541|emb|CBI25412.3| unnamed protein product [Vitis vinifera] Length = 683 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGS---------LEKDLLDE 84 L + + E+ L+E K +LE + K + GS LE +LL+E Sbjct: 344 SQLIQKVSSLEQELAESKREIQKLENRCKRLESGSVSSIGVVEALEPELLNE 395 >gi|225448584|ref|XP_002273969.1| PREDICTED: hypothetical protein [Vitis vinifera] Length = 818 Score = 35.9 bits (82), Expect = 2.1, Method: Composition-based stats. Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 9/52 (17%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGS---------LEKDLLDE 84 L + + E+ L+E K +LE + K + GS LE +LL+E Sbjct: 479 SQLIQKVSSLEQELAESKREIQKLENRCKRLESGSVSSIGVVEALEPELLNE 530 >gi|330721388|gb|EGG99455.1| Cell division protein FtsB [gamma proteobacterium IMCC2047] Length = 96 Score = 35.9 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 21/84 (25%), Positives = 38/84 (45%), Gaps = 6/84 (7%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 + LV+ + Y VG+ L ++K L E++ SEL+ L+ +V + Sbjct: 5 WVLLVVFILGLQYRLW---VGENSLAELWGVKKKLEEQQSINSELQARNDALKAEVSDLK 61 Query: 74 DGSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR L + +E Sbjct: 62 QG---LDAIEERARSELGMINENE 82 >gi|149911464|ref|ZP_01900081.1| hypothetical protein PE36_23061 [Moritella sp. PE36] gi|149805495|gb|EDM65502.1| hypothetical protein PE36_23061 [Moritella sp. PE36] Length = 95 Score = 35.9 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 16/69 (23%), Positives = 33/69 (47%), Gaps = 3/69 (4%) Query: 29 NHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 H IVG+ G+ K +E+ + + L E + L+ ++ + +G D ++E+ R Sbjct: 20 YHFIVGNNGVMDYKRIEREVNIQHSNNQVLIERNTALKNEILDLRNGY---DAIEERTRN 76 Query: 89 SLNLSRSDE 97 L + + E Sbjct: 77 ELGMIKEGE 85 >gi|218248569|ref|YP_002373940.1| hypothetical protein PCC8801_3834 [Cyanothece sp. PCC 8801] gi|218169047|gb|ACK67784.1| conserved hypothetical protein [Cyanothece sp. PCC 8801] Length = 265 Score = 35.9 bits (82), Expect = 2.2, Method: Composition-based stats. Identities = 7/44 (15%), Positives = 15/44 (34%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 + + E E + R R E+ + + ++ D L Sbjct: 222 QERQRAETERQRAETEYQRAETERQRAEKLAAFLREQGIDPDTL 265 >gi|163856113|ref|YP_001630411.1| cell division protein FtsB [Bordetella petrii DSM 12804] gi|226707112|sp|A9IIP9|FTSB_BORPD RecName: Full=Cell division protein ftsB homolog gi|163259841|emb|CAP42142.1| Cell division protein ftsB homolog [Bordetella petrii] Length = 111 Score = 35.5 bits (81), Expect = 2.2, Method: Composition-based stats. Identities = 14/67 (20%), Positives = 30/67 (44%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + + L+ + LE +V+ ++ G ++E+AR L + Sbjct: 22 GKGGWFKVWDLQRQVAAQHETNDGLRARNAALEAEVRDLATG---VGAIEERARSELGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|323704329|ref|ZP_08115908.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11] gi|323536395|gb|EGB26167.1| Peptidase M23 [Thermoanaerobacterium xylanolyticum LX-11] Length = 304 Score = 35.5 bits (81), Expect = 2.3, Method: Composition-based stats. Identities = 21/99 (21%), Positives = 36/99 (36%), Gaps = 9/99 (9%) Query: 4 KYYKKNHFFRAIFLVIA-FCCVVYFT------NHAIVGDYGLKANKSLEKSLIERERFLS 56 + K + F A+ L+I F YF A+ + A + + E + Sbjct: 29 RSALKAYIFAAVVLLIGLFSTFFYFAGKYAYLYAAVHEKDKIIA--EKNQKIAEMQDLNQ 86 Query: 57 ELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRS 95 + + L K +SD D L++K R + LS Sbjct: 87 SQGKKIAMLNDNAKKLSDKMKSLDELEQKVRRMVGLSSP 125 >gi|332528283|ref|ZP_08404288.1| septum formation initiator [Hylemonella gracilis ATCC 19624] gi|332042303|gb|EGI78624.1| septum formation initiator [Hylemonella gracilis ATCC 19624] Length = 96 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 3/59 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +L L + + E K+ RL +V+ + +G D+++EKAR L + + +EI + Sbjct: 37 AALANKLEAQTQRNIEAKQQNERLAAEVQDLQEG---LDMVEEKARRELGMVKPNEIYV 92 >gi|264677263|ref|YP_003277169.1| septum formation initiator [Comamonas testosteroni CNB-2] gi|299530807|ref|ZP_07044222.1| Septum formation initiator [Comamonas testosteroni S44] gi|262207775|gb|ACY31873.1| Septum formation initiator [Comamonas testosteroni CNB-2] gi|298721323|gb|EFI62265.1| Septum formation initiator [Comamonas testosteroni S44] Length = 92 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 L++ + ++ + K RL+ +V + DG ++EKARY L + + +EI + Sbjct: 33 ELQQQIKDQYAANALEKSENDRLQSEVNDLKDG---LSTVEEKARYELGMVKPNEIYI 87 >gi|283850652|ref|ZP_06367939.1| Septum formation initiator [Desulfovibrio sp. FW1012B] gi|283573895|gb|EFC21868.1| Septum formation initiator [Desulfovibrio sp. FW1012B] Length = 110 Score = 35.5 bits (81), Expect = 2.4, Method: Composition-based stats. Identities = 14/91 (15%), Positives = 38/91 (41%), Gaps = 3/91 (3%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R L ++ + I D G+ A L+ + + L + ++ L ++++ + Sbjct: 4 RRFLLTGLIFFNIFLLYNLIWSDNGIFAYLELKARHEQLRQRLEGVNDHSLDLSQEIRWL 63 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 ++ ++ AR +N + +EI+ + Sbjct: 64 KT---DRAFTEKMARSQMNYLKENEILYQFP 91 >gi|332216410|ref|XP_003257343.1| PREDICTED: tumor necrosis factor receptor superfamily member 16-like [Nomascus leucogenys] Length = 183 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 11/65 (16%), Positives = 22/65 (33%), Gaps = 6/65 (9%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + + + Y ++K ++ R L L +++ + V L S Sbjct: 62 LLATVVLGLLAYVAFKCWH------SHKQRQQLAKARTAELGGLNKDQMHGDSSVFLDSP 115 Query: 75 GSLEK 79 SLE Sbjct: 116 SSLEP 120 >gi|15639174|ref|NP_218620.1| hypothetical protein TP0181 [Treponema pallidum subsp. pallidum str. Nichols] gi|189025414|ref|YP_001933186.1| hypothetical protein TPASS_0181 [Treponema pallidum subsp. pallidum SS14] gi|14285844|sp|O83211|Y181_TREPA RecName: Full=Uncharacterized protein TP_0181 gi|3322473|gb|AAC65194.1| predicted coding region TP0181 [Treponema pallidum subsp. pallidum str. Nichols] gi|189017989|gb|ACD70607.1| hypothetical protein TPASS_0181 [Treponema pallidum subsp. pallidum SS14] gi|291059588|gb|ADD72323.1| putative septum formation initiator subfamily [Treponema pallidum subsp. pallidum str. Chicago] Length = 147 Score = 35.5 bits (81), Expect = 2.5, Method: Composition-based stats. Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 5/92 (5%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + R + ++ Y G+ G+ A + LE+ E + L E L Sbjct: 2 RIYLRVVLP-LSLALNSYGVLAFFWGERGVCAMRLLEREKKELVHHIQTLAERGRDLAAV 60 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 V + S +++ + AR L R+ ++++ Sbjct: 61 VDAL---SFDEETIGAYAR-QLGYVRAGDVLV 88 >gi|120553854|ref|YP_958205.1| septum formation initiator [Marinobacter aquaeolei VT8] gi|120323703|gb|ABM18018.1| cell division protein FtsB [Marinobacter aquaeolei VT8] Length = 90 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 +LE+S+ E+ +EL RL +V+ + + E+ ++E+AR +L L R DE Sbjct: 31 ALEQSIAEQREENAELAARNDRLYAEVRNLRN---EQGAVEERARMNLGLIREDE 82 >gi|332526688|ref|ZP_08402790.1| septum formation initiator [Rubrivivax benzoatilyticus JA2] gi|332111091|gb|EGJ11123.1| septum formation initiator [Rubrivivax benzoatilyticus JA2] Length = 92 Score = 35.5 bits (81), Expect = 2.6, Method: Composition-based stats. Identities = 14/46 (30%), Positives = 28/46 (60%), Gaps = 3/46 (6%) Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +E +RLE +V + +G ++++EKAR L + + DEI++ + Sbjct: 47 RERNARLEAEVSDLKEG---LEMVEEKARAELGMVKPDEILVQVAP 89 >gi|188534822|ref|YP_001908619.1| cell division protein FtsB [Erwinia tasmaniensis Et1/99] gi|226707121|sp|B2VFZ8|FTSB_ERWT9 RecName: Full=Cell division protein ftsB homolog gi|188029864|emb|CAO97748.1| Cell division protein ftsB homolog [Erwinia tasmaniensis Et1/99] Length = 104 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ +++ + ++ ++LK RL ++ ++ GS + ++E+AR L + Sbjct: 22 GKNGIHDYTRVDEDVASQQGNNAKLKARNDRLFAEIDDLNGGS---EAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|157961014|ref|YP_001501048.1| septum formation initiator [Shewanella pealeana ATCC 700345] gi|189038853|sp|A8H1S6|FTSB_SHEPA RecName: Full=Cell division protein ftsB homolog gi|157846014|gb|ABV86513.1| Septum formation initiator [Shewanella pealeana ATCC 700345] Length = 98 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 14/82 (17%), Positives = 35/82 (42%), Gaps = 3/82 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 L + + +GD L + L++ + +++ ++L L ++ + G Sbjct: 4 LLFVLIALLAMLQYRLWLGDKSLADSFHLQEQIKLQQQSNAQLVARNQVLREEISDLRSG 63 Query: 76 SLEKDLLDEKARYSLNLSRSDE 97 + + L+E+AR L + + E Sbjct: 64 T---EALEERARNELGMVKEGE 82 >gi|119500078|ref|XP_001266796.1| PHD finger domain protein, putative [Neosartorya fischeri NRRL 181] gi|119414961|gb|EAW24899.1| PHD finger domain protein, putative [Neosartorya fischeri NRRL 181] Length = 837 Score = 35.5 bits (81), Expect = 2.7, Method: Composition-based stats. Identities = 19/60 (31%), Positives = 31/60 (51%), Gaps = 2/60 (3%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILF 101 K E+ + E L + E + RLER +S+ L+ ++ EK R SL +SD+ +F Sbjct: 375 KDRERKRLLHEAELQRIAEEQERLERGESRLSERQLKAEM--EKQRKSLEELQSDDHWIF 432 >gi|220934359|ref|YP_002513258.1| Septum formation initiator [Thioalkalivibrio sp. HL-EbGR7] gi|254790061|sp|B8GQ76|FTSB_THISH RecName: Full=Cell division protein ftsB homolog gi|219995669|gb|ACL72271.1| Septum formation initiator [Thioalkalivibrio sp. HL-EbGR7] Length = 95 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 3/55 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 L ++L + EL+ + L+ +V + G D ++E+AR L + R DE Sbjct: 31 QLRQTLEAQRAENEELRYRNAALDAEVTDLKTG---LDAIEERARRELGMIRRDE 82 >gi|113867209|ref|YP_725698.1| cell division protein FtsB [Ralstonia eutropha H16] gi|123329397|sp|Q0KCE1|FTSB_RALEH RecName: Full=Cell division protein ftsB homolog gi|113525985|emb|CAJ92330.1| septum formation initiator [Ralstonia eutropha H16] Length = 113 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L + L E+ LK ++LE +V + DG+ ++E+ARY L + Sbjct: 22 GKGGWLRVWDLNRQLTEQGTRNQTLKLRNAKLEGEVADLQDGT---GAIEERARYELGMV 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|152979685|ref|YP_001345314.1| cell division protein FtsB [Actinobacillus succinogenes 130Z] gi|171704498|sp|A6VQY2|FTSB_ACTSZ RecName: Full=Cell division protein ftsB homolog gi|150841408|gb|ABR75379.1| Septum formation initiator [Actinobacillus succinogenes 130Z] Length = 92 Score = 35.1 bits (80), Expect = 3.0, Method: Composition-based stats. Identities = 12/83 (14%), Positives = 35/83 (42%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + ++I ++ F G G + ++ + + ++L + + ++K + D Sbjct: 3 LLIIILAFVLMLFQYDLWFGKNGYLDYQETQQEIAVHKEENTKLSQRNQVIAAEIKDLKD 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G + + E+AR + + +E Sbjct: 63 G---VNAIQERARLQYEMVKPNE 82 >gi|78357115|ref|YP_388564.1| cell division protein FtsB [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] gi|78219520|gb|ABB38869.1| cell division protein FtsB [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 108 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 21/95 (22%), Positives = 37/95 (38%), Gaps = 7/95 (7%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 +R I L + + I G G+ A L+ + ++ L L R+++ Sbjct: 2 LWRHIALGGSLLFNMIMLYTLIWGTQGVIAYNDLKSQYKRLQAQIASLDNRNIALSREIR 61 Query: 71 LMSDG--SLEKDLLDEKARYSLNLSRSDEIILFYS 103 L+ +EK R +N R DEI+ +S Sbjct: 62 LLQSDGRYIEK-----MVRKRMNFVREDEILYIFS 91 >gi|317485228|ref|ZP_07944109.1| septum formation initiator [Bilophila wadsworthia 3_1_6] gi|316923519|gb|EFV44724.1| septum formation initiator [Bilophila wadsworthia 3_1_6] Length = 120 Score = 35.1 bits (80), Expect = 3.1, Method: Composition-based stats. Identities = 18/97 (18%), Positives = 42/97 (43%), Gaps = 3/97 (3%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K ++ L++A V + + G L + + L E + + L R Sbjct: 13 KATLWKVFILILAIIVNVVLASRLLWGPQSLVSYRELASQYAELLKERDGFDVVNAGLSR 72 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +++L+ ++ +++ R LN RS+EI+ +++ Sbjct: 73 EIRLLQS---DEKYVEKMIRQRLNFVRSNEILYLFTE 106 >gi|220909904|ref|YP_002485215.1| hypothetical protein Cyan7425_4546 [Cyanothece sp. PCC 7425] gi|219866515|gb|ACL46854.1| protein of unknown function DUF820 [Cyanothece sp. PCC 7425] Length = 260 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 10/49 (20%), Positives = 20/49 (40%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 G+ L ++ +E E+ ++ R R E+ + L+ D L Sbjct: 207 GNLLLTGDEQVEPLTAALEQERQRAEQERQRAEQLAAYLRSIGLDPDHL 255 >gi|221068546|ref|ZP_03544651.1| Septum formation initiator [Comamonas testosteroni KF-1] gi|220713569|gb|EED68937.1| Septum formation initiator [Comamonas testosteroni KF-1] Length = 92 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 30/58 (51%), Gaps = 3/58 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 L++ + ++ + K RL+ +V + DG ++EKARY L + + +EI + Sbjct: 33 ELQQQINDQYAANALEKTENDRLQSEVNDLKDG---LSTVEEKARYELGMVKPNEIYI 87 >gi|17545849|ref|NP_519251.1| cell division protein FtsB [Ralstonia solanacearum GMI1000] gi|25091681|sp|Q8Y0B4|FTSB_RALSO RecName: Full=Cell division protein ftsB homolog gi|17428143|emb|CAD14832.1| putative cell division ftsb homolog. transmembrane protein [Ralstonia solanacearum GMI1000] Length = 111 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G ++K + + + +ELK+ +LE +VK + +G+ ++E+ARY L + Sbjct: 22 GKGGWLRVWDMQKQVASQNQRNAELKQRNLKLEGEVKDLKEGT---GAIEERARYELGMV 78 Query: 94 RSDE 97 + DE Sbjct: 79 KDDE 82 >gi|114332431|ref|YP_748653.1| septum formation initiator [Nitrosomonas eutropha C91] gi|114309445|gb|ABI60688.1| cell division protein FtsB [Nitrosomonas eutropha C91] Length = 93 Score = 35.1 bits (80), Expect = 3.2, Method: Composition-based stats. Identities = 18/83 (21%), Positives = 31/83 (37%), Gaps = 6/83 (7%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 LV+ Y G G + + +I L+ + LE +V + G Sbjct: 7 LLVLMIALTQYPLW---FGKGGWLEIMEMHEQIIALHETNQSLQNRNTVLEAEVNNLKKG 63 Query: 76 SLEKDLLDEKARYSLNLSRSDEI 98 D ++E AR L + R +E+ Sbjct: 64 ---LDAIEELARSELGMIRRNEL 83 >gi|326475429|gb|EGD99438.1| molybdenum cofactor biosynthetic protein [Trichophyton tonsurans CBS 112818] Length = 464 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 41 NKSLEKSLIERERFLSELKENRSRLE-RKVKLMSDGSLEKDLL-DEKARY 88 + LE + ER LS+LK+ + LE ++ + D S + LL DE RY Sbjct: 8 RRQLEAQIAATERQLSQLKQELADLETQQPEATRDRSADWPLLQDEYRRY 57 >gi|151302301|gb|ABR92532.1| AprB [Desulfofustis glycolicus] Length = 111 Score = 35.1 bits (80), Expect = 3.3, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 22/55 (40%), Gaps = 7/55 (12%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFL 55 MWT ++ + R F + +A G+ G +L+ ++ E+ L Sbjct: 61 MWTVKFRNGNLKRFKFPIRTTAEGA---ANAYTGEKG----ANLDDEILTLEKEL 108 >gi|321264125|ref|XP_003196780.1| hypothetical protein CGB_K3620C [Cryptococcus gattii WM276] gi|317463257|gb|ADV24993.1| Hypothetical protein CGB_K3620C [Cryptococcus gattii WM276] Length = 500 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 11/44 (25%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKL--MSDGSLEKDL 81 A + + + L+ L+ +R+ LE++V + S EKD+ Sbjct: 78 AIRERDATAANLRDELNSLRADRAALEKRVIEWDLRWKSQEKDM 121 >gi|291570125|dbj|BAI92397.1| hypothetical protein [Arthrospira platensis NIES-39] Length = 278 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 8/42 (19%), Positives = 20/42 (47%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 + E++ +E ++ ++ R R ER +L+ + + L Sbjct: 237 RQRAEQAELELQQERQRVEAERQRAERLAELLRAQGINPEEL 278 >gi|193215230|ref|YP_001996429.1| septum formation initiator [Chloroherpeton thalassium ATCC 35110] gi|193088707|gb|ACF13982.1| Septum formation initiator [Chloroherpeton thalassium ATCC 35110] Length = 148 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 18/84 (21%), Positives = 37/84 (44%), Gaps = 4/84 (4%) Query: 21 FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 F V + +A+ GDYG+ LE + L+E + +L+ +++ + E + Sbjct: 68 FVLVCFLVLYALFGDYGIVQRLRLEYHYRSLQSELAEENKRTKQLQAEIRHVK----EIE 123 Query: 81 LLDEKARYSLNLSRSDEIILFYSD 104 ++ AR NL++ E + Sbjct: 124 EIERIAREKYNLTKEGETVYIIKQ 147 >gi|326477466|gb|EGE01476.1| molybdenum cofactor biosynthetic protein [Trichophyton equinum CBS 127.97] Length = 474 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 18/50 (36%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Query: 41 NKSLEKSLIERERFLSELKENRSRLE-RKVKLMSDGSLEKDLL-DEKARY 88 + LE + ER LS+LK+ + LE ++ + D S + LL DE RY Sbjct: 8 RRQLEAQIAATERQLSQLKQELADLETQQPEATRDRSADWPLLQDEYRRY 57 >gi|325577107|ref|ZP_08147591.1| cell division protein FtsB [Haemophilus parainfluenzae ATCC 33392] gi|325160689|gb|EGC72810.1| cell division protein FtsB [Haemophilus parainfluenzae ATCC 33392] Length = 92 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 15/84 (17%), Positives = 38/84 (45%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+ I +V F G G K + + E + +L + + +++ ++ Sbjct: 3 LFIGILVGILVLFQYDLWFGKNGYFDYKDVAAQIKENKAENEKLSQRNQMISAEIQGLTK 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G + ++E+AR S ++ + +E+ Sbjct: 63 GF---ESIEERARMSHDMVKPNEV 83 >gi|332971087|gb|EGK10057.1| cell division protein divIC [Desmospora sp. 8437] Length = 79 Score = 35.1 bits (80), Expect = 3.4, Method: Composition-based stats. Identities = 19/61 (31%), Positives = 31/61 (50%), Gaps = 5/61 (8%) Query: 45 EKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 E +L+E+ R L+ L++ R L++++ + D D L E AR + E IL SD Sbjct: 23 EAALVEKRRELASLEKERRELKQEINRLQDE----DYLFELARKM-GYGKPGEEILDVSD 77 Query: 105 F 105 Sbjct: 78 L 78 >gi|85860511|ref|YP_462713.1| septum formation initiator [Syntrophus aciditrophicus SB] gi|85723602|gb|ABC78545.1| septum formation initiator [Syntrophus aciditrophicus SB] Length = 91 Score = 35.1 bits (80), Expect = 3.5, Method: Composition-based stats. Identities = 14/66 (21%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 GD GL + ++K L ++ E+ S+L+ + L+ D +++ AR L + Sbjct: 24 GDRGLVDSYMMQKRLAALQKENQEIIRENSQLKHTIALLKDDLSYIEMV---ARNDLGMV 80 Query: 94 RSDEII 99 + +++ Sbjct: 81 KDGDMV 86 >gi|328956575|ref|YP_004373961.1| cell-division initiation protein [Carnobacterium sp. 17-4] gi|328672899|gb|AEB28945.1| cell-division initiation protein [Carnobacterium sp. 17-4] Length = 137 Score = 35.1 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 17/89 (19%), Positives = 34/89 (38%), Gaps = 7/89 (7%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 L ++ V F + + +E E + L +++ + L ++K + D Sbjct: 41 ILAVSCFFVSGFAINIWTNT---QTISQMEHEKKEAQNELKLVEKEQENLNNQIKKLEDE 97 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYSD 104 D + + AR LS +EII + Sbjct: 98 ----DYVAKVARSQYYLSEENEIIFSLPE 122 >gi|30249042|ref|NP_841112.1| putative transmembrane protein [Nitrosomonas europaea ATCC 19718] gi|30138659|emb|CAD84954.1| putative transmembrane protein [Nitrosomonas europaea ATCC 19718] Length = 93 Score = 35.1 bits (80), Expect = 3.7, Method: Composition-based stats. Identities = 17/90 (18%), Positives = 33/90 (36%), Gaps = 6/90 (6%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 LV+ Y G A + + + + L+ + LE +V + G Sbjct: 7 LLVLLIGLAQYPLW---FGKGSWLAILEMHEQIAALQEANQRLQNRNTVLEAEVNNLKKG 63 Query: 76 SLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 D ++E AR L + R +E+ ++ Sbjct: 64 F---DAIEELARSELGMIRKNELFFRVVEY 90 >gi|108762160|ref|YP_631890.1| cell division protein FtsB [Myxococcus xanthus DK 1622] gi|108466040|gb|ABF91225.1| cell division protein FtsB [Myxococcus xanthus DK 1622] Length = 93 Score = 34.7 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 14/90 (15%), Positives = 31/90 (34%), Gaps = 3/90 (3%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 R FL++A + ++V G + SL + + + L L ++ Sbjct: 2 TARRKFLLVAVGVAAALSLVSVVDAKGFRRYLSLRQDVESVQARNRSLSAQNEALRNEIA 61 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + + L+ R L + E++ Sbjct: 62 ALRK---DPAALERAVREELGFVKPGELVF 88 >gi|24114043|ref|NP_708553.1| cell division protein FtsB [Shigella flexneri 2a str. 301] gi|30064105|ref|NP_838276.1| cell division protein FtsB [Shigella flexneri 2a str. 2457T] gi|110806621|ref|YP_690141.1| cell division protein FtsB [Shigella flexneri 5 str. 8401] gi|81723097|sp|Q83JY0|FTSB_SHIFL RecName: Full=Cell division protein ftsB homolog gi|123047982|sp|Q0T1H9|FTSB_SHIF8 RecName: Full=Cell division protein ftsB homolog gi|24053167|gb|AAN44260.1| orf, conserved hypothetical protein [Shigella flexneri 2a str. 301] gi|30042361|gb|AAP18086.1| hypothetical protein S2964 [Shigella flexneri 2a str. 2457T] gi|110616169|gb|ABF04836.1| conserved hypothetical protein [Shigella flexneri 5 str. 8401] gi|281602119|gb|ADA75103.1| ftsB-like cell division protein [Shigella flexneri 2002017] gi|313647815|gb|EFS12261.1| septum formation initiator family protein [Shigella flexneri 2a str. 2457T] gi|332753472|gb|EGJ83852.1| septum formation initiator family protein [Shigella flexneri 4343-70] gi|332753606|gb|EGJ83985.1| septum formation initiator family protein [Shigella flexneri K-671] gi|332755697|gb|EGJ86060.1| septum formation initiator family protein [Shigella flexneri 2747-71] gi|332765702|gb|EGJ95915.1| essential cell division protein FtsB [Shigella flexneri 2930-71] gi|332999502|gb|EGK19087.1| septum formation initiator family protein [Shigella flexneri VA-6] gi|332999958|gb|EGK19541.1| septum formation initiator family protein [Shigella flexneri K-218] gi|333001101|gb|EGK20671.1| septum formation initiator family protein [Shigella flexneri K-272] gi|333015394|gb|EGK34733.1| septum formation initiator family protein [Shigella flexneri K-227] gi|333015763|gb|EGK35101.1| septum formation initiator family protein [Shigella flexneri K-304] Length = 103 Score = 34.7 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + + ++LK +L ++ ++ G ++ L+E+AR L+++ Sbjct: 22 GKNGIHDYTRVNDDVAALQATNAKLKARNDQLFAEIDDLNGG---QEALEERARNELSMT 78 Query: 94 RSDE 97 R E Sbjct: 79 RPGE 82 >gi|88705815|ref|ZP_01103524.1| Septum formation initiator [Congregibacter litoralis KT71] gi|88699886|gb|EAQ96996.1| Septum formation initiator [Congregibacter litoralis KT71] Length = 102 Score = 34.7 bits (79), Expect = 3.8, Method: Composition-based stats. Identities = 19/65 (29%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 GD G L + + +R + L+E L R+V+ + G+ +L+++AR L L+ Sbjct: 22 GDGGRLELMRLRQQAQDSQRENALLRERNEELARQVRDLKAGNT---VLEQRAREELGLT 78 Query: 94 RSDEI 98 DEI Sbjct: 79 GEDEI 83 >gi|258593196|emb|CBE69535.1| putative Septum formation initiator (ftsB) [NC10 bacterium 'Dutch sediment'] Length = 123 Score = 34.7 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 16/92 (17%), Positives = 37/92 (40%), Gaps = 5/92 (5%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 K+ R + + ++ ++VG + K+ E ++ ++ LK+ L R Sbjct: 20 KSSRKRWLVFLAGLAILI--AVASVVGKKSFVKVLQMSKTRTELQQEITRLKQVNEGLTR 77 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 ++ + ++ AR L L + EI+ Sbjct: 78 EI---RSFANNPSQVEAIAREDLGLVKPGEIV 106 >gi|294634776|ref|ZP_06713305.1| cell division protein FtsB [Edwardsiella tarda ATCC 23685] gi|291091835|gb|EFE24396.1| cell division protein FtsB [Edwardsiella tarda ATCC 23685] Length = 114 Score = 34.7 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G GL +++ + ++ ++LK +L ++ ++ G ++ ++E+AR L + Sbjct: 22 GKNGLHDYMRVKQDVAVQQANNAKLKSRNDQLFAEIDDLNGG---QEAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|293189392|ref|ZP_06608115.1| septum formation initiator family protein [Actinomyces odontolyticus F0309] gi|292821855|gb|EFF80791.1| septum formation initiator family protein [Actinomyces odontolyticus F0309] Length = 253 Score = 34.7 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 L E+ L + + ++E ++ + ++R++ L + + D + +AR L R E Sbjct: 128 LYQWWQQERELAQIKTQVAEQQQKNADMQRQLDLWN----DPDYISTQARERLGFVRPGE 183 >gi|293392786|ref|ZP_06637104.1| cell division protein FtsB [Serratia odorifera DSM 4582] gi|291424645|gb|EFE97856.1| cell division protein FtsB [Serratia odorifera DSM 4582] Length = 123 Score = 34.7 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 31/64 (48%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + + ++ ++LK +L ++ ++ G ++ ++E+AR L + Sbjct: 40 GKNGVHDYVRVNEDVAAQQGNNAKLKARNDQLFAEIDDLNGG---QEAIEERARNELGMI 96 Query: 94 RSDE 97 + E Sbjct: 97 KPGE 100 >gi|90416191|ref|ZP_01224123.1| hypothetical protein GB2207_10953 [marine gamma proteobacterium HTCC2207] gi|90331916|gb|EAS47130.1| hypothetical protein GB2207_10953 [marine gamma proteobacterium HTCC2207] Length = 102 Score = 34.7 bits (79), Expect = 3.9, Method: Composition-based stats. Identities = 16/82 (19%), Positives = 34/82 (41%), Gaps = 3/82 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 ++I + VG+ L L + L ++E L++ ++ V+ + + Sbjct: 4 LIIILVVLLAGLQWRLWVGEGSLAHRAELNRQLQQQEDENQTLRQRNQQIATDVESLKN- 62 Query: 76 SLEKDLLDEKARYSLNLSRSDE 97 D ++EKAR L + + E Sbjct: 63 --NLDAIEEKARADLGMIKQGE 82 >gi|319792843|ref|YP_004154483.1| septum formation initiator [Variovorax paradoxus EPS] gi|315595306|gb|ADU36372.1| Septum formation initiator [Variovorax paradoxus EPS] Length = 92 Score = 34.7 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 13/68 (19%), Positives = 33/68 (48%), Gaps = 3/68 (4%) Query: 33 VGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNL 92 G ++ L+ L +++ ++ RL +V + DG ++++E+AR L + Sbjct: 24 NGRGSVRDVVQLQTKLTDQKEANAKATITNERLASEVNDLKDG---LEMVEERARAELGM 80 Query: 93 SRSDEIIL 100 + +E+ + Sbjct: 81 VKPNEVFV 88 >gi|311104812|ref|YP_003977665.1| cell division protein FtsB [Achromobacter xylosoxidans A8] gi|310759501|gb|ADP14950.1| cell division protein FtsB [Achromobacter xylosoxidans A8] Length = 137 Score = 34.7 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 16/67 (23%), Positives = 31/67 (46%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L++ + E+ L+ + LE +V+ + GS ++E+AR L + Sbjct: 22 GKGGWFKVWDLQRQVAEQRETNEGLRARNAALEAEVRDLEGGS---GAIEERARGELGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 RDGEVFV 85 >gi|54310176|ref|YP_131196.1| hypothetical protein PBPRA3078 [Photobacterium profundum SS9] gi|46914617|emb|CAG21394.1| conserved hypothetical protein [Photobacterium profundum SS9] Length = 95 Score = 34.7 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 12/69 (17%), Positives = 35/69 (50%), Gaps = 3/69 (4%) Query: 29 NHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 +G GL ++E ++ +++ +EL + ++ ++ + G ++ ++E+AR Sbjct: 21 YDFWLGKNGLMDYLAVEANVGIQQKANAELVQRNQQMYAEIDDLHRG---QESVEERARS 77 Query: 89 SLNLSRSDE 97 L + + +E Sbjct: 78 ELGMIKPNE 86 >gi|319940789|ref|ZP_08015128.1| hypothetical protein HMPREF9464_00347 [Sutterella wadsworthensis 3_1_45B] gi|319805671|gb|EFW02452.1| hypothetical protein HMPREF9464_00347 [Sutterella wadsworthensis 3_1_45B] Length = 420 Score = 34.7 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 16/50 (32%), Positives = 29/50 (58%), Gaps = 2/50 (4%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDG--SLEKDLLDEKARYS 89 K ++S+ E R L LK RS +E+++ + S+E+DL + ++RY Sbjct: 77 KKADQSISEANRRLRTLKTERSTVEQRLSELRQDGRSVERDLREARSRYE 126 >gi|311694166|gb|ADP97039.1| septum formation initiator [marine bacterium HP15] Length = 83 Score = 34.7 bits (79), Expect = 4.0, Method: Composition-based stats. Identities = 18/55 (32%), Positives = 32/55 (58%), Gaps = 3/55 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 +LE+S+ E+ +EL RL +V+ + + E+ ++E+AR +L L R DE Sbjct: 24 ALEQSIAEQREENAELATRNERLYAEVRNLRN---EQGAVEERARMNLGLIRDDE 75 >gi|293571074|ref|ZP_06682115.1| septum formation initiator subfamily, putative [Enterococcus faecium E980] gi|291608857|gb|EFF38138.1| septum formation initiator subfamily, putative [Enterococcus faecium E980] Length = 141 Score = 34.7 bits (79), Expect = 4.1, Method: Composition-based stats. Identities = 12/72 (16%), Positives = 28/72 (38%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 + ++ F R I +V F + + ++ L + +E + E+ + Sbjct: 25 QQQRQLIFRRRRLAAIFVGALVIFAIIGVQIFHDMQRMHQLNELRVEANAEMKEVNADVD 84 Query: 64 RLERKVKLMSDG 75 +L + V L+ D Sbjct: 85 QLHQDVSLLKDD 96 >gi|239816420|ref|YP_002945330.1| septum formation initiator [Variovorax paradoxus S110] gi|239802997|gb|ACS20064.1| Septum formation initiator [Variovorax paradoxus S110] Length = 92 Score = 34.7 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 10/59 (16%), Positives = 31/59 (52%), Gaps = 4/59 (6%) Query: 46 KSLIERERFLSELKENRSRL----ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + + + + L++ K ++ ER ++D + ++++E+AR L + + +E+ + Sbjct: 30 RDVAQLQSKLADQKAANAKAVVNNERLASEVNDLKIGLEMVEERARQELGMVKPNEVFV 88 >gi|119944443|ref|YP_942123.1| septum formation initiator [Psychromonas ingrahamii 37] gi|166216891|sp|A1SSQ9|FTSB_PSYIN RecName: Full=Cell division protein ftsB homolog gi|119863047|gb|ABM02524.1| cell division protein FtsB [Psychromonas ingrahamii 37] Length = 92 Score = 34.7 bits (79), Expect = 4.2, Method: Composition-based stats. Identities = 20/83 (24%), Positives = 39/83 (46%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+ C +V H G GL +L++ + SEL++ + ++K + + Sbjct: 3 LFVFFMLCLLVLLQYHLWFGKNGLGDRHNLQEEVTLILENNSELRQRNQMMFSEIKDLKE 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G+ D ++E+AR L L + E Sbjct: 63 GT---DAIEERARNELGLVKEGE 82 >gi|49073692|gb|AAT49342.1| PA3634 [synthetic construct] Length = 95 Score = 34.7 bits (79), Expect = 4.3, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 6/92 (6%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 ++ ++ + L++A + Y VGD L + L+K + ++ L E L Sbjct: 2 RLRSPYWLFVVLILALAGLQYRLW---VGDGSLAQVRDLQKQIADQHGENERLLERNRIL 58 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 E +V + G+ + ++E+AR+ L + + E Sbjct: 59 EAEVAELKKGT---ETVEERARHELGMVKDGE 87 >gi|239906796|ref|YP_002953537.1| septum formation initiator family protein [Desulfovibrio magneticus RS-1] gi|239796662|dbj|BAH75651.1| septum formation initiator family protein [Desulfovibrio magneticus RS-1] Length = 112 Score = 34.7 bits (79), Expect = 4.4, Method: Composition-based stats. Identities = 14/94 (14%), Positives = 40/94 (42%), Gaps = 4/94 (4%) Query: 10 HFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV 69 + R + + V+ + I D G+ A L+ + ++ L + + L +++ Sbjct: 2 IWRRFLLTAL-IFFNVFLLYNLIWSDNGIFAYLELKSRHEQLKQRLEAVNDKSLDLSQEI 60 Query: 70 KLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 + + ++ ++ AR +N + +EI+ + Sbjct: 61 RWLKT---DQAFTEKMARSQMNYLKDNEILYQFP 91 >gi|304312488|ref|YP_003812086.1| Cell division protein, septum formation initiator [gamma proteobacterium HdN1] gi|301798221|emb|CBL46443.1| Cell division protein, septum formation initiator [gamma proteobacterium HdN1] Length = 93 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 6/88 (6%) Query: 17 LVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGS 76 L+IAF + Y VG+ L+ + ++E+ L E RL +VK + +GS Sbjct: 5 LLIAFVLLQYRLW---VGEGSFAEVWRLQTEIEKQEQENYVLGERNRRLTAEVKDLQEGS 61 Query: 77 LEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++E+AR L + +SDE++ D Sbjct: 62 A---AVEERARKQLGMIKSDEMLFIVRD 86 >gi|289662658|ref|ZP_06484239.1| cell division protein FtsB [Xanthomonas campestris pv. vasculorum NCPPB702] gi|289669621|ref|ZP_06490696.1| cell division protein FtsB [Xanthomonas campestris pv. musacearum NCPPB4381] Length = 121 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE + + + L++ L +VK + DG ++E+AR L + + E Sbjct: 35 LEAQVAHQTQDNEGLRQRNQALAAEVKDLKDGEA---AIEERARSELGMIKPGE 85 >gi|315126481|ref|YP_004068484.1| peptidase M13 protein [Pseudoalteromonas sp. SM9913] gi|315014995|gb|ADT68333.1| peptidase M13 protein [Pseudoalteromonas sp. SM9913] Length = 692 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 17/51 (33%), Positives = 24/51 (47%) Query: 26 YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGS 76 Y T HAI G+ GL + S + L+ +E R R +R + MS S Sbjct: 321 YLTYHAINGNAGLLSEDIFNTSFAFFGKELNGQQEPRPRWKRAISQMSGTS 371 >gi|317049285|ref|YP_004116933.1| Septum formation initiator [Pantoea sp. At-9b] gi|316950902|gb|ADU70377.1| Septum formation initiator [Pantoea sp. At-9b] Length = 105 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 12/64 (18%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ ++LK +L ++ ++ GS + ++E+AR L + Sbjct: 22 GKNGIHDYTRVNDDVASQQANNAKLKARNDQLFAEIDDLNGGS---EAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|256751007|ref|ZP_05491890.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1] gi|256750117|gb|EEU63138.1| Peptidase M23 [Thermoanaerobacter ethanolicus CCSD1] Length = 301 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 16/92 (17%), Positives = 37/92 (40%), Gaps = 9/92 (9%) Query: 7 KKNHFFRAIFLVIAFCCVVYF---TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K + +++A +VYF T + +K + + + E + + Sbjct: 32 KTTVTVAFLIIMVATAFLVYFSKTTFYLYS------VIAEKDKEIEQLTSLIEEQDKKIA 85 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRS 95 L++ +L+++ + L+EK R + LS Sbjct: 86 TLDKNAQLVNEKIKGLNELEEKVRRMVGLSTP 117 >gi|167040796|ref|YP_001663781.1| peptidase M23B [Thermoanaerobacter sp. X514] gi|300914831|ref|ZP_07132147.1| Peptidase M23 [Thermoanaerobacter sp. X561] gi|307723935|ref|YP_003903686.1| peptidase M23 [Thermoanaerobacter sp. X513] gi|166855036|gb|ABY93445.1| peptidase M23B [Thermoanaerobacter sp. X514] gi|300889766|gb|EFK84912.1| Peptidase M23 [Thermoanaerobacter sp. X561] gi|307580996|gb|ADN54395.1| Peptidase M23 [Thermoanaerobacter sp. X513] Length = 301 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 16/92 (17%), Positives = 37/92 (40%), Gaps = 9/92 (9%) Query: 7 KKNHFFRAIFLVIAFCCVVYF---TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K + +++A +VYF T + +K + + + E + + Sbjct: 32 KTTVTVAFLIIMVATAFLVYFSKTTFYLYS------VIAEKDKEIEQLTSLIEEQDKKIA 85 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRS 95 L++ +L+++ + L+EK R + LS Sbjct: 86 TLDKNAQLVNEKIKGLNELEEKVRRMVGLSTP 117 >gi|167037898|ref|YP_001665476.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|320116313|ref|YP_004186472.1| peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1] gi|166856732|gb|ABY95140.1| peptidase M23B [Thermoanaerobacter pseudethanolicus ATCC 33223] gi|319929404|gb|ADV80089.1| Peptidase M23 [Thermoanaerobacter brockii subsp. finnii Ako-1] Length = 301 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 16/92 (17%), Positives = 37/92 (40%), Gaps = 9/92 (9%) Query: 7 KKNHFFRAIFLVIAFCCVVYF---TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K + +++A +VYF T + +K + + + E + + Sbjct: 32 KTTVTVAFLIIMVATAFLVYFSKTTFYLYS------VIAEKDKEIEQLTSLIEEQDKKIA 85 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRS 95 L++ +L+++ + L+EK R + LS Sbjct: 86 TLDKNAQLVNEKIKGLNELEEKVRRMVGLSTP 117 >gi|134117369|ref|XP_772911.1| hypothetical protein CNBK2820 [Cryptococcus neoformans var. neoformans B-3501A] gi|50255529|gb|EAL18264.1| hypothetical protein CNBK2820 [Cryptococcus neoformans var. neoformans B-3501A] Length = 485 Score = 34.7 bits (79), Expect = 4.5, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKL--MSDGSLEKDL 81 A + + + L+ L+ +R+ LE++V + + EKD+ Sbjct: 77 AIRERDATAANLRDELNSLRADRAALEKRVIEWDLRWKNREKDM 120 >gi|90407892|ref|ZP_01216067.1| cell divison protein FtsB [Psychromonas sp. CNPT3] gi|90310983|gb|EAS39093.1| cell divison protein FtsB [Psychromonas sp. CNPT3] Length = 92 Score = 34.7 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 19/83 (22%), Positives = 36/83 (43%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF +I H G G++ NK L K + + +EL + + ++ + Sbjct: 3 IFFMILVFVFALEQYHLWWGKNGMQENKVLVKEVDLAIKSNAELMKRNQLMFAEIDDLRQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G+ + ++E+AR L L + E Sbjct: 63 GN---EAIEERARNELGLIKEGE 82 >gi|95930476|ref|ZP_01313212.1| Septum formation initiator [Desulfuromonas acetoxidans DSM 684] gi|95133516|gb|EAT15179.1| Septum formation initiator [Desulfuromonas acetoxidans DSM 684] Length = 105 Score = 34.7 bits (79), Expect = 4.6, Method: Composition-based stats. Identities = 25/98 (25%), Positives = 45/98 (45%), Gaps = 5/98 (5%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 KKN FL+IA V A+ G+ G +++ + +L++ +RL Sbjct: 10 KKNLTQSRSFLLIAVAVVG-LGF-ALFGEKGALRLHQVQQHQAQLLARYEQLQQANTRLR 67 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 ++ +S E+ + ++ AR + NL R EII +S Sbjct: 68 NEIDSLSHD--ERYM-EQVARSTFNLVRDGEIIYQFSP 102 >gi|269960394|ref|ZP_06174767.1| cell divison protein FtsB [Vibrio harveyi 1DA3] gi|269834821|gb|EEZ88907.1| cell divison protein FtsB [Vibrio harveyi 1DA3] Length = 93 Score = 34.7 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 15/83 (18%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF++ + G G+ ++E + +++ S+L+ + + ++ + Sbjct: 3 IFVIALTLLFGWLQYTLWFGKNGVSDYYTVEDEIEVQQQVNSKLQARNNEMFAEIDDLRQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR+ L L + E Sbjct: 63 G---LDAIEERARHELGLVKDGE 82 >gi|77164371|ref|YP_342896.1| septum formation initiator [Nitrosococcus oceani ATCC 19707] gi|254433586|ref|ZP_05047094.1| Septum formation initiator subfamily [Nitrosococcus oceani AFC27] gi|300114829|ref|YP_003761404.1| septum formation initiator [Nitrosococcus watsonii C-113] gi|123744361|sp|Q3JCT0|FTSB_NITOC RecName: Full=Cell division protein ftsB homolog gi|76882685|gb|ABA57366.1| cell division protein FtsB [Nitrosococcus oceani ATCC 19707] gi|207089919|gb|EDZ67190.1| Septum formation initiator subfamily [Nitrosococcus oceani AFC27] gi|299540766|gb|ADJ29083.1| Septum formation initiator [Nitrosococcus watsonii C-113] Length = 91 Score = 34.7 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 3/61 (4%) Query: 37 GLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD 96 GL + L +S+ ++ + L E L+ +V+ + G D L+E+AR L + + Sbjct: 25 GLGELRQLSRSIKQQRHENATLIERNQVLKAEVQDLKSG---LDALEERARSGLGMIKQG 81 Query: 97 E 97 E Sbjct: 82 E 82 >gi|253988166|ref|YP_003039522.1| cell division protein FtsB [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949] gi|253779616|emb|CAQ82777.1| cell division protein ftsb [Photorhabdus asymbiotica] Length = 106 Score = 34.7 bits (79), Expect = 4.7, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 30/64 (46%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ ++ + +E S+LK +L ++ + G ++ ++E+AR L + Sbjct: 22 GKNGIHDYAQVKNDVAVQEFKNSKLKVRNEQLSAEINDLYGG---QEAIEERARSVLGMV 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|319943949|ref|ZP_08018229.1| septum formation initiator family protein [Lautropia mirabilis ATCC 51599] gi|319742710|gb|EFV95117.1| septum formation initiator family protein [Lautropia mirabilis ATCC 51599] Length = 98 Score = 34.7 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 3/62 (4%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 L++SL + + + LE +V+ + G + ++E+ARY L + + DEI + Sbjct: 31 RLDQSLALQREVNAGKRLRNEGLEAEVEDLKSG---RSAVEERARYGLGMVKPDEIFVQI 87 Query: 103 SD 104 + Sbjct: 88 NP 89 >gi|313109038|ref|ZP_07795011.1| putative septum formation initiator [Pseudomonas aeruginosa 39016] gi|310881513|gb|EFQ40107.1| putative septum formation initiator [Pseudomonas aeruginosa 39016] Length = 94 Score = 34.7 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 42/92 (45%), Gaps = 6/92 (6%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 ++ ++ + L +A + Y VGD L + L+K + ++ L E L Sbjct: 2 RLRSPYWLFVVLTLALAGLQYRLW---VGDGSLAQVRDLQKQIADQHGENERLLERNRIL 58 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 E +V + G+ + ++E+AR+ L + + E Sbjct: 59 EAEVAELKKGT---ETVEERARHELGMVKDGE 87 >gi|91776260|ref|YP_546016.1| cell division protein FtsB [Methylobacillus flagellatus KT] gi|122399672|sp|Q1H012|FTSB_METFK RecName: Full=Cell division protein ftsB homolog gi|91710247|gb|ABE50175.1| cell division protein FtsB [Methylobacillus flagellatus KT] Length = 106 Score = 34.7 bits (79), Expect = 4.8, Method: Composition-based stats. Identities = 15/84 (17%), Positives = 36/84 (42%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 + +I + +G L + ++ ++ +ELK L+ +V+ + Sbjct: 3 LLTLIFVALIALLQYPLWLGKGSWLRVWDLNQKIVAQKAVNAELKLRNDTLDAEVRDLKQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G+ ++E+AR L + + DE+ Sbjct: 63 GNA---AIEERARSELGMIKQDEV 83 >gi|307546208|ref|YP_003898687.1| septum formation initiator [Halomonas elongata DSM 2581] gi|307218232|emb|CBV43502.1| septum formation initiator [Halomonas elongata DSM 2581] Length = 98 Score = 34.7 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 16/71 (22%), Positives = 32/71 (45%), Gaps = 3/71 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G+ ++ + + + E + L+ RL +V + G D ++E+AR + + Sbjct: 23 GEGSVRELADVGQRVENLEAENAPLRARNERLAAEVVDLKTG---LDAIEERARNEVGMV 79 Query: 94 RSDEIILFYSD 104 RSDE + D Sbjct: 80 RSDEQFFWVPD 90 >gi|293357587|ref|XP_342346.4| PREDICTED: centromere protein E [Rattus norvegicus] Length = 2503 Score = 34.7 bits (79), Expect = 4.9, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 28/44 (63%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 A+V GL +N LEK + + ++ L++ E + L+++V L+S+ Sbjct: 705 ALVDGKGLLSNLELEKRITDLQKELNKEVEEKETLQKEVHLLSE 748 >gi|325916053|ref|ZP_08178343.1| cell division protein FtsB [Xanthomonas vesicatoria ATCC 35937] gi|325537729|gb|EGD09435.1| cell division protein FtsB [Xanthomonas vesicatoria ATCC 35937] Length = 121 Score = 34.3 bits (78), Expect = 4.9, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE + + + L++ L +VK + DG ++E+AR L + + E Sbjct: 35 LEAQVAHQTQDNEGLRQRNQALAAEVKDLKDGEA---AIEERARSELGMIKPGE 85 >gi|325003188|ref|ZP_08124300.1| septum formation initiator [Pseudonocardia sp. P1] Length = 201 Score = 34.3 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 10/52 (19%), Positives = 22/52 (42%), Gaps = 3/52 (5%) Query: 49 IERERFLSELKENRSRLERKVKLMSDGSL---EKDLLDEKARYSLNLSRSDE 97 + + + L+ + E + LE V +S + + +AR L + + E Sbjct: 110 VAQRQELAAVSEQQQALEADVARLSADRARLSDPAEVQAQARTRLGMVQPGE 161 >gi|294787079|ref|ZP_06752333.1| Smc [Parascardovia denticolens F0305] gi|315226731|ref|ZP_07868519.1| chromosome partitioning protein Smc [Parascardovia denticolens DSM 10105] gi|294485912|gb|EFG33546.1| Smc [Parascardovia denticolens F0305] gi|315120863|gb|EFT83995.1| chromosome partitioning protein Smc [Parascardovia denticolens DSM 10105] Length = 1225 Score = 34.3 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 10/51 (19%), Positives = 21/51 (41%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLN 91 + L+ + L+ L+ R LE +V + + D+L E+ + Sbjct: 887 RQELQAQASSHDEELTVLRARRRDLEPRVNALIQREHDSDVLRERVAAQVG 937 >gi|225165515|ref|ZP_03727338.1| Maltoporin (phage lambda and maltose receptor)-like protein [Opitutaceae bacterium TAV2] gi|224800233|gb|EEG18640.1| Maltoporin (phage lambda and maltose receptor)-like protein [Opitutaceae bacterium TAV2] Length = 491 Score = 34.3 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 14/70 (20%), Positives = 24/70 (34%), Gaps = 11/70 (15%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENR 62 K H RAIF+ F A + +S + E +E+K +R Sbjct: 1 MNQKPKTHTTRAIFMAALVALGTTFG-----------ATPAFAQSSADIEALRAEIKASR 49 Query: 63 SRLERKVKLM 72 E ++ + Sbjct: 50 EAYEARIAEL 59 >gi|94310001|ref|YP_583211.1| cell division protein FtsB [Cupriavidus metallidurans CH34] gi|166216892|sp|Q1LPI4|FTSB_RALME RecName: Full=Cell division protein ftsB homolog gi|93353853|gb|ABF07942.1| cell division protein [Cupriavidus metallidurans CH34] gi|222875355|gb|EEF12486.1| predicted protein [Populus trichocarpa] Length = 113 Score = 34.3 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 18/67 (26%), Positives = 33/67 (49%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G L + + E+ LK ++LE +VK + DG+ ++E+ARY L + Sbjct: 22 GKGGWLRVWDLNRQVNEQTVHNQALKLRNAKLEGEVKDLQDGT---GAIEERARYELGMV 78 Query: 94 RSDEIIL 100 + E+ + Sbjct: 79 KDGEVFV 85 >gi|162606132|ref|XP_001713581.1| heat shock protein 70KD [Guillardia theta] gi|13794501|gb|AAK39876.1|AF165818_84 heat shock protein 70KD [Guillardia theta] Length = 650 Score = 34.3 bits (78), Expect = 5.0, Method: Composition-based stats. Identities = 22/84 (26%), Positives = 38/84 (45%), Gaps = 17/84 (20%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKL----------MSDGSL--- 77 I D G + + +E+ + E E++ +E ++ R ++E K L + D L Sbjct: 509 TITNDKGRLSKEEIERMVEEAEKYKNEDEKTRQKIEAKNNLENYAYNIRNTIRDEKLKDK 568 Query: 78 ----EKDLLDEKARYSLNLSRSDE 97 EK LL+EK R L ++E Sbjct: 569 IDENEKKLLEEKIREILEFVENNE 592 >gi|206890349|ref|YP_002248832.1| septum formation initiator family protein [Thermodesulfovibrio yellowstonii DSM 11347] gi|206742287|gb|ACI21344.1| septum formation initiator family protein [Thermodesulfovibrio yellowstonii DSM 11347] Length = 109 Score = 34.3 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 13/73 (17%), Positives = 35/73 (47%), Gaps = 3/73 (4%) Query: 28 TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKAR 87 GD G + L+K+ + + ++E+ L+ +++L+ + ++ L++ AR Sbjct: 33 GYSFFFGDMGYLKYRQLKKNEQKILKEINEISTENKLLKNEIELLKN---DRSYLEKYAR 89 Query: 88 YSLNLSRSDEIIL 100 + L + E++ Sbjct: 90 ENFGLVKPGEMVF 102 >gi|90020893|ref|YP_526720.1| cell division protein FtsB [Saccharophagus degradans 2-40] gi|122996372|sp|Q21LC1|FTSB_SACD2 RecName: Full=Cell division protein ftsB homolog gi|89950493|gb|ABD80508.1| cell division protein FtsB [Saccharophagus degradans 2-40] Length = 100 Score = 34.3 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 21/91 (23%), Positives = 42/91 (46%), Gaps = 6/91 (6%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 AI LV+A + Y +G+ + + SL + + +++ + L+E L +V + Sbjct: 5 AIILVVALLALQYRLW---MGEGSIASVVSLNREIAKQKEENARLRERNRLLAAEVDALK 61 Query: 74 DGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 G KD ++E+AR + + + E D Sbjct: 62 QG---KDAIEERARNDMGMIKEGETFFMIVD 89 >gi|163749997|ref|ZP_02157241.1| hypothetical protein KT99_17191 [Shewanella benthica KT99] gi|161330271|gb|EDQ01252.1| hypothetical protein KT99_17191 [Shewanella benthica KT99] Length = 96 Score = 34.3 bits (78), Expect = 5.1, Method: Composition-based stats. Identities = 15/82 (18%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 FL + F + G L + L + + + ++L L ++ + G Sbjct: 4 FLFVLFGLLGVLQYQLWYGVNSLPGSVELREQVALQREGNAKLVARNQVLREEIIDLRSG 63 Query: 76 SLEKDLLDEKARYSLNLSRSDE 97 + + L+E+AR L + + E Sbjct: 64 T---EALEERARNELGMVKEGE 82 >gi|303245515|ref|ZP_07331799.1| Septum formation initiator [Desulfovibrio fructosovorans JJ] gi|302493364|gb|EFL53226.1| Septum formation initiator [Desulfovibrio fructosovorans JJ] Length = 108 Score = 34.3 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 14/91 (15%), Positives = 38/91 (41%), Gaps = 3/91 (3%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R L ++ + I D G+ A L+ + + L + ++ L ++++ + Sbjct: 4 RRFLLTGLIFFNIFLLYNLIWSDNGIFAYLELKARHQQLKERLETINDHSLDLSQEIRWL 63 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 ++ ++ AR +N + +EI+ + Sbjct: 64 KT---DRAFTEKMARSQMNYLKGNEILYQFP 91 >gi|293345711|ref|XP_001077739.2| PREDICTED: centromere protein E [Rattus norvegicus] Length = 2532 Score = 34.3 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 28/44 (63%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 A+V GL +N LEK + + ++ L++ E + L+++V L+S+ Sbjct: 705 ALVDGKGLLSNLELEKRITDLQKELNKEVEEKETLQKEVHLLSE 748 >gi|153873905|ref|ZP_02002325.1| Protein of unknown function DUF820 [Beggiatoa sp. PS] gi|152069630|gb|EDN67674.1| Protein of unknown function DUF820 [Beggiatoa sp. PS] Length = 287 Score = 34.3 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 12/46 (26%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Query: 38 LKANKSLEKSLIE---RERFLSELKENRSRLERKVKLMSDGSLEKD 80 L A +++ E +E+ L E + R R ER +L+ + ++ D Sbjct: 239 LLAKHEQQRASFECQQKEQALQEAAQERQRAERLAQLLRESGIDPD 284 >gi|93006693|ref|YP_581130.1| septum formation initiator [Psychrobacter cryohalolentis K5] gi|92394371|gb|ABE75646.1| cell division protein FtsB [Psychrobacter cryohalolentis K5] Length = 102 Score = 34.3 bits (78), Expect = 5.2, Method: Composition-based stats. Identities = 18/87 (20%), Positives = 34/87 (39%), Gaps = 3/87 (3%) Query: 11 FFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 F + I L +A + +G+ G + L + E++R + L V Sbjct: 4 FSQFILLALAVAVLSGLQYQYWLGENGRVEHNKLLTEVNEQQRLNDNQVSANNLLRTDVN 63 Query: 71 LMSDGSLEKDLLDEKARYSLNLSRSDE 97 + G + ++E AR L L + +E Sbjct: 64 DLKTG---LEAVEEHARLDLGLIKPNE 87 >gi|254820128|ref|ZP_05225129.1| hypothetical protein MintA_09386 [Mycobacterium intracellulare ATCC 13950] Length = 220 Score = 34.3 bits (78), Expect = 5.3, Method: Composition-based stats. Identities = 20/89 (22%), Positives = 33/89 (37%), Gaps = 15/89 (16%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K++ + + RAI + + A G + R L+ + R+ Sbjct: 58 KHHIR--WARAIVYALLPGLALSLAVAA-----GFLKW----QGGSARTAQLAATESVRT 106 Query: 64 RLERKVKLM--SDGSLEKDLLDEKARYSL 90 E + L+ S+EKDL E AR L Sbjct: 107 ATESTIALLSYRADSVEKDL--EAARSRL 133 >gi|296423758|ref|XP_002841420.1| hypothetical protein [Tuber melanosporum Mel28] gi|295637658|emb|CAZ85611.1| unnamed protein product [Tuber melanosporum] Length = 1684 Score = 34.3 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 20/58 (34%), Positives = 29/58 (50%), Gaps = 2/58 (3%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE++L L ELK S LE +V+ +S+ +KD +EK+R LS E Sbjct: 212 VKLDLEQNLDMSAAELDELKRQLSNLEAEVRRLSETVEDKD--EEKSRLEQRLSLEKE 267 >gi|15598830|ref|NP_252324.1| hypothetical protein PA3634 [Pseudomonas aeruginosa PAO1] gi|116051631|ref|YP_789530.1| hypothetical protein PA14_17330 [Pseudomonas aeruginosa UCBPP-PA14] gi|152989221|ref|YP_001346889.1| hypothetical protein PSPA7_1505 [Pseudomonas aeruginosa PA7] gi|218890141|ref|YP_002439005.1| putative septum formation initiator [Pseudomonas aeruginosa LESB58] gi|254236548|ref|ZP_04929871.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|254242332|ref|ZP_04935654.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|296387861|ref|ZP_06877336.1| putative septum formation initiator [Pseudomonas aeruginosa PAb1] gi|9949793|gb|AAG07022.1|AE004783_7 conserved hypothetical protein [Pseudomonas aeruginosa PAO1] gi|115586852|gb|ABJ12867.1| putative septum formation initiator [Pseudomonas aeruginosa UCBPP-PA14] gi|126168479|gb|EAZ53990.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719] gi|126195710|gb|EAZ59773.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192] gi|150964379|gb|ABR86404.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7] gi|218770364|emb|CAW26129.1| putative septum formation initiator [Pseudomonas aeruginosa LESB58] Length = 94 Score = 34.3 bits (78), Expect = 5.4, Method: Composition-based stats. Identities = 20/92 (21%), Positives = 43/92 (46%), Gaps = 6/92 (6%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 ++ ++ + L++A + Y VGD L + L+K + ++ L E L Sbjct: 2 RLRSPYWLFVVLILALAGLQYRLW---VGDGSLAQVRDLQKQIADQHGENERLLERNRIL 58 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 E +V + G+ + ++E+AR+ L + + E Sbjct: 59 EAEVAELKKGT---ETVEERARHELGMVKDGE 87 >gi|238921118|ref|YP_002934633.1| cell division protein FtsB [Edwardsiella ictaluri 93-146] gi|259647166|sp|C5BGJ2|FTSB_EDWI9 RecName: Full=Cell division protein ftsB homolog gi|238870687|gb|ACR70398.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146] Length = 114 Score = 34.3 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 11/64 (17%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ +++ + ++ ++LK +L ++ ++ G ++ ++E+AR L + Sbjct: 22 GKNGVHDYMRVKQDVATQQANNAKLKSRNDQLFAEIDDLNGG---QEAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|67526421|ref|XP_661272.1| hypothetical protein AN3668.2 [Aspergillus nidulans FGSC A4] gi|40740686|gb|EAA59876.1| hypothetical protein AN3668.2 [Aspergillus nidulans FGSC A4] gi|259481795|tpe|CBF75649.1| TPA: PHD finger domain protein, putative (AFU_orthologue; AFUA_4G12400) [Aspergillus nidulans FGSC A4] Length = 827 Score = 34.3 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 3/60 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSL-NLSRSDEIIL 100 K E+ I E L ++E + +LER +S+ L+ +L EK R +L +LS+ DE I Sbjct: 379 KERERKRILHEAELERIQEEQKKLERGESRISERQLKAEL--EKQRKNLEDLSQEDEWIF 436 >gi|41408720|ref|NP_961556.1| hypothetical protein MAP2622 [Mycobacterium avium subsp. paratuberculosis K-10] gi|41397078|gb|AAS04939.1| hypothetical protein MAP_2622 [Mycobacterium avium subsp. paratuberculosis K-10] Length = 314 Score = 34.3 bits (78), Expect = 5.5, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Query: 40 ANKSLEKSLIERERF-LSELKENRSRLERK-VKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 A K LE L + + E R ER+ +L+++ + D LDE+AR ++ + Sbjct: 202 AKKELEAELATMRAEAQAAIDEARQEAERECARLLAEAKQKADDLDERARRTVEEANQQR 261 Query: 98 IILF 101 I++ Sbjct: 262 IMIL 265 >gi|69245446|ref|ZP_00603441.1| Septum formation initiator [Enterococcus faecium DO] gi|227552667|ref|ZP_03982716.1| septum formation initiator protein [Enterococcus faecium TX1330] gi|257879857|ref|ZP_05659510.1| septum formation initiator [Enterococcus faecium 1,230,933] gi|257882583|ref|ZP_05662236.1| septum formation initiator [Enterococcus faecium 1,231,502] gi|257886019|ref|ZP_05665672.1| septum formation initiator [Enterococcus faecium 1,231,501] gi|257888636|ref|ZP_05668289.1| septum formation initiator [Enterococcus faecium 1,141,733] gi|257891698|ref|ZP_05671351.1| septum formation initiator [Enterococcus faecium 1,231,410] gi|257894173|ref|ZP_05673826.1| septum formation initiator [Enterococcus faecium 1,231,408] gi|257897409|ref|ZP_05677062.1| septum formation initiator [Enterococcus faecium Com12] gi|257899969|ref|ZP_05679622.1| septum formation initiator [Enterococcus faecium Com15] gi|258614285|ref|ZP_05712055.1| hypothetical protein EfaeD_01102 [Enterococcus faecium DO] gi|260559530|ref|ZP_05831711.1| septum formation initiator [Enterococcus faecium C68] gi|261206681|ref|ZP_05921379.1| septum formation initiator [Enterococcus faecium TC 6] gi|289565042|ref|ZP_06445496.1| septum formation initiator [Enterococcus faecium D344SRF] gi|293378832|ref|ZP_06624987.1| septum formation initiator [Enterococcus faecium PC4.1] gi|293553695|ref|ZP_06674319.1| septum formation initiator subfamily, putative [Enterococcus faecium E1039] gi|293563196|ref|ZP_06677652.1| septum formation initiator subfamily, putative [Enterococcus faecium E1162] gi|293570118|ref|ZP_06681198.1| septum formation initiator subfamily, putative [Enterococcus faecium E1071] gi|294614897|ref|ZP_06694788.1| septum formation initiator subfamily, putative [Enterococcus faecium E1636] gi|294618631|ref|ZP_06698170.1| septum formation initiator subfamily, putative [Enterococcus faecium E1679] gi|294623707|ref|ZP_06702540.1| putative septum formation initiator [Enterococcus faecium U0317] gi|314938212|ref|ZP_07845512.1| septum formation initiator [Enterococcus faecium TX0133a04] gi|314943107|ref|ZP_07849906.1| septum formation initiator [Enterococcus faecium TX0133C] gi|314949304|ref|ZP_07852647.1| septum formation initiator [Enterococcus faecium TX0082] gi|314952237|ref|ZP_07855252.1| septum formation initiator [Enterococcus faecium TX0133A] gi|314992095|ref|ZP_07857545.1| septum formation initiator [Enterococcus faecium TX0133B] gi|314996278|ref|ZP_07861334.1| septum formation initiator [Enterococcus faecium TX0133a01] gi|68195828|gb|EAN10264.1| Septum formation initiator [Enterococcus faecium DO] gi|227178196|gb|EEI59168.1| septum formation initiator protein [Enterococcus faecium TX1330] gi|257814085|gb|EEV42843.1| septum formation initiator [Enterococcus faecium 1,230,933] gi|257818241|gb|EEV45569.1| septum formation initiator [Enterococcus faecium 1,231,502] gi|257821875|gb|EEV49005.1| septum formation initiator [Enterococcus faecium 1,231,501] gi|257824690|gb|EEV51622.1| septum formation initiator [Enterococcus faecium 1,141,733] gi|257828058|gb|EEV54684.1| septum formation initiator [Enterococcus faecium 1,231,410] gi|257830552|gb|EEV57159.1| septum formation initiator [Enterococcus faecium 1,231,408] gi|257833974|gb|EEV60395.1| septum formation initiator [Enterococcus faecium Com12] gi|257837881|gb|EEV62955.1| septum formation initiator [Enterococcus faecium Com15] gi|260074629|gb|EEW62950.1| septum formation initiator [Enterococcus faecium C68] gi|260079174|gb|EEW66867.1| septum formation initiator [Enterococcus faecium TC 6] gi|289163249|gb|EFD11095.1| septum formation initiator [Enterococcus faecium D344SRF] gi|291587490|gb|EFF19374.1| septum formation initiator subfamily, putative [Enterococcus faecium E1071] gi|291592183|gb|EFF23801.1| septum formation initiator subfamily, putative [Enterococcus faecium E1636] gi|291595150|gb|EFF26488.1| septum formation initiator subfamily, putative [Enterococcus faecium E1679] gi|291596922|gb|EFF28140.1| putative septum formation initiator [Enterococcus faecium U0317] gi|291602270|gb|EFF32498.1| septum formation initiator subfamily, putative [Enterococcus faecium E1039] gi|291604846|gb|EFF34324.1| septum formation initiator subfamily, putative [Enterococcus faecium E1162] gi|292642373|gb|EFF60528.1| septum formation initiator [Enterococcus faecium PC4.1] gi|313589522|gb|EFR68367.1| septum formation initiator [Enterococcus faecium TX0133a01] gi|313593309|gb|EFR72154.1| septum formation initiator [Enterococcus faecium TX0133B] gi|313595632|gb|EFR74477.1| septum formation initiator [Enterococcus faecium TX0133A] gi|313598166|gb|EFR77011.1| septum formation initiator [Enterococcus faecium TX0133C] gi|313642408|gb|EFS06988.1| septum formation initiator [Enterococcus faecium TX0133a04] gi|313644310|gb|EFS08890.1| septum formation initiator [Enterococcus faecium TX0082] Length = 141 Score = 34.3 bits (78), Expect = 5.6, Method: Composition-based stats. Identities = 12/72 (16%), Positives = 28/72 (38%) Query: 4 KYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 + ++ F R I +V F + + ++ L + +E + E+ + Sbjct: 25 QQQRQLIFRRRRLAAIFVGALVIFAIIGVQIFHDMQRMHQLNELRVEANTEMKEVNADVD 84 Query: 64 RLERKVKLMSDG 75 +L + V L+ D Sbjct: 85 QLHQDVSLLKDD 96 >gi|26249154|ref|NP_755194.1| cell division protein FtsB [Escherichia coli CFT073] gi|91212116|ref|YP_542102.1| cell division protein FtsB [Escherichia coli UTI89] gi|110642890|ref|YP_670620.1| cell division protein FtsB [Escherichia coli 536] gi|117624983|ref|YP_853971.1| cell division protein FtsB [Escherichia coli APEC O1] gi|191171311|ref|ZP_03032861.1| cell division protein FtsB [Escherichia coli F11] gi|215488068|ref|YP_002330499.1| cell division protein FtsB [Escherichia coli O127:H6 str. E2348/69] gi|218559741|ref|YP_002392654.1| cell division protein FtsB [Escherichia coli S88] gi|218690875|ref|YP_002399087.1| cell division protein FtsB [Escherichia coli ED1a] gi|227888291|ref|ZP_04006096.1| septum formation initiator [Escherichia coli 83972] gi|237706623|ref|ZP_04537104.1| cell division protein ftsB [Escherichia sp. 3_2_53FAA] gi|300976238|ref|ZP_07173335.1| cell division protein FtsB [Escherichia coli MS 200-1] gi|300976788|ref|ZP_07173605.1| cell division protein FtsB [Escherichia coli MS 45-1] gi|301049489|ref|ZP_07196447.1| cell division protein FtsB [Escherichia coli MS 185-1] gi|306812370|ref|ZP_07446568.1| cell division protein FtsB [Escherichia coli NC101] gi|312964985|ref|ZP_07779225.1| septum formation initiator family protein [Escherichia coli 2362-75] gi|331648471|ref|ZP_08349559.1| cell division protein FtsB [Escherichia coli M605] gi|331658862|ref|ZP_08359804.1| cell division protein FtsB [Escherichia coli TA206] gi|331684367|ref|ZP_08384959.1| cell division protein FtsB [Escherichia coli H299] gi|62286887|sp|Q8FEJ4|FTSB_ECOL6 RecName: Full=Cell division protein ftsB gi|122422683|sp|Q1R7U3|FTSB_ECOUT RecName: Full=Cell division protein ftsB homolog gi|123147779|sp|Q0TEB0|FTSB_ECOL5 RecName: Full=Cell division protein ftsB homolog gi|166216883|sp|A1AEU2|FTSB_ECOK1 RecName: Full=Cell division protein ftsB homolog gi|226707113|sp|B7MKM2|FTSB_ECO45 RecName: Full=Cell division protein ftsB homolog gi|254790056|sp|B7UHG7|FTSB_ECO27 RecName: Full=Cell division protein ftsB homolog gi|254790058|sp|B7MZ49|FTSB_ECO81 RecName: Full=Cell division protein ftsB homolog gi|26109561|gb|AAN81764.1|AE016765_166 Hypothetical protein ygbQ [Escherichia coli CFT073] gi|91073690|gb|ABE08571.1| hypothetical protein YgbQ [Escherichia coli UTI89] gi|110344482|gb|ABG70719.1| hypothetical protein YgbQ [Escherichia coli 536] gi|115514107|gb|ABJ02182.1| cell divison protein FtsB [Escherichia coli APEC O1] gi|190908611|gb|EDV68200.1| cell division protein FtsB [Escherichia coli F11] gi|215266140|emb|CAS10566.1| cell division protein [Escherichia coli O127:H6 str. E2348/69] gi|218366510|emb|CAR04263.1| cell division protein [Escherichia coli S88] gi|218428439|emb|CAR09366.2| cell division protein [Escherichia coli ED1a] gi|222034445|emb|CAP77187.1| Cell division protein ftsB [Escherichia coli LF82] gi|226899663|gb|EEH85922.1| cell division protein ftsB [Escherichia sp. 3_2_53FAA] gi|227834560|gb|EEJ45026.1| septum formation initiator [Escherichia coli 83972] gi|281179754|dbj|BAI56084.1| conserved hypothetical protein [Escherichia coli SE15] gi|294489969|gb|ADE88725.1| cell division protein FtsB [Escherichia coli IHE3034] gi|300298720|gb|EFJ55105.1| cell division protein FtsB [Escherichia coli MS 185-1] gi|300308583|gb|EFJ63103.1| cell division protein FtsB [Escherichia coli MS 200-1] gi|300409974|gb|EFJ93512.1| cell division protein FtsB [Escherichia coli MS 45-1] gi|305854408|gb|EFM54846.1| cell division protein FtsB [Escherichia coli NC101] gi|307554727|gb|ADN47502.1| cell division protein FtsB [Escherichia coli ABU 83972] gi|307625676|gb|ADN69980.1| cell division protein FtsB [Escherichia coli UM146] gi|312290541|gb|EFR18421.1| septum formation initiator family protein [Escherichia coli 2362-75] gi|312947280|gb|ADR28107.1| cell division protein FtsB [Escherichia coli O83:H1 str. NRG 857C] gi|315289249|gb|EFU48644.1| cell division protein FtsB [Escherichia coli MS 110-3] gi|315293690|gb|EFU53042.1| cell division protein FtsB [Escherichia coli MS 153-1] gi|315298759|gb|EFU58013.1| cell division protein FtsB [Escherichia coli MS 16-3] gi|320194887|gb|EFW69516.1| Cell division protein FtsB [Escherichia coli WV_060327] gi|323188835|gb|EFZ74120.1| septum formation initiator family protein [Escherichia coli RN587/1] gi|323951030|gb|EGB46906.1| septum formation initiator protein [Escherichia coli H252] gi|323957238|gb|EGB52962.1| septum formation initiator protein [Escherichia coli H263] gi|324005714|gb|EGB74933.1| cell division protein FtsB [Escherichia coli MS 57-2] gi|324015512|gb|EGB84731.1| cell division protein FtsB [Escherichia coli MS 60-1] gi|330908782|gb|EGH37296.1| cell division protein FtsB [Escherichia coli AA86] gi|331042218|gb|EGI14360.1| cell division protein FtsB [Escherichia coli M605] gi|331053444|gb|EGI25473.1| cell division protein FtsB [Escherichia coli TA206] gi|331077982|gb|EGI49188.1| cell division protein FtsB [Escherichia coli H299] Length = 103 Score = 34.3 bits (78), Expect = 5.7, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ ++LK +L ++ ++ G ++ L+E+AR L+++ Sbjct: 22 GKNGIHDYTRVNNDVAAQQATNAKLKARNDQLFAEIDDLNGG---QEALEERARNELSMT 78 Query: 94 RSDE 97 R E Sbjct: 79 RPGE 82 >gi|58260440|ref|XP_567630.1| hypothetical protein CNK00670 [Cryptococcus neoformans var. neoformans JEC21] gi|57229711|gb|AAW46113.1| hypothetical protein CNK00670 [Cryptococcus neoformans var. neoformans JEC21] Length = 486 Score = 34.3 bits (78), Expect = 5.8, Method: Composition-based stats. Identities = 10/44 (22%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKL--MSDGSLEKDL 81 A + + + L+ L+ +R+ LE++V + + EKD+ Sbjct: 78 AIRERDATAANLRDELNSLRADRAALEKRVIEWDLRWKNREKDM 121 >gi|309781229|ref|ZP_07675966.1| cell division protein FtsB-like protein [Ralstonia sp. 5_7_47FAA] gi|308920050|gb|EFP65710.1| cell division protein FtsB-like protein [Ralstonia sp. 5_7_47FAA] Length = 111 Score = 34.3 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 18/64 (28%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G ++K + + + +ELK ++LE +VK + +G+ ++E+ARY L + Sbjct: 22 GKGGWLRVWDMQKQVTAQNQRNAELKLRNTKLEGEVKDLKEGT---GAIEERARYELGMV 78 Query: 94 RSDE 97 + DE Sbjct: 79 KDDE 82 >gi|300691890|ref|YP_003752885.1| cell division protein ftsB homolog [Ralstonia solanacearum PSI07] gi|299078950|emb|CBJ51610.1| Cell division protein ftsB homolog [Ralstonia solanacearum PSI07] Length = 111 Score = 34.3 bits (78), Expect = 5.9, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G ++K + + + +ELK+ +LE +V+ + +G+ ++E+ARY L + Sbjct: 22 GRGGWLRVWDMQKQVTSQHQRNAELKQRNLKLEGEVRDLKEGT---GAIEERARYELGMV 78 Query: 94 RSDE 97 + DE Sbjct: 79 KDDE 82 >gi|324514938|gb|ADY46035.1| RNA-binding protein 38 [Ascaris suum] Length = 274 Score = 34.3 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 10/55 (18%), Positives = 22/55 (40%), Gaps = 1/55 (1%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 AI ++ F +A YG+ + L + L+ + + ++ LE + Sbjct: 219 AIHPSVSTAGATGFEQYAYT-PYGVLPTSTYAAQLTAAQSQLAAVTQQQAALEHQ 272 >gi|229442227|gb|AAI72924.1| centromere protein E [synthetic construct] Length = 818 Score = 34.3 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 24/39 (61%) Query: 36 YGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 GL +N LEK + + ++ L++ E + L+ +V L+S+ Sbjct: 710 KGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSE 748 >gi|303257816|ref|ZP_07343826.1| cell division protein FtsB [Burkholderiales bacterium 1_1_47] gi|330998762|ref|ZP_08322490.1| putative cell division protein FtsL [Parasutterella excrementihominis YIT 11859] gi|302859419|gb|EFL82500.1| cell division protein FtsB [Burkholderiales bacterium 1_1_47] gi|329576259|gb|EGG57775.1| putative cell division protein FtsL [Parasutterella excrementihominis YIT 11859] Length = 101 Score = 34.3 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 22/92 (23%), Positives = 39/92 (42%), Gaps = 4/92 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 R + LV+A V VG L+ L ++ + L+ +RLE + + Sbjct: 14 RFLVLVLAIAVVG-IQYPLWVGKGSNATLLDLQDQLKTQKEKNAALELEITRLEGEADSL 72 Query: 73 SDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 GS + L+ +AR LN+ R +E ++ Sbjct: 73 RHGS---EALESRAREKLNMIRENEYLIRIMP 101 >gi|71412953|ref|XP_808637.1| hypothetical protein [Trypanosoma cruzi strain CL Brener] gi|70872884|gb|EAN86786.1| hypothetical protein, conserved [Trypanosoma cruzi] Length = 383 Score = 34.3 bits (78), Expect = 6.0, Method: Composition-based stats. Identities = 11/47 (23%), Positives = 23/47 (48%) Query: 54 FLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 +++LK+ + LER++ + +LL+E R +L E + Sbjct: 323 EIAQLKQEVASLERRIATYGVDRADHELLEESYRATLGRVAELEATM 369 >gi|294812139|ref|ZP_06770782.1| Septum formation initiator [Streptomyces clavuligerus ATCC 27064] gi|326440705|ref|ZP_08215439.1| hypothetical protein SclaA2_06543 [Streptomyces clavuligerus ATCC 27064] gi|294324738|gb|EFG06381.1| Septum formation initiator [Streptomyces clavuligerus ATCC 27064] Length = 212 Score = 34.3 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 15/58 (25%), Positives = 22/58 (37%), Gaps = 5/58 (8%) Query: 47 SLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 L E R + L + + L+R V D L D L+ +AR L + D Sbjct: 59 ELSELRRETTALTDEQQALQRDV----DSFLAPDALERRAR-ELGMVPGGNPAFLAPD 111 >gi|114046693|ref|YP_737243.1| cell division protein FtsB [Shewanella sp. MR-7] gi|117919566|ref|YP_868758.1| cell division protein FtsB [Shewanella sp. ANA-3] gi|123030801|sp|Q0HXG9|FTSB_SHESR RecName: Full=Cell division protein ftsB homolog gi|166216894|sp|A0KU83|FTSB_SHESA RecName: Full=Cell division protein ftsB homolog gi|113888135|gb|ABI42186.1| cell division protein FtsB [Shewanella sp. MR-7] gi|117611898|gb|ABK47352.1| cell division protein FtsB [Shewanella sp. ANA-3] Length = 99 Score = 34.3 bits (78), Expect = 6.1, Method: Composition-based stats. Identities = 17/83 (20%), Positives = 37/83 (44%), Gaps = 6/83 (7%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I L++ + Y GD L L+K + ++ ++L E L+ ++ + Sbjct: 6 IALIVLLGLLQYRLW---SGDNSLPEYFVLQKQIAAQQEGNAKLNERNQVLKEEIIDLKS 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G+ + ++E+AR L + + E Sbjct: 63 GT---EAIEERARNELGMVKEGE 82 >gi|309390181|gb|ADO78061.1| uncharacterized protein with myosin-like domain [Halanaerobium praevalens DSM 2228] Length = 427 Score = 34.3 bits (78), Expect = 6.2, Method: Composition-based stats. Identities = 12/42 (28%), Positives = 27/42 (64%), Gaps = 3/42 (7%) Query: 45 EKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKA 86 ++ L+ E+ L+EL +NR +LE++++ +S + L+E+ Sbjct: 147 DQELLAVEKELAELTKNRDQLEQRIENLSSQRQD---LEEQV 185 >gi|221134013|ref|ZP_03560318.1| septum formation initiator [Glaciecola sp. HTCC2999] Length = 98 Score = 34.3 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 16/83 (19%), Positives = 33/83 (39%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I LVI + G + +L+ + +R++ + L + L + + Sbjct: 7 IILVILVSLLCALQYRLWFGKRSIPEYLALQAEVEQRQQQNANLTQRNKLLAADINDLK- 65 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 + D ++E+AR L L + E Sbjct: 66 --IGLDAIEERARNELGLIKEGE 86 >gi|24374949|ref|NP_718992.1| hypothetical protein SO_3439 [Shewanella oneidensis MR-1] gi|62286884|sp|Q8EBR1|FTSB_SHEON RecName: Full=Cell division protein ftsB homolog gi|24349667|gb|AAN56436.1|AE015780_7 conserved hypothetical protein [Shewanella oneidensis MR-1] Length = 99 Score = 34.3 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 17/83 (20%), Positives = 37/83 (44%), Gaps = 6/83 (7%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I L++ + Y GD L L+K + ++ ++L E L+ ++ + Sbjct: 6 ITLIVLLGLLQYRLW---SGDNSLPEYFVLQKQIAAQQDGNAKLNERNQVLKEEIIDLKS 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G+ + ++E+AR L + + E Sbjct: 63 GT---EAIEERARNELGMVKEGE 82 >gi|257454623|ref|ZP_05619879.1| septum formation initiator [Enhydrobacter aerosaccus SK60] gi|257447933|gb|EEV22920.1| septum formation initiator [Enhydrobacter aerosaccus SK60] Length = 116 Score = 34.3 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 26/95 (27%), Positives = 40/95 (42%), Gaps = 6/95 (6%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 F IF VI C+ Y G L A L K + E++ ++ ++ L Sbjct: 5 RQLFMIIFAVIVLVCLQYQYWFGTNGRGDLAA---LNKQISEQQSINTDQQKANEVLLAD 61 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 VK + +G LE ++E AR L L + E + S Sbjct: 62 VKDLKNG-LEA--VEEHARSDLGLIKQGETFVQMS 93 >gi|82702358|ref|YP_411924.1| septum formation initiator [Nitrosospira multiformis ATCC 25196] gi|82410423|gb|ABB74532.1| cell division protein FtsB [Nitrosospira multiformis ATCC 25196] Length = 102 Score = 34.3 bits (78), Expect = 6.3, Method: Composition-based stats. Identities = 14/56 (25%), Positives = 28/56 (50%), Gaps = 3/56 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 +++ L + +LK S L+ +V+ + G D ++E+AR L + + EI Sbjct: 40 EVDQQLATQYETNEKLKTRNSALDAEVRDLKQGY---DAVEERARNELGMIKEGEI 92 >gi|260893895|ref|YP_003239992.1| Septum formation initiator [Ammonifex degensii KC4] gi|260866036|gb|ACX53142.1| Septum formation initiator [Ammonifex degensii KC4] Length = 110 Score = 34.3 bits (78), Expect = 6.4, Method: Composition-based stats. Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 4/61 (6%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYS 103 +E+SL E+ L+ LKE + L K+KL+ S L++ AR L + ++ E + Sbjct: 45 MEQSLARAEQELNTLKERNNELWEKIKLLQSDSY----LEQLARQRLGMIKAGETPVVVE 100 Query: 104 D 104 Sbjct: 101 P 101 >gi|156975780|ref|YP_001446687.1| cell division protein FtsB [Vibrio harveyi ATCC BAA-1116] gi|166216896|sp|A7MTT1|FTSB_VIBHB RecName: Full=Cell division protein ftsB homolog gi|156527374|gb|ABU72460.1| hypothetical protein VIBHAR_03524 [Vibrio harveyi ATCC BAA-1116] Length = 93 Score = 34.3 bits (78), Expect = 6.4, Method: Composition-based stats. Identities = 15/83 (18%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF++ + G G+ ++E + +++ S+L+ + + ++ + Sbjct: 3 IFVIALTLLFGWLQYTLWFGKNGVSDYYTVEDEIEVQQQVNSKLQARNNEMFAEIDDLRQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR+ L L + E Sbjct: 63 G---LDAIEERARHELGLVKDGE 82 >gi|154507719|ref|ZP_02043361.1| hypothetical protein ACTODO_00201 [Actinomyces odontolyticus ATCC 17982] gi|153797353|gb|EDN79773.1| hypothetical protein ACTODO_00201 [Actinomyces odontolyticus ATCC 17982] Length = 253 Score = 34.3 bits (78), Expect = 6.4, Method: Composition-based stats. Identities = 12/60 (20%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 L E+ L + + ++E ++ + ++R++ L + + D + +AR L R E Sbjct: 128 LYQWWQQERELAQIKTQVAEQQQMNADMQRQLDLWN----DPDYISTQARERLGFVRPGE 183 >gi|284009095|emb|CBA76080.1| cell division protein FtsB [Arsenophonus nasoniae] Length = 102 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 14/82 (17%), Positives = 32/82 (39%), Gaps = 3/82 (3%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDG 75 +I + + G G+ ++ + E K RL ++ +++G Sbjct: 9 LALILLAVLCWLQYSLWFGKNGVHDYLRVKNEVAALETLNMTFKVRNERLFAEIDDLNEG 68 Query: 76 SLEKDLLDEKARYSLNLSRSDE 97 ++ ++E+AR L + R E Sbjct: 69 ---REAIEERARTELGMIRPGE 87 >gi|113969460|ref|YP_733253.1| cell division protein FtsB [Shewanella sp. MR-4] gi|122944023|sp|Q0HL71|FTSB_SHESM RecName: Full=Cell division protein ftsB homolog gi|113884144|gb|ABI38196.1| cell division protein FtsB [Shewanella sp. MR-4] Length = 99 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 17/83 (20%), Positives = 37/83 (44%), Gaps = 6/83 (7%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I L++ + Y GD L L+K + ++ ++L E L+ ++ + Sbjct: 6 IALIVLLGLLQYRLW---SGDNSLPEYFVLQKQIAAQQDGNAKLNERNQVLKEEIIDLKS 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G+ + ++E+AR L + + E Sbjct: 63 GT---EAIEERARNELGMVKEGE 82 >gi|58582585|ref|YP_201601.1| cell division protein FtsB [Xanthomonas oryzae pv. oryzae KACC10331] gi|84624470|ref|YP_451842.1| cell division protein FtsB [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|188575900|ref|YP_001912829.1| cell division protein FtsB [Xanthomonas oryzae pv. oryzae PXO99A] gi|75434878|sp|Q5GYK5|FTSB_XANOR RecName: Full=Cell division protein ftsB homolog gi|123521576|sp|Q2P1K9|FTSB_XANOM RecName: Full=Cell division protein ftsB homolog gi|226707165|sp|B2SUA7|FTSB_XANOP RecName: Full=Cell division protein ftsB homolog gi|58427179|gb|AAW76216.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae KACC10331] gi|84368410|dbj|BAE69568.1| conserved hypothetical protein [Xanthomonas oryzae pv. oryzae MAFF 311018] gi|188520352|gb|ACD58297.1| septum formation initiator protein FtsB [Xanthomonas oryzae pv. oryzae PXO99A] Length = 121 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 13/54 (24%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE + + + L++ L +VK + DG ++E+AR L + + E Sbjct: 35 LEAQVAHQTQDNEGLRQRNQALAAEVKDLKDGEA---AIEERARSELGMIKPGE 85 >gi|121998001|ref|YP_001002788.1| Fis family transcriptional regulator [Halorhodospira halophila SL1] gi|121589406|gb|ABM61986.1| transcriptional regulator, Fis family [Halorhodospira halophila SL1] Length = 382 Score = 34.0 bits (77), Expect = 6.7, Method: Composition-based stats. Identities = 10/39 (25%), Positives = 17/39 (43%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE 78 A LE+ + E R L L+ R+ +V + + E Sbjct: 62 ALSQLERQVSEATRELERLRAERAEARGRVAELREDYAE 100 >gi|68536568|ref|YP_251273.1| hypothetical protein jk1482 [Corynebacterium jeikeium K411] gi|68264167|emb|CAI37655.1| hypothetical protein jk1482 [Corynebacterium jeikeium K411] Length = 236 Score = 34.0 bits (77), Expect = 6.8, Method: Composition-based stats. Identities = 11/55 (20%), Positives = 25/55 (45%), Gaps = 3/55 (5%) Query: 46 KSLIERERFLSELKENRSRLERKVKLMSDG---SLEKDLLDEKARYSLNLSRSDE 97 ++ E+ L++L + E++ ++ ++D + E+AR L L E Sbjct: 96 RNYFEQRAELAQLNQEIEAQEKEKAELTSELNRYRDEDYIKEQARTRLGLIEPGE 150 >gi|226939477|ref|YP_002794550.1| septum formation initiator [Laribacter hongkongensis HLHK9] gi|226714403|gb|ACO73541.1| septum formation initiator [Laribacter hongkongensis HLHK9] Length = 93 Score = 34.0 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 17/84 (20%), Positives = 29/84 (34%), Gaps = 3/84 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 I V+ + G + LE L E+ +L L V+ + Sbjct: 3 IVPVVLLTGIALLQWPLWFGKGSWVRSLQLESQLTEQRALNEKLLSRNMVLAADVQDLKT 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDEI 98 G ++E+AR L + R E+ Sbjct: 63 GHA---AVEERARNELGMVRQGEV 83 >gi|317051701|ref|YP_004112817.1| Septum formation initiator [Desulfurispirillum indicum S5] gi|316946785|gb|ADU66261.1| Septum formation initiator [Desulfurispirillum indicum S5] Length = 100 Score = 34.0 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 21/93 (22%), Positives = 37/93 (39%), Gaps = 7/93 (7%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 KN F L A + F D G + + K+ E + L +L S +E Sbjct: 3 KNLFVPVTLLCFAIGFFLSFLF----SDMGFLRYQEIVKNKTELDTRLRDLAYEISLVED 58 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 ++ ++D +K+ L AR L + E ++ Sbjct: 59 QISRLTD---DKEHLIRLARRELGMMMPGERVI 88 >gi|83748259|ref|ZP_00945285.1| FtsB [Ralstonia solanacearum UW551] gi|207743530|ref|YP_002259922.1| cell division protein ftsb homolog [Ralstonia solanacearum IPO1609] gi|300704500|ref|YP_003746103.1| cell division protein FtsB-like protein [Ralstonia solanacearum CFBP2957] gi|83725100|gb|EAP72252.1| FtsB [Ralstonia solanacearum UW551] gi|206594928|emb|CAQ61855.1| cell division protein ftsb homolog [Ralstonia solanacearum IPO1609] gi|299072164|emb|CBJ43496.1| Cell division protein ftsB homolog [Ralstonia solanacearum CFBP2957] Length = 111 Score = 34.0 bits (77), Expect = 6.9, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G ++K + + + +E K+ +LE +VK + +G+ ++E+ARY L + Sbjct: 22 GKGGWLRVWDMQKQVASQNQRNAEFKQRNVKLEGEVKDLKEGT---GAIEERARYELGMV 78 Query: 94 RSDE 97 + DE Sbjct: 79 KDDE 82 >gi|156742167|ref|YP_001432296.1| hypothetical protein Rcas_2195 [Roseiflexus castenholzii DSM 13941] gi|156233495|gb|ABU58278.1| protein of unknown function DUF820 [Roseiflexus castenholzii DSM 13941] Length = 230 Score = 34.0 bits (77), Expect = 7.0, Method: Composition-based stats. Identities = 8/40 (20%), Positives = 13/40 (32%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 LE+ E + R R ER + ++ D Sbjct: 188 QDQLERERQRAEAEQQRAEAERQRAERLAARLRALGIDPD 227 >gi|212634206|ref|YP_002310731.1| Septum formation initiator [Shewanella piezotolerans WP3] gi|212555690|gb|ACJ28144.1| Septum formation initiator [Shewanella piezotolerans WP3] Length = 114 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 16/89 (17%), Positives = 38/89 (42%), Gaps = 5/89 (5%) Query: 9 NHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERK 68 + R +F +I + +GD L + L++ + ++ ++L L + Sbjct: 15 SIMKRLLFALIV--LLAMLQYRLWLGDKSLADSIHLQEQIKLQQESNAQLVARNQVLREE 72 Query: 69 VKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 + + G+ + L+E+AR L + + E Sbjct: 73 INDLRSGT---EALEERARNELGMVKEGE 98 >gi|153835660|ref|ZP_01988327.1| cell division protein FtsB [Vibrio harveyi HY01] gi|148867717|gb|EDL66980.1| cell division protein FtsB [Vibrio harveyi HY01] Length = 93 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 15/83 (18%), Positives = 38/83 (45%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 IF++ + +G G+ ++E + +++ S+L+ + + ++ + Sbjct: 3 IFVIALTLLFGWLQYTLWLGKNGVSDYYTVEDEIEVQQQVNSKLQARNNEMFAEIDDLRQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR+ L L + E Sbjct: 63 G---LDAIEERARHELGLVKDGE 82 >gi|37523582|ref|NP_926959.1| hypothetical protein gll4013 [Gloeobacter violaceus PCC 7421] gi|35214587|dbj|BAC91954.1| gll4013 [Gloeobacter violaceus PCC 7421] Length = 265 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 9/44 (20%), Positives = 20/44 (45%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 +A + E+ RE+ + + R ER + + + ++ D L Sbjct: 222 QAVQMAEQERQAREQAVQMAERERQSRERLARYLREQGIDPDTL 265 >gi|238898786|ref|YP_002924468.1| cell division protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] gi|229466546|gb|ACQ68320.1| cell division protein [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pisum)] Length = 104 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G++ ++K + E++ +ELK ++L ++ + G K+ L+E+AR L + Sbjct: 22 GKNGIRDFVRIKKDVAEQKIKNNELKMRNAQLFAEINDLDGG---KEALEERARNDLGMI 78 Query: 94 RSDE 97 + DE Sbjct: 79 KQDE 82 >gi|154490846|ref|ZP_02030787.1| hypothetical protein PARMER_00763 [Parabacteroides merdae ATCC 43184] gi|154088594|gb|EDN87638.1| hypothetical protein PARMER_00763 [Parabacteroides merdae ATCC 43184] Length = 101 Score = 34.0 bits (77), Expect = 7.1, Method: Composition-based stats. Identities = 15/81 (18%), Positives = 37/81 (45%), Gaps = 3/81 (3%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 +V+F ++GD L + ++ + E+ +K + +E K ++D +K+ L+ Sbjct: 23 IVFFALTFVMGDSSLYKRYTYDEKIRSLEKE---IKHYQKEIEINSKKLNDLHTDKEGLE 79 Query: 84 EKARYSLNLSRSDEIILFYSD 104 AR + + +E + + Sbjct: 80 RFAREEYFMKKPNEDVYIIKN 100 >gi|149026004|gb|EDL82247.1| rCG28678 [Rattus norvegicus] Length = 1915 Score = 34.0 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 12/39 (30%), Positives = 25/39 (64%) Query: 36 YGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 GL +N LEK + + ++ L++ E + L+++V L+S+ Sbjct: 155 KGLLSNLELEKRITDLQKELNKEVEEKETLQKEVHLLSE 193 >gi|59712681|ref|YP_205457.1| cell division protein [Vibrio fischeri ES114] gi|197335237|ref|YP_002156874.1| cell division protein FtsB [Vibrio fischeri MJ11] gi|75353472|sp|Q5E327|FTSB_VIBF1 RecName: Full=Cell division protein ftsB homolog gi|226707163|sp|B5FAF8|FTSB_VIBFM RecName: Full=Cell division protein ftsB homolog gi|59480782|gb|AAW86569.1| cell division protein [Vibrio fischeri ES114] gi|197316727|gb|ACH66174.1| cell division protein FtsB [Vibrio fischeri MJ11] Length = 94 Score = 34.0 bits (77), Expect = 7.2, Method: Composition-based stats. Identities = 18/84 (21%), Positives = 37/84 (44%), Gaps = 6/84 (7%) Query: 14 AIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 AIFL+IA + Y G G+ + + +E L+ ++ ++ + Sbjct: 5 AIFLLIALGWLQYTLW---FGKNGMSDYAQVSNDVALQEEVNQGLRNRNEQMFAEIDDLK 61 Query: 74 DGSLEKDLLDEKARYSLNLSRSDE 97 GS + ++E+AR+ L + + E Sbjct: 62 KGS---EAIEERARHELGMIKKGE 82 >gi|153005102|ref|YP_001379427.1| septum formation initiator [Anaeromyxobacter sp. Fw109-5] gi|152028675|gb|ABS26443.1| Septum formation initiator [Anaeromyxobacter sp. Fw109-5] Length = 101 Score = 34.0 bits (77), Expect = 7.5, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 28/68 (41%), Gaps = 3/68 (4%) Query: 37 GLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD 96 GL+ L + E+ + L +RL R+V+ + + L+ AR L R Sbjct: 31 GLRRYLRLAEDTRRMEQENARLAAENARLSREVRALRT---DPSALERAAREELRFVRPG 87 Query: 97 EIILFYSD 104 E + + D Sbjct: 88 ERVYWVGD 95 >gi|126175327|ref|YP_001051476.1| septum formation initiator [Shewanella baltica OS155] gi|153001648|ref|YP_001367329.1| septum formation initiator [Shewanella baltica OS185] gi|160876384|ref|YP_001555700.1| septum formation initiator [Shewanella baltica OS195] gi|217972420|ref|YP_002357171.1| Septum formation initiator [Shewanella baltica OS223] gi|304410166|ref|ZP_07391785.1| Septum formation initiator [Shewanella baltica OS183] gi|307302123|ref|ZP_07581881.1| Septum formation initiator [Shewanella baltica BA175] gi|125998532|gb|ABN62607.1| cell division protein FtsB [Shewanella baltica OS155] gi|151366266|gb|ABS09266.1| Septum formation initiator [Shewanella baltica OS185] gi|160861906|gb|ABX50440.1| Septum formation initiator [Shewanella baltica OS195] gi|217497555|gb|ACK45748.1| Septum formation initiator [Shewanella baltica OS223] gi|304351575|gb|EFM15974.1| Septum formation initiator [Shewanella baltica OS183] gi|306914161|gb|EFN44582.1| Septum formation initiator [Shewanella baltica BA175] gi|315268574|gb|ADT95427.1| Septum formation initiator [Shewanella baltica OS678] Length = 118 Score = 34.0 bits (77), Expect = 7.6, Method: Composition-based stats. Identities = 18/83 (21%), Positives = 36/83 (43%), Gaps = 4/83 (4%) Query: 16 FLVIA-FCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 F VIA + GD L L+K + ++ ++L E L+ ++ + Sbjct: 22 FFVIALIVLLGLLQFRLWSGDNSLPEYFVLQKQIAAQQEGNAKLNERNQVLKEEIIDLKS 81 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G+ + ++E+AR L + + E Sbjct: 82 GT---EAIEERARNELGMVKEGE 101 >gi|126667572|ref|ZP_01738542.1| Septum formation initiator [Marinobacter sp. ELB17] gi|126627998|gb|EAZ98625.1| Septum formation initiator [Marinobacter sp. ELB17] Length = 102 Score = 34.0 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 17/62 (27%), Positives = 33/62 (53%), Gaps = 3/62 (4%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFY 102 +LE+++ E+++ L RL +V+ + + E+ ++E+AR L L R+DE Sbjct: 43 ALEQAIAEQQQGNDTLATRNERLYAEVRNLRN---EQGAVEERARIDLGLIRNDETFFLV 99 Query: 103 SD 104 D Sbjct: 100 VD 101 >gi|94266653|ref|ZP_01290330.1| Septum formation initiator [delta proteobacterium MLMS-1] gi|93452700|gb|EAT03251.1| Septum formation initiator [delta proteobacterium MLMS-1] Length = 97 Score = 34.0 bits (77), Expect = 7.7, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 37 GLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD 96 G L + + E + S L E +L+ +++ + + D ++E AR + R + Sbjct: 34 GFWQYTKLSRQISELQNENSHLVEENRQLQEEIEKLQN---NPDYIEELARREYDFLREN 90 Query: 97 EIIL 100 E++ Sbjct: 91 ELLF 94 >gi|296415346|ref|XP_002837351.1| hypothetical protein [Tuber melanosporum Mel28] gi|295633215|emb|CAZ81542.1| unnamed protein product [Tuber melanosporum] Length = 798 Score = 34.0 bits (77), Expect = 7.8, Method: Composition-based stats. Identities = 12/54 (22%), Positives = 23/54 (42%), Gaps = 3/54 (5%) Query: 46 KSLIERERFLSELKENRSRLERKVKLMSD--GSLEKDLLDEKARYSLNLSRSDE 97 + E + R +LE V + +LE +L DE+ R+ L + ++ Sbjct: 702 ADFENLTKQAIEFENERMKLETLVDGLRTKCENLETNLADERVRW-LGVRAPND 754 >gi|254514881|ref|ZP_05126942.1| septum formation initiator family protein [gamma proteobacterium NOR5-3] gi|219677124|gb|EED33489.1| septum formation initiator family protein [gamma proteobacterium NOR5-3] Length = 102 Score = 34.0 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 18/65 (27%), Positives = 33/65 (50%), Gaps = 3/65 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G+ G L + + +R + L+E L R+V + G+ +L+++AR L L+ Sbjct: 22 GEGGRLELLQLRQQTQDAQRENAILRERNEDLSRQVMDLKAGNT---VLEQRAREELGLT 78 Query: 94 RSDEI 98 R DE+ Sbjct: 79 RDDEV 83 >gi|146312860|ref|YP_001177934.1| cell division protein FtsB [Enterobacter sp. 638] gi|166988428|sp|A4WDV3|FTSB_ENT38 RecName: Full=Cell division protein ftsB homolog gi|145319736|gb|ABP61883.1| cell division protein FtsB [Enterobacter sp. 638] Length = 103 Score = 34.0 bits (77), Expect = 7.9, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 33/64 (51%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G GL + + ++ ++LK +L ++ ++ G ++ ++E+AR L+++ Sbjct: 22 GKNGLHDYGRVNDDVTAQQATNAKLKARNDQLFAEIDDLNGG---QEAIEERARNELSMT 78 Query: 94 RSDE 97 + DE Sbjct: 79 KPDE 82 >gi|320640392|gb|EFX09931.1| cell division protein FtsB [Escherichia coli O157:H7 str. G5101] Length = 103 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ ++LK +L ++ ++ G ++ L+E+AR L+++ Sbjct: 22 GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG---QEALEERARNELSMT 78 Query: 94 RSDE 97 R E Sbjct: 79 RPSE 82 >gi|294506871|ref|YP_003570929.1| Conserved hypothetical protein, secreted [Salinibacter ruber M8] gi|294343199|emb|CBH23977.1| Conserved hypothetical protein, secreted [Salinibacter ruber M8] Length = 143 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 8/62 (12%), Positives = 22/62 (35%), Gaps = 4/62 (6%) Query: 14 AIFLVIAFCCVVY---FTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 ++ Y + G + + +E + + L+ L+ R L+ +V+ Sbjct: 27 FAIPILGIALAGYKEWLKFKTKHRELG-SSTREVEDRIDGLQDRLARLEAERDALQERVQ 85 Query: 71 LM 72 + Sbjct: 86 NL 87 >gi|289548347|ref|YP_003473335.1| septum formation initiator [Thermocrinis albus DSM 14484] gi|289181964|gb|ADC89208.1| Septum formation initiator [Thermocrinis albus DSM 14484] Length = 92 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 22/92 (23%), Positives = 36/92 (39%), Gaps = 4/92 (4%) Query: 13 RAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLM 72 + + + +V G Y L+ LEK+ E +L E S+LE ++ M Sbjct: 3 KGVCYLFLSALIVLTLYGLFFGPYNLQQLSRLEKARTALEEKRKKLAEENSQLENQLSSM 62 Query: 73 SDGSLEKDLLDEK-ARYSLNLSRSDEIILFYS 103 D E+ R +L + R DE I+ Sbjct: 63 RR---NPDFYIERFLRETLGMQRKDETIVILE 91 >gi|88798279|ref|ZP_01113865.1| cell division protein FtsB [Reinekea sp. MED297] gi|88779055|gb|EAR10244.1| cell division protein FtsB [Reinekea sp. MED297] Length = 90 Score = 34.0 bits (77), Expect = 8.0, Method: Composition-based stats. Identities = 16/70 (22%), Positives = 34/70 (48%), Gaps = 3/70 (4%) Query: 35 DYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSR 94 + G ++ L S+ E + L+ + + L+ +V + G+ D ++E AR +L L + Sbjct: 23 ENGYLDHRRLLDSVAEEQSRLAAQQRINANLQARVDDLKSGN---DAIEELARQNLGLIK 79 Query: 95 SDEIILFYSD 104 E + +D Sbjct: 80 PGETFVLIAD 89 >gi|310766645|gb|ADP11595.1| cell division protein FtsB [Erwinia sp. Ejp617] Length = 109 Score = 34.0 bits (77), Expect = 8.1, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ + LK RL ++ ++ GS + ++E+AR L + Sbjct: 22 GKNGIHDYTRVNDDVAAQQGANARLKARNDRLFAEIDDLNGGS---EAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|187477665|ref|YP_785689.1| cell division protein FtsB [Bordetella avium 197N] gi|115422251|emb|CAJ48775.1| cell division protein [Bordetella avium 197N] Length = 122 Score = 33.6 bits (76), Expect = 8.4, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 28/67 (41%), Gaps = 3/67 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G K + + L+ + LE +V+ + G+ L+E+AR L + Sbjct: 22 GKGGWLKVWDYRKEVAAQREVNEGLRARNNALEAEVRDLESGT---GALEERARGDLGMM 78 Query: 94 RSDEIIL 100 R E+ + Sbjct: 79 REGEVFV 85 >gi|320163632|gb|EFW40531.1| BRCA1 associated protein [Capsaspora owczarzaki ATCC 30864] Length = 900 Score = 33.6 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 18/71 (25%), Positives = 26/71 (36%), Gaps = 10/71 (14%) Query: 30 HAIVGDYGLKANKS-LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 HAI + L L+ S E E L+ + R LE+K + S +R Sbjct: 748 HAIERERQLIVRMEALQSSTSEMEHKLAASERERKALEKKTLQAREKS---------SRL 798 Query: 89 SLNLSRSDEII 99 L+ EI Sbjct: 799 QLDFDNEKEIT 809 >gi|332533605|ref|ZP_08409467.1| putative peptidase M13 family protein [Pseudoalteromonas haloplanktis ANT/505] gi|332037007|gb|EGI73466.1| putative peptidase M13 family protein [Pseudoalteromonas haloplanktis ANT/505] Length = 692 Score = 33.6 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 25/51 (49%) Query: 26 YFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGS 76 Y T HAI G+ GL + + + + L+ +E R R +R + MS S Sbjct: 321 YLTYHAISGNAGLLSEEVFNTNFAFFGKELNGQQEPRPRWKRAISEMSGTS 371 >gi|289578003|ref|YP_003476630.1| peptidase M23 [Thermoanaerobacter italicus Ab9] gi|289527716|gb|ADD02068.1| Peptidase M23 [Thermoanaerobacter italicus Ab9] Length = 301 Score = 33.6 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 17/92 (18%), Positives = 36/92 (39%), Gaps = 9/92 (9%) Query: 7 KKNHFFRAIFLVIAFCCVVYF---TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRS 63 K ++ A +VYF T + EK + + + E + + Sbjct: 32 KTAVIVAFSIIMAATAFLVYFSKTTFYLYS------VIAEKEKKIEQLTSLIEEQDKKIA 85 Query: 64 RLERKVKLMSDGSLEKDLLDEKARYSLNLSRS 95 L++ +L+++ + + L+EK R + LS Sbjct: 86 TLDKNAQLVNEKIKDLNELEEKIRRMVGLSTP 117 >gi|159479330|ref|XP_001697746.1| hypothetical protein CHLREDRAFT_192775 [Chlamydomonas reinhardtii] gi|158274114|gb|EDO99898.1| predicted protein [Chlamydomonas reinhardtii] Length = 4143 Score = 33.6 bits (76), Expect = 8.5, Method: Composition-based stats. Identities = 14/47 (29%), Positives = 25/47 (53%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKA 86 A SL++ + E E L LK R+ L+ +V+ ++ + L E+A Sbjct: 1118 AKASLQQRVTELEAQLEGLKTERASLQGRVEELTTAADATAALQEQA 1164 >gi|330504223|ref|YP_004381092.1| cell division protein FtsB [Pseudomonas mendocina NK-01] gi|328918509|gb|AEB59340.1| cell division protein FtsB [Pseudomonas mendocina NK-01] Length = 92 Score = 33.6 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 20/97 (20%), Positives = 44/97 (45%), Gaps = 6/97 (6%) Query: 8 KNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLER 67 ++ ++ I L++ F + Y VG+ L L++ + E++ L E LE Sbjct: 2 RSPYWLFIVLILLFAGLQYRLW---VGEGSLAQVSRLQQQIAEQQGENERLLERNRILEA 58 Query: 68 KVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 +V + G + ++E+AR L + + E + ++ Sbjct: 59 EVMELKRGM---ETVEERARQELGMLKEGETLYLLTE 92 >gi|323978644|gb|EGB73726.1| septum formation initiator protein [Escherichia coli TW10509] Length = 103 Score = 33.6 bits (76), Expect = 8.6, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ ++LK +L ++ ++ G ++ L+E+AR L+++ Sbjct: 22 GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG---QEALEERARNELSMT 78 Query: 94 RSDE 97 R E Sbjct: 79 RPGE 82 >gi|320173402|gb|EFW48601.1| Cell division protein FtsB [Shigella dysenteriae CDC 74-1112] Length = 103 Score = 33.6 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ ++LK +L ++ ++ G ++ L+E+AR L+++ Sbjct: 22 GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG---QEALEERARNELSMT 78 Query: 94 RSDE 97 R E Sbjct: 79 RPGE 82 >gi|313902516|ref|ZP_07835917.1| Septum formation initiator [Thermaerobacter subterraneus DSM 13965] gi|313467202|gb|EFR62715.1| Septum formation initiator [Thermaerobacter subterraneus DSM 13965] Length = 236 Score = 33.6 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 12/58 (20%), Positives = 25/58 (43%), Gaps = 4/58 (6%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 + L +R + L++ + LE + + + +DE AR L L + E ++ Sbjct: 173 QARQELRALDRQVQVLQDRAAELEAARRRIQ----DPAYVDETARERLGLVQPGETVI 226 >gi|294867766|ref|XP_002765226.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] gi|239865221|gb|EEQ97943.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983] Length = 854 Score = 33.6 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 16/68 (23%), Positives = 37/68 (54%), Gaps = 4/68 (5%) Query: 30 HAIVGDYGLKANKS-LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 +A+ YG + ++ + + E+ L + + +R+ +E +++++ G + +D L E AR Sbjct: 323 NALEQKYGTEVTQAGFLLAAQQEEKRLEDREMDRAVMELRLRMLQTGIINEDYLKE-ARE 381 Query: 89 SLNLSRSD 96 +LN D Sbjct: 382 TLN--NPD 387 >gi|15803265|ref|NP_289297.1| cell division protein FtsB [Escherichia coli O157:H7 EDL933] gi|15832856|ref|NP_311629.1| cell division protein FtsB [Escherichia coli O157:H7 str. Sakai] gi|16130655|ref|NP_417228.1| cell division protein [Escherichia coli str. K-12 substr. MG1655] gi|74313314|ref|YP_311733.1| cell division protein FtsB [Shigella sonnei Ss046] gi|82545179|ref|YP_409126.1| cell division protein FtsB [Shigella boydii Sb227] gi|82778115|ref|YP_404464.1| cell division protein FtsB [Shigella dysenteriae Sd197] gi|89109535|ref|AP_003315.1| cell division protein [Escherichia coli str. K-12 substr. W3110] gi|157156928|ref|YP_001464071.1| cell division protein FtsB [Escherichia coli E24377A] gi|157162196|ref|YP_001459514.1| cell division protein FtsB [Escherichia coli HS] gi|168749925|ref|ZP_02774947.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4113] gi|168755495|ref|ZP_02780502.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4401] gi|168762850|ref|ZP_02787857.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4501] gi|168768842|ref|ZP_02793849.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4486] gi|168774717|ref|ZP_02799724.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4196] gi|168778733|ref|ZP_02803740.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4076] gi|168788004|ref|ZP_02813011.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC869] gi|168800171|ref|ZP_02825178.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC508] gi|170019006|ref|YP_001723960.1| cell division protein FtsB [Escherichia coli ATCC 8739] gi|170082323|ref|YP_001731643.1| cell division protein [Escherichia coli str. K-12 substr. DH10B] gi|170680593|ref|YP_001744897.1| cell division protein FtsB [Escherichia coli SMS-3-5] gi|188492933|ref|ZP_03000203.1| cell division protein FtsB [Escherichia coli 53638] gi|191166767|ref|ZP_03028593.1| cell division protein FtsB [Escherichia coli B7A] gi|193065062|ref|ZP_03046137.1| cell division protein FtsB [Escherichia coli E22] gi|193069677|ref|ZP_03050629.1| cell division protein FtsB [Escherichia coli E110019] gi|194427888|ref|ZP_03060434.1| cell division protein FtsB [Escherichia coli B171] gi|194431683|ref|ZP_03063974.1| cell division protein FtsB [Shigella dysenteriae 1012] gi|194438993|ref|ZP_03071077.1| cell division protein FtsB [Escherichia coli 101-1] gi|195939461|ref|ZP_03084843.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4024] gi|208807246|ref|ZP_03249583.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4206] gi|208811863|ref|ZP_03253192.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4045] gi|208820638|ref|ZP_03260958.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4042] gi|209396991|ref|YP_002272211.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4115] gi|209920191|ref|YP_002294275.1| cell division protein FtsB [Escherichia coli SE11] gi|217327468|ref|ZP_03443551.1| cell division protein FtsB [Escherichia coli O157:H7 str. TW14588] gi|218555295|ref|YP_002388208.1| cell division protein FtsB [Escherichia coli IAI1] gi|218696346|ref|YP_002404013.1| cell division protein FtsB [Escherichia coli 55989] gi|218701239|ref|YP_002408868.1| cell division protein FtsB [Escherichia coli IAI39] gi|218706242|ref|YP_002413761.1| cell division protein FtsB [Escherichia coli UMN026] gi|238901885|ref|YP_002927681.1| cell division protein [Escherichia coli BW2952] gi|253772396|ref|YP_003035227.1| cell division protein FtsB [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|254037790|ref|ZP_04871848.1| cell division protein FtsB [Escherichia sp. 1_1_43] gi|254162679|ref|YP_003045787.1| cell division protein FtsB [Escherichia coli B str. REL606] gi|254794688|ref|YP_003079525.1| cell division protein FtsB [Escherichia coli O157:H7 str. TW14359] gi|256019467|ref|ZP_05433332.1| cell division protein FtsB [Shigella sp. D9] gi|256024744|ref|ZP_05438609.1| cell division protein FtsB [Escherichia sp. 4_1_40B] gi|260845395|ref|YP_003223173.1| cell division protein FtsB [Escherichia coli O103:H2 str. 12009] gi|260856859|ref|YP_003230750.1| cell division protein FtsB [Escherichia coli O26:H11 str. 11368] gi|260869427|ref|YP_003235829.1| cell division protein FtsB [Escherichia coli O111:H- str. 11128] gi|261226043|ref|ZP_05940324.1| cell division protein [Escherichia coli O157:H7 str. FRIK2000] gi|261256701|ref|ZP_05949234.1| cell division protein FtsB [Escherichia coli O157:H7 str. FRIK966] gi|291284075|ref|YP_003500893.1| Cell division protein ftsB-like protein [Escherichia coli O55:H7 str. CB9615] gi|293406240|ref|ZP_06650166.1| cell division protein FtsB [Escherichia coli FVEC1412] gi|293412103|ref|ZP_06654826.1| cell division protein FtsB [Escherichia coli B354] gi|293415994|ref|ZP_06658634.1| cell division protein FtsB [Escherichia coli B185] gi|293449069|ref|ZP_06663490.1| cell division protein FtsB [Escherichia coli B088] gi|297518372|ref|ZP_06936758.1| cell division protein FtsB [Escherichia coli OP50] gi|298381977|ref|ZP_06991574.1| cell division protein FtsB [Escherichia coli FVEC1302] gi|300815843|ref|ZP_07096067.1| cell division protein FtsB [Escherichia coli MS 107-1] gi|300820529|ref|ZP_07100680.1| cell division protein FtsB [Escherichia coli MS 119-7] gi|300899989|ref|ZP_07118192.1| cell division protein FtsB [Escherichia coli MS 198-1] gi|300906746|ref|ZP_07124428.1| cell division protein FtsB [Escherichia coli MS 84-1] gi|300922271|ref|ZP_07138397.1| cell division protein FtsB [Escherichia coli MS 182-1] gi|300930607|ref|ZP_07145999.1| cell division protein FtsB [Escherichia coli MS 187-1] gi|300941131|ref|ZP_07155643.1| cell division protein FtsB [Escherichia coli MS 21-1] gi|300946973|ref|ZP_07161199.1| cell division protein FtsB [Escherichia coli MS 116-1] gi|300954991|ref|ZP_07167402.1| cell division protein FtsB [Escherichia coli MS 175-1] gi|301027164|ref|ZP_07190533.1| cell division protein FtsB [Escherichia coli MS 69-1] gi|301027329|ref|ZP_07190670.1| cell division protein FtsB [Escherichia coli MS 196-1] gi|301306163|ref|ZP_07212239.1| cell division protein FtsB [Escherichia coli MS 124-1] gi|301326211|ref|ZP_07219594.1| cell division protein FtsB [Escherichia coli MS 78-1] gi|301645269|ref|ZP_07245220.1| cell division protein FtsB [Escherichia coli MS 146-1] gi|307139436|ref|ZP_07498792.1| cell division protein FtsB [Escherichia coli H736] gi|307312824|ref|ZP_07592454.1| Septum formation initiator [Escherichia coli W] gi|309786162|ref|ZP_07680790.1| septum formation initiator family protein [Shigella dysenteriae 1617] gi|309795216|ref|ZP_07689635.1| cell division protein FtsB [Escherichia coli MS 145-7] gi|312973041|ref|ZP_07787214.1| septum formation initiator family protein [Escherichia coli 1827-70] gi|331643434|ref|ZP_08344565.1| cell division protein FtsB [Escherichia coli H736] gi|331654226|ref|ZP_08355226.1| cell division protein FtsB [Escherichia coli M718] gi|331664304|ref|ZP_08365210.1| cell division protein FtsB [Escherichia coli TA143] gi|331669487|ref|ZP_08370333.1| cell division protein FtsB [Escherichia coli TA271] gi|331674254|ref|ZP_08375014.1| cell division protein FtsB [Escherichia coli TA280] gi|331678728|ref|ZP_08379402.1| cell division protein FtsB [Escherichia coli H591] gi|332280589|ref|ZP_08393002.1| cell division protein ftsB [Shigella sp. D9] gi|62288096|sp|P0A6S5|FTSB_ECOLI RecName: Full=Cell division protein ftsB gi|62288097|sp|P0A6S6|FTSB_ECO57 RecName: Full=Cell division protein ftsB gi|123558860|sp|Q31XB0|FTSB_SHIBS RecName: Full=Cell division protein ftsB homolog gi|123561778|sp|Q32CI2|FTSB_SHIDS RecName: Full=Cell division protein ftsB homolog gi|123616334|sp|Q3YYB4|FTSB_SHISS RecName: Full=Cell division protein ftsB homolog gi|166988426|sp|A7ZQJ2|FTSB_ECO24 RecName: Full=Cell division protein ftsB homolog gi|166988427|sp|A8A3M7|FTSB_ECOHS RecName: Full=Cell division protein ftsB homolog gi|189038847|sp|B1IUT1|FTSB_ECOLC RecName: Full=Cell division protein ftsB homolog gi|226707114|sp|B5Z3B0|FTSB_ECO5E RecName: Full=Cell division protein ftsB homolog gi|226707115|sp|B7NT92|FTSB_ECO7I RecName: Full=Cell division protein ftsB homolog gi|226707116|sp|B7LXG0|FTSB_ECO8A RecName: Full=Cell division protein ftsB homolog gi|226707117|sp|B1XCS4|FTSB_ECODH RecName: Full=Cell division protein ftsB homolog gi|226707118|sp|B7N6X8|FTSB_ECOLU RecName: Full=Cell division protein ftsB homolog gi|226707119|sp|B6I6D8|FTSB_ECOSE RecName: Full=Cell division protein ftsB homolog gi|226707120|sp|B1LQ68|FTSB_ECOSM RecName: Full=Cell division protein ftsB homolog gi|254790057|sp|B7LEG6|FTSB_ECO55 RecName: Full=Cell division protein ftsB homolog gi|259647165|sp|C4ZZQ2|FTSB_ECOBW RecName: Full=Cell division protein ftsB homolog gi|12517202|gb|AAG57855.1|AE005502_9 orf, hypothetical protein [Escherichia coli O157:H7 str. EDL933] gi|882641|gb|AAA69258.1| ORF_f103 [Escherichia coli str. K-12 substr. MG1655] gi|1789105|gb|AAC75790.1| cell division protein [Escherichia coli str. K-12 substr. MG1655] gi|13363073|dbj|BAB37025.1| hypothetical protein [Escherichia coli O157:H7 str. Sakai] gi|73671312|gb|AAZ80067.1| YgbQ [Escherichia coli LW1655F+] gi|73856791|gb|AAZ89498.1| conserved hypothetical protein [Shigella sonnei Ss046] gi|81242263|gb|ABB62973.1| conserved hypothetical protein [Shigella dysenteriae Sd197] gi|81246590|gb|ABB67298.1| conserved hypothetical protein [Shigella boydii Sb227] gi|85675569|dbj|BAE76825.1| cell division protein [Escherichia coli str. K12 substr. W3110] gi|157067876|gb|ABV07131.1| cell division protein FtsB [Escherichia coli HS] gi|157078958|gb|ABV18666.1| cell division protein FtsB [Escherichia coli E24377A] gi|169753934|gb|ACA76633.1| Septum formation initiator [Escherichia coli ATCC 8739] gi|169890158|gb|ACB03865.1| cell division protein [Escherichia coli str. K-12 substr. DH10B] gi|170518311|gb|ACB16489.1| cell division protein FtsB [Escherichia coli SMS-3-5] gi|187769568|gb|EDU33412.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4196] gi|188015828|gb|EDU53950.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4113] gi|188488132|gb|EDU63235.1| cell division protein FtsB [Escherichia coli 53638] gi|189003311|gb|EDU72297.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4076] gi|189357310|gb|EDU75729.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4401] gi|189362092|gb|EDU80511.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4486] gi|189366847|gb|EDU85263.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4501] gi|189372186|gb|EDU90602.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC869] gi|189377458|gb|EDU95874.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC508] gi|190903138|gb|EDV62861.1| cell division protein FtsB [Escherichia coli B7A] gi|192927359|gb|EDV81978.1| cell division protein FtsB [Escherichia coli E22] gi|192957040|gb|EDV87491.1| cell division protein FtsB [Escherichia coli E110019] gi|194414121|gb|EDX30397.1| cell division protein FtsB [Escherichia coli B171] gi|194420039|gb|EDX36117.1| cell division protein FtsB [Shigella dysenteriae 1012] gi|194422114|gb|EDX38117.1| cell division protein FtsB [Escherichia coli 101-1] gi|208727047|gb|EDZ76648.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4206] gi|208733140|gb|EDZ81827.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4045] gi|208740761|gb|EDZ88443.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4042] gi|209158391|gb|ACI35824.1| cell division protein FtsB [Escherichia coli O157:H7 str. EC4115] gi|209761698|gb|ACI79161.1| hypothetical protein ECs3602 [Escherichia coli] gi|209761700|gb|ACI79162.1| hypothetical protein ECs3602 [Escherichia coli] gi|209761702|gb|ACI79163.1| hypothetical protein ECs3602 [Escherichia coli] gi|209761704|gb|ACI79164.1| hypothetical protein ECs3602 [Escherichia coli] gi|209761706|gb|ACI79165.1| hypothetical protein ECs3602 [Escherichia coli] gi|209913450|dbj|BAG78524.1| conserved hypothetical protein [Escherichia coli SE11] gi|217319835|gb|EEC28260.1| cell division protein FtsB [Escherichia coli O157:H7 str. TW14588] gi|218353078|emb|CAU98903.1| cell division protein [Escherichia coli 55989] gi|218362063|emb|CAQ99672.1| cell division protein [Escherichia coli IAI1] gi|218371225|emb|CAR19056.1| cell division protein [Escherichia coli IAI39] gi|218433339|emb|CAR14239.1| cell division protein [Escherichia coli UMN026] gi|226839414|gb|EEH71435.1| cell division protein FtsB [Escherichia sp. 1_1_43] gi|238860127|gb|ACR62125.1| cell division protein [Escherichia coli BW2952] gi|242378303|emb|CAQ33080.1| essential cell division protein FtsB [Escherichia coli BL21(DE3)] gi|253323440|gb|ACT28042.1| Septum formation initiator [Escherichia coli 'BL21-Gold(DE3)pLysS AG'] gi|253974580|gb|ACT40251.1| cell divison protein FtsB [Escherichia coli B str. REL606] gi|253978747|gb|ACT44417.1| cell diviision protein FtsB [Escherichia coli BL21(DE3)] gi|254594088|gb|ACT73449.1| cell division protein [Escherichia coli O157:H7 str. TW14359] gi|257755508|dbj|BAI27010.1| cell division protein FtsB [Escherichia coli O26:H11 str. 11368] gi|257760542|dbj|BAI32039.1| cell division protein FtsB [Escherichia coli O103:H2 str. 12009] gi|257765783|dbj|BAI37278.1| cell division protein FtsB [Escherichia coli O111:H- str. 11128] gi|260448201|gb|ACX38623.1| Septum formation initiator [Escherichia coli DH1] gi|284922684|emb|CBG35772.1| cell division protein [Escherichia coli 042] gi|290763948|gb|ADD57909.1| Cell division protein ftsB-like protein [Escherichia coli O55:H7 str. CB9615] gi|291322159|gb|EFE61588.1| cell division protein FtsB [Escherichia coli B088] gi|291426246|gb|EFE99278.1| cell division protein FtsB [Escherichia coli FVEC1412] gi|291432183|gb|EFF05165.1| cell division protein FtsB [Escherichia coli B185] gi|291468874|gb|EFF11365.1| cell division protein FtsB [Escherichia coli B354] gi|298277117|gb|EFI18633.1| cell division protein FtsB [Escherichia coli FVEC1302] gi|299879322|gb|EFI87533.1| cell division protein FtsB [Escherichia coli MS 196-1] gi|300318083|gb|EFJ67867.1| cell division protein FtsB [Escherichia coli MS 175-1] gi|300356498|gb|EFJ72368.1| cell division protein FtsB [Escherichia coli MS 198-1] gi|300395196|gb|EFJ78734.1| cell division protein FtsB [Escherichia coli MS 69-1] gi|300401440|gb|EFJ84978.1| cell division protein FtsB [Escherichia coli MS 84-1] gi|300421401|gb|EFK04712.1| cell division protein FtsB [Escherichia coli MS 182-1] gi|300453360|gb|EFK16980.1| cell division protein FtsB [Escherichia coli MS 116-1] gi|300454174|gb|EFK17667.1| cell division protein FtsB [Escherichia coli MS 21-1] gi|300461549|gb|EFK25042.1| cell division protein FtsB [Escherichia coli MS 187-1] gi|300526793|gb|EFK47862.1| cell division protein FtsB [Escherichia coli MS 119-7] gi|300531772|gb|EFK52834.1| cell division protein FtsB [Escherichia coli MS 107-1] gi|300838595|gb|EFK66355.1| cell division protein FtsB [Escherichia coli MS 124-1] gi|300847056|gb|EFK74816.1| cell division protein FtsB [Escherichia coli MS 78-1] gi|301076434|gb|EFK91240.1| cell division protein FtsB [Escherichia coli MS 146-1] gi|306907259|gb|EFN37765.1| Septum formation initiator [Escherichia coli W] gi|308121187|gb|EFO58449.1| cell division protein FtsB [Escherichia coli MS 145-7] gi|308925907|gb|EFP71386.1| septum formation initiator family protein [Shigella dysenteriae 1617] gi|309703107|emb|CBJ02439.1| cell division protein [Escherichia coli ETEC H10407] gi|310332983|gb|EFQ00197.1| septum formation initiator family protein [Escherichia coli 1827-70] gi|315062029|gb|ADT76356.1| cell division protein [Escherichia coli W] gi|315137355|dbj|BAJ44514.1| cell division protein ftsB-like protein [Escherichia coli DH1] gi|315254533|gb|EFU34501.1| cell division protein FtsB [Escherichia coli MS 85-1] gi|315615137|gb|EFU95774.1| septum formation initiator family protein [Escherichia coli 3431] gi|320180818|gb|EFW55741.1| Cell division protein FtsB [Shigella boydii ATCC 9905] gi|320186531|gb|EFW61259.1| Cell division protein FtsB [Shigella flexneri CDC 796-83] gi|320189077|gb|EFW63736.1| Cell division protein FtsB [Escherichia coli O157:H7 str. EC1212] gi|320202398|gb|EFW76968.1| Cell division protein FtsB [Escherichia coli EC4100B] gi|320645938|gb|EFX14919.1| cell division protein FtsB [Escherichia coli O157:H- str. 493-89] gi|320651238|gb|EFX19673.1| cell division protein FtsB [Escherichia coli O157:H- str. H 2687] gi|320656788|gb|EFX24676.1| cell division protein FtsB [Escherichia coli O55:H7 str. 3256-97 TW 07815] gi|320662331|gb|EFX29728.1| cell division protein FtsB [Escherichia coli O55:H7 str. USDA 5905] gi|320667383|gb|EFX34341.1| cell division protein FtsB [Escherichia coli O157:H7 str. LSU-61] gi|323154971|gb|EFZ41163.1| septum formation initiator family protein [Escherichia coli EPECa14] gi|323159943|gb|EFZ45913.1| septum formation initiator family protein [Escherichia coli E128010] gi|323167234|gb|EFZ52951.1| septum formation initiator family protein [Shigella sonnei 53G] gi|323172958|gb|EFZ58589.1| septum formation initiator family protein [Escherichia coli LT-68] gi|323180174|gb|EFZ65726.1| septum formation initiator family protein [Escherichia coli 1180] gi|323183280|gb|EFZ68677.1| septum formation initiator family protein [Escherichia coli 1357] gi|323377388|gb|ADX49656.1| Septum formation initiator [Escherichia coli KO11] gi|323935695|gb|EGB32009.1| septum formation initiator protein [Escherichia coli E1520] gi|323941421|gb|EGB37604.1| septum formation initiator protein [Escherichia coli E482] gi|323946366|gb|EGB42394.1| septum formation initiator protein [Escherichia coli H120] gi|323960592|gb|EGB56218.1| septum formation initiator protein [Escherichia coli H489] gi|323966900|gb|EGB62329.1| septum formation initiator protein [Escherichia coli M863] gi|323971523|gb|EGB66756.1| septum formation initiator protein [Escherichia coli TA007] gi|324017019|gb|EGB86238.1| cell division protein FtsB [Escherichia coli MS 117-3] gi|324120002|gb|EGC13880.1| septum formation initiator protein [Escherichia coli E1167] gi|326339184|gb|EGD62999.1| Cell division protein FtsB [Escherichia coli O157:H7 str. 1044] gi|326342933|gb|EGD66701.1| Cell division protein FtsB [Escherichia coli O157:H7 str. 1125] gi|327251476|gb|EGE63162.1| septum formation initiator family protein [Escherichia coli STEC_7v] gi|331036905|gb|EGI09129.1| cell division protein FtsB [Escherichia coli H736] gi|331047608|gb|EGI19685.1| cell division protein FtsB [Escherichia coli M718] gi|331058235|gb|EGI30216.1| cell division protein FtsB [Escherichia coli TA143] gi|331063155|gb|EGI35068.1| cell division protein FtsB [Escherichia coli TA271] gi|331068348|gb|EGI39743.1| cell division protein FtsB [Escherichia coli TA280] gi|331073558|gb|EGI44879.1| cell division protein FtsB [Escherichia coli H591] gi|332087484|gb|EGI92612.1| septum formation initiator family protein [Shigella boydii 5216-82] gi|332087688|gb|EGI92815.1| septum formation initiator family protein [Shigella dysenteriae 155-74] gi|332091997|gb|EGI97075.1| septum formation initiator family protein [Shigella boydii 3594-74] gi|332102941|gb|EGJ06287.1| cell division protein ftsB [Shigella sp. D9] gi|332344631|gb|AEE57965.1| conserved hypothetical protein [Escherichia coli UMNK88] Length = 103 Score = 33.6 bits (76), Expect = 8.8, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 32/64 (50%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ ++LK +L ++ ++ G ++ L+E+AR L+++ Sbjct: 22 GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNGG---QEALEERARNELSMT 78 Query: 94 RSDE 97 R E Sbjct: 79 RPGE 82 >gi|148680223|gb|EDL12170.1| centromere protein E, isoform CRA_b [Mus musculus] Length = 1298 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 27/44 (61%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 A+V GL +N LEK + + ++ L++ E + L+ +V L+S+ Sbjct: 705 ALVDGKGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSE 748 >gi|115648101|ref|NP_776123.3| centromere-associated protein E [Mus musculus] Length = 2471 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 27/44 (61%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 A+V GL +N LEK + + ++ L++ E + L+ +V L+S+ Sbjct: 705 ALVDGKGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSE 748 >gi|81892832|sp|Q6RT24|CENPE_MOUSE RecName: Full=Centromere-associated protein E; AltName: Full=Centromere protein E; Short=CENP-E; AltName: Full=Kinesin superfamily protein 10; Short=KIF10; AltName: Full=Motor domain of KIF10; Flags: Precursor gi|40388490|gb|AAR85498.1| centromere associated protein-E [Mus musculus] Length = 2474 Score = 33.6 bits (76), Expect = 8.9, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 27/44 (61%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 A+V GL +N LEK + + ++ L++ E + L+ +V L+S+ Sbjct: 705 ALVDGKGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSE 748 >gi|322490366|emb|CBZ25626.1| conserved hypothetical protein [Leishmania mexicana MHOM/GT/2001/U1103] Length = 1551 Score = 33.6 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 15/67 (22%), Positives = 32/67 (47%), Gaps = 11/67 (16%) Query: 40 ANKSLEKSLIERERFLSELKENRSRL----ERKVKLMSDGSLEKD-----LLDE--KARY 88 A + + L ++ +R+ L +V+L+ + LEKD LL++ +A+ Sbjct: 822 AITDFSQRFAALQAELDVVRADRNELIGEQSEQVRLLQEQLLEKDTAQWRLLEDLHRAQE 881 Query: 89 SLNLSRS 95 L ++R+ Sbjct: 882 QLTVARA 888 >gi|209525012|ref|ZP_03273556.1| conserved hypothetical protein [Arthrospira maxima CS-328] gi|209494421|gb|EDZ94732.1| conserved hypothetical protein [Arthrospira maxima CS-328] Length = 99 Score = 33.6 bits (76), Expect = 9.0, Method: Composition-based stats. Identities = 9/44 (20%), Positives = 22/44 (50%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLL 82 +A + E++ +E ++ + R R ER +L+ ++ + L Sbjct: 56 QAEQRFEQAEVELQQERQRAEAERQRAERLAELLRAQGIDPEEL 99 >gi|114797112|ref|YP_761708.1| putative cell division protein FtsL [Hyphomonas neptunium ATCC 15444] gi|114737286|gb|ABI75411.1| putative cell division protein FtsL [Hyphomonas neptunium ATCC 15444] Length = 130 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 13/85 (15%), Positives = 26/85 (30%), Gaps = 15/85 (17%) Query: 16 FLVIAFCCVVYFTNHAIVGDYGLKANKS----LEKSLIERERFLSELKENRSRLERKVKL 71 YG K + +E + E +R + L+ + + R+ Sbjct: 5 VFFFGLLVAGLLIFSLYRAKYGAKDTAAELMAVEAQIEEAQREKALLETELAHMSRR--- 61 Query: 72 MSDGSLEKDLLDEKARYSLNLSRSD 96 D ++E AR L ++ Sbjct: 62 --------DWIEEFARKELGMAPPK 78 >gi|260887860|ref|ZP_05899123.1| putative cell division protein FtsL [Selenomonas sputigena ATCC 35185] gi|330838728|ref|YP_004413308.1| Septum formation initiator [Selenomonas sputigena ATCC 35185] gi|260862366|gb|EEX76866.1| putative cell division protein FtsL [Selenomonas sputigena ATCC 35185] gi|329746492|gb|AEB99848.1| Septum formation initiator [Selenomonas sputigena ATCC 35185] Length = 98 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 17/98 (17%), Positives = 39/98 (39%), Gaps = 8/98 (8%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 M T+ ++ H F+V+ C + YF+ I L L++ ++ L + Sbjct: 3 MATESKRRGHRLDW-FVVVILCVLGYFSYTMIDQQIHLN---ELDRDCAAAQQRLETAQR 58 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 + L+ + + +++ AR L ++ E+ Sbjct: 59 ENAELKDLKAKLD----DPVYIEKTAREELGMTHEGEL 92 >gi|239933024|ref|ZP_04689977.1| two-component system sensory histidine kinase [Streptomyces ghanaensis ATCC 14672] Length = 1332 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE---KDLLDEKARYSL 90 L++ E + EL+ + + LE K L++ + + K+L E+AR L Sbjct: 704 TAELQQRSAELQTQQEELQHSNAELEEKAALLATQNRDIEAKNLQIEQARQEL 756 >gi|28198454|ref|NP_778768.1| cell division protein FtsB [Xylella fastidiosa Temecula1] gi|182681127|ref|YP_001829287.1| cell division protein FtsB [Xylella fastidiosa M23] gi|32129532|sp|Q87DY5|FTSB_XYLFT RecName: Full=Cell division protein ftsB homolog gi|226707166|sp|B2I938|FTSB_XYLF2 RecName: Full=Cell division protein ftsB homolog gi|28056538|gb|AAO28417.1| conserved hypothetical protein [Xylella fastidiosa Temecula1] gi|182631237|gb|ACB92013.1| Septum formation initiator [Xylella fastidiosa M23] gi|307579575|gb|ADN63544.1| cell division protein FtsB [Xylella fastidiosa subsp. fastidiosa GB514] Length = 118 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 + L+ ++++ + L++ + L +VK + DG ++E+AR L + + EI Sbjct: 33 RMLQVQIVQQHQENERLRQRNASLAAEVKNLKDGDA---AIEERARSELGMIKPGEI 86 >gi|71898805|ref|ZP_00680973.1| Septum formation initiator [Xylella fastidiosa Ann-1] gi|71731391|gb|EAO33454.1| Septum formation initiator [Xylella fastidiosa Ann-1] Length = 118 Score = 33.6 bits (76), Expect = 9.1, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 + L+ ++++ + L++ + L +VK + DG ++E+AR L + + EI Sbjct: 33 RMLQVQIVQQHQENERLRQRNASLAAEVKNLKDGDA---AIEERARSELGMIKPGEI 86 >gi|148680222|gb|EDL12169.1| centromere protein E, isoform CRA_a [Mus musculus] Length = 2524 Score = 33.6 bits (76), Expect = 9.2, Method: Composition-based stats. Identities = 14/44 (31%), Positives = 27/44 (61%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 A+V GL +N LEK + + ++ L++ E + L+ +V L+S+ Sbjct: 705 ALVDGKGLLSNLELEKRITDLQKELNKEAEEKQTLQEEVNLLSE 748 >gi|297669212|ref|XP_002812799.1| PREDICTED: bone morphogenetic protein receptor type-2-like [Pongo abelii] Length = 1038 Score = 33.6 bits (76), Expect = 9.3, Method: Composition-based stats. Identities = 21/75 (28%), Positives = 30/75 (40%), Gaps = 8/75 (10%) Query: 14 AIFLVIAFCCVV-YFTNHAIVGDY--GLKANKSLEKSLIERERFLSELKENRSRLERKVK 70 A V+A V YF + GD GL + +E + E L LK L + Sbjct: 156 ASVSVLAVLIVALYFGYRMLTGDRKQGLHSMNMMEAAASEPSLDLDNLK-----LLELIG 210 Query: 71 LMSDGSLEKDLLDEK 85 G++ K LDE+ Sbjct: 211 RGRYGAVYKGSLDER 225 >gi|224824526|ref|ZP_03697633.1| Septum formation initiator [Lutiella nitroferrum 2002] gi|224603019|gb|EEG09195.1| Septum formation initiator [Lutiella nitroferrum 2002] Length = 98 Score = 33.6 bits (76), Expect = 9.3, Method: Composition-based stats. Identities = 15/56 (26%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 L+K L E+ L + L+ +V + G+ D ++E+AR L + R E+ Sbjct: 31 QLDKQLQEQRAVNQTLIARNAALDAEVGDLKRGT---DAIEERARNELGMIRQGEV 83 >gi|221111865|ref|XP_002167766.1| PREDICTED: similar to RING finger protein 219 [Hydra magnipapillata] Length = 433 Score = 33.6 bits (76), Expect = 9.3, Method: Composition-based stats. Identities = 9/39 (23%), Positives = 22/39 (56%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGS 76 + AN+ L +S +E ++ L + R + +++K + + S Sbjct: 172 IIANEELSRSNVELKKELQTINSERESMMKEIKRLQEDS 210 >gi|291441377|ref|ZP_06580767.1| two-component system sensor kinase [Streptomyces ghanaensis ATCC 14672] gi|291344272|gb|EFE71228.1| two-component system sensor kinase [Streptomyces ghanaensis ATCC 14672] Length = 1334 Score = 33.6 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 14/53 (26%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Query: 41 NKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE---KDLLDEKARYSL 90 L++ E + EL+ + + LE K L++ + + K+L E+AR L Sbjct: 706 TAELQQRSAELQTQQEELQHSNAELEEKAALLATQNRDIEAKNLQIEQARQEL 758 >gi|259909448|ref|YP_002649804.1| cell division protein FtsB [Erwinia pyrifoliae Ep1/96] gi|224965070|emb|CAX56602.1| Cell division protein FtsB homolog [Erwinia pyrifoliae Ep1/96] gi|283479521|emb|CAY75437.1| Cell division protein ftsB homolog [Erwinia pyrifoliae DSM 12163] Length = 109 Score = 33.6 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ + LK RL ++ ++ GS + ++E+AR L + Sbjct: 22 GKNGIHDYTRVNDDVASQQGANARLKARNDRLFAEIDDLNGGS---EAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|298530684|ref|ZP_07018086.1| Septum formation initiator [Desulfonatronospira thiodismutans ASO3-1] gi|298510058|gb|EFI33962.1| Septum formation initiator [Desulfonatronospira thiodismutans ASO3-1] Length = 91 Score = 33.6 bits (76), Expect = 9.5, Method: Composition-based stats. Identities = 15/77 (19%), Positives = 32/77 (41%), Gaps = 3/77 (3%) Query: 28 TNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKAR 87 G + +++ E ++ L E +L +++K + KD + E R Sbjct: 18 AYQLYWGPSSVPVYLENKETFQELKQENKALLEENKQLSKEIKHLRSR---KDFIKEAVR 74 Query: 88 YSLNLSRSDEIILFYSD 104 + R DE++ ++SD Sbjct: 75 KEMGYVREDEVMYYFSD 91 >gi|225867627|ref|YP_002743575.1| septum formation initiator protein [Streptococcus equi subsp. zooepidemicus] gi|225869497|ref|YP_002745444.1| septum formation initiator protein [Streptococcus equi subsp. equi 4047] gi|225698901|emb|CAW91890.1| putative septum formation initiator protein [Streptococcus equi subsp. equi 4047] gi|225700903|emb|CAW97569.1| putative septum formation initiator protein [Streptococcus equi subsp. zooepidemicus] Length = 123 Score = 33.6 bits (76), Expect = 9.6, Method: Composition-based stats. Identities = 20/100 (20%), Positives = 37/100 (37%), Gaps = 8/100 (8%) Query: 6 YKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRL 65 K+N F I + + F F G + K + +I E+ EL++ Sbjct: 29 QKRNRFMGWILVSMMFL----FILPTYNLVKGYVSLKKQGQQIITLEKEYRELEKKTKSE 84 Query: 66 ERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSDF 105 ++ + + + D + + AR LSR E+I Sbjct: 85 KQLAEQLKND----DFVKKYARAKYYLSREGEVIYPTPGL 120 >gi|27364949|ref|NP_760477.1| cell division protein FtsB [Vibrio vulnificus CMCP6] gi|37681001|ref|NP_935610.1| cell division protein FtsB [Vibrio vulnificus YJ016] gi|320155336|ref|YP_004187715.1| cell division protein FtsB [Vibrio vulnificus MO6-24/O] gi|33301178|sp|Q8DC61|FTSB_VIBVU RecName: Full=Cell division protein ftsB homolog gi|62286846|sp|Q7MHQ2|FTSB_VIBVY RecName: Full=Cell division protein ftsB homolog gi|27361095|gb|AAO10004.1| Cell division protein ftsB [Vibrio vulnificus CMCP6] gi|37199751|dbj|BAC95581.1| septum formation initiator [Vibrio vulnificus YJ016] gi|319930648|gb|ADV85512.1| cell division protein FtsB [Vibrio vulnificus MO6-24/O] Length = 93 Score = 33.6 bits (76), Expect = 9.6, Method: Composition-based stats. Identities = 13/83 (15%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Query: 15 IFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSD 74 +F+++ + G G+ ++E + ++ ++L+ S + ++ + Sbjct: 3 LFILVLTLLFGWLQYTLWFGKNGVSDYYTIESDIEAQQLVNTKLQARNSEMYAEIDDLKQ 62 Query: 75 GSLEKDLLDEKARYSLNLSRSDE 97 G D ++E+AR+ L + + E Sbjct: 63 G---LDAIEERARHELGMLKEGE 82 >gi|332881254|ref|ZP_08448904.1| outer membrane protein, OMP85 family [Capnocytophaga sp. oral taxon 329 str. F0087] gi|332680630|gb|EGJ53577.1| outer membrane protein, OMP85 family [Capnocytophaga sp. oral taxon 329 str. F0087] Length = 877 Score = 33.6 bits (76), Expect = 9.7, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 K R LE ++ L+ D L +++D +A++ Sbjct: 130 KGEREDLENRIGLLKDNQLTPNMID-RAKFL 159 >gi|292492704|ref|YP_003528143.1| septum formation initiator [Nitrosococcus halophilus Nc4] gi|291581299|gb|ADE15756.1| Septum formation initiator [Nitrosococcus halophilus Nc4] Length = 91 Score = 33.6 bits (76), Expect = 9.7, Method: Composition-based stats. Identities = 16/61 (26%), Positives = 31/61 (50%), Gaps = 3/61 (4%) Query: 37 GLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSD 96 GL + L +S+ ++ + + L E L+ +V+ + G D L+E+AR L + + Sbjct: 25 GLGELRRLSRSIQQQRQENAALVERNQVLDAEVRDLKSG---LDALEERARSELGMVKQG 81 Query: 97 E 97 E Sbjct: 82 E 82 >gi|302848593|ref|XP_002955828.1| hypothetical protein VOLCADRAFT_96773 [Volvox carteri f. nagariensis] gi|300258796|gb|EFJ43029.1| hypothetical protein VOLCADRAFT_96773 [Volvox carteri f. nagariensis] Length = 1701 Score = 33.6 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 16/53 (30%), Positives = 28/53 (52%), Gaps = 4/53 (7%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLM----SDGSLEKDLLDEKA 86 L A+ +++ ERE L+ L R L+R++ M S+ E+D+L +A Sbjct: 1048 LDADARFHEAITEREARLAALASERESLQRQISTMSALQSEDKQERDMLRLRA 1100 >gi|297568613|ref|YP_003689957.1| Septum formation initiator [Desulfurivibrio alkaliphilus AHT2] gi|296924528|gb|ADH85338.1| Septum formation initiator [Desulfurivibrio alkaliphilus AHT2] Length = 102 Score = 33.6 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 14/69 (20%), Positives = 32/69 (46%), Gaps = 3/69 (4%) Query: 36 YGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRS 95 YGL + + L E ++ L+ + +L ++ + + + ++E AR L + Sbjct: 35 YGLWQYGKVSRQLNELQQKNHSLEVQQRQLREEIDRLQH---DPEYIEEVARREYGLLKE 91 Query: 96 DEIILFYSD 104 +EI+ +S Sbjct: 92 NEILFDFSP 100 >gi|255657448|ref|ZP_05402857.1| putative septum formation protein [Clostridium difficile QCD-23m63] gi|296449044|ref|ZP_06890834.1| probable septum formation protein [Clostridium difficile NAP08] gi|296879867|ref|ZP_06903840.1| probable septum formation protein [Clostridium difficile NAP07] gi|296262137|gb|EFH08942.1| probable septum formation protein [Clostridium difficile NAP08] gi|296429156|gb|EFH15030.1| probable septum formation protein [Clostridium difficile NAP07] Length = 94 Score = 33.6 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 17/93 (18%), Positives = 39/93 (41%), Gaps = 8/93 (8%) Query: 7 KKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLE 66 +K + I + + ++ V +Y K +K + + L + + + L+ Sbjct: 4 RKKFSGQIIVISLFLGISIFSMMTGFVFEY--TKAKEYKKEIASLNKQLKKTEIQINALK 61 Query: 67 RKVKLMSDGSLEKDLLDEKARYSLNLSRSDEII 99 + + S E D L++ AR LN+ + +E + Sbjct: 62 K-----DEKSYEGD-LEDIARKRLNMVKPNETV 88 >gi|255071455|ref|XP_002499401.1| predicted protein [Micromonas sp. RCC299] gi|226514664|gb|ACO60660.1| predicted protein [Micromonas sp. RCC299] Length = 535 Score = 33.6 bits (76), Expect = 9.8, Method: Composition-based stats. Identities = 16/65 (24%), Positives = 30/65 (46%), Gaps = 4/65 (6%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKL----MSDGSLEKDLLDEKARYSLNLS 93 ++ + L E L ++ +RL +VK + D + +D LD++ R +LS Sbjct: 134 IRERDEANEQLEFLEGELEGVRAEETRLRAEVKSQGEELRDVTKNRDDLDDEVRRLKDLS 193 Query: 94 RSDEI 98 + EI Sbjct: 194 NAREI 198 >gi|330996369|ref|ZP_08320252.1| outer membrane protein, OMP85 family [Paraprevotella xylaniphila YIT 11841] gi|329573227|gb|EGG54841.1| outer membrane protein, OMP85 family [Paraprevotella xylaniphila YIT 11841] Length = 877 Score = 33.6 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 9/31 (29%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Query: 59 KENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 K R LE ++ L+ D L +++D +A++ Sbjct: 130 KGEREDLENRIGLLKDNQLTPNMID-RAKFL 159 >gi|292487244|ref|YP_003530116.1| cell division protein FtsB [Erwinia amylovora CFBP1430] gi|292900384|ref|YP_003539753.1| cell division protein [Erwinia amylovora ATCC 49946] gi|291200232|emb|CBJ47360.1| cell division protein [Erwinia amylovora ATCC 49946] gi|291552663|emb|CBA19708.1| Cell division protein ftsB homolog [Erwinia amylovora CFBP1430] gi|312171345|emb|CBX79604.1| Cell division protein ftsB homolog [Erwinia amylovora ATCC BAA-2158] Length = 104 Score = 33.6 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 13/64 (20%), Positives = 29/64 (45%), Gaps = 3/64 (4%) Query: 34 GDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLS 93 G G+ + + ++ + LK RL ++ ++ GS + ++E+AR L + Sbjct: 22 GKNGIHDYTRVNDDVASQQGTNARLKARNDRLFAEIDDLNGGS---EAIEERARNELGMI 78 Query: 94 RSDE 97 + E Sbjct: 79 KPGE 82 >gi|260787763|ref|XP_002588921.1| hypothetical protein BRAFLDRAFT_125428 [Branchiostoma floridae] gi|229274093|gb|EEN44932.1| hypothetical protein BRAFLDRAFT_125428 [Branchiostoma floridae] Length = 405 Score = 33.6 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 15/54 (27%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Query: 44 LEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDE 97 LE + ER + L L+ R+ L KV+++ + E LL E+ Y + + + Sbjct: 30 LELEVAERTQNLRRLEAQRNELNAKVRMLRE---ELQLLQEQGSYVGEVVKPMD 80 >gi|15837893|ref|NP_298581.1| cell division protein FtsB [Xylella fastidiosa 9a5c] gi|25091715|sp|Q9PDT7|FTSB_XYLFA RecName: Full=Cell division protein ftsB homolog gi|9106281|gb|AAF84101.1|AE003962_11 conserved hypothetical protein [Xylella fastidiosa 9a5c] Length = 118 Score = 33.6 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 + L+ ++++ + L++ + L +VK + DG ++E+AR L + + EI Sbjct: 33 RMLQVQIVQQHQENERLRQRNASLAAEVKNLKDGDA---AIEERARSELGMIKPGEI 86 >gi|71274917|ref|ZP_00651205.1| Septum formation initiator [Xylella fastidiosa Dixon] gi|71901859|ref|ZP_00683922.1| Septum formation initiator [Xylella fastidiosa Ann-1] gi|170729818|ref|YP_001775251.1| cell division protein FtsB [Xylella fastidiosa M12] gi|226707167|sp|B0U659|FTSB_XYLFM RecName: Full=Cell division protein ftsB homolog gi|71164649|gb|EAO14363.1| Septum formation initiator [Xylella fastidiosa Dixon] gi|71728387|gb|EAO30555.1| Septum formation initiator [Xylella fastidiosa Ann-1] gi|167964611|gb|ACA11621.1| cell division protein FtsB [Xylella fastidiosa M12] Length = 118 Score = 33.6 bits (76), Expect = 9.9, Method: Composition-based stats. Identities = 13/57 (22%), Positives = 30/57 (52%), Gaps = 3/57 (5%) Query: 42 KSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEI 98 + L+ ++++ + L++ + L +VK + DG ++E+AR L + + EI Sbjct: 33 RMLQVQIVQQHQENERLRQRNASLAAEVKNLKDGDA---AIEERARSELGMIKPGEI 86 Database: nr Posted date: May 22, 2011 12:22 AM Number of letters in database: 999,999,966 Number of sequences in database: 2,987,313 Database: /data/usr2/db/fasta/nr.01 Posted date: May 22, 2011 12:30 AM Number of letters in database: 999,999,796 Number of sequences in database: 2,903,041 Database: /data/usr2/db/fasta/nr.02 Posted date: May 22, 2011 12:36 AM Number of letters in database: 999,999,281 Number of sequences in database: 2,904,016 Database: /data/usr2/db/fasta/nr.03 Posted date: May 22, 2011 12:41 AM Number of letters in database: 999,999,960 Number of sequences in database: 2,935,328 Database: /data/usr2/db/fasta/nr.04 Posted date: May 22, 2011 12:46 AM Number of letters in database: 842,794,627 Number of sequences in database: 2,394,679 Lambda K H 0.319 0.166 0.491 Lambda K H 0.267 0.0509 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 2,215,931,678 Number of Sequences: 14124377 Number of extensions: 91209906 Number of successful extensions: 765924 Number of sequences better than 10.0: 1708 Number of HSP's better than 10.0 without gapping: 784 Number of HSP's successfully gapped in prelim test: 1199 Number of HSP's that attempted gapping in prelim test: 762003 Number of HSP's gapped (non-prelim): 4767 length of query: 105 length of database: 4,842,793,630 effective HSP length: 73 effective length of query: 32 effective length of database: 3,811,714,109 effective search space: 121974851488 effective search space used: 121974851488 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 76 (33.6 bits)