RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] (105 letters) >gnl|CDD|32743 COG2919, COG2919, Septum formation initiator [Cell division and chromosome partitioning]. Length = 117 Score = 52.2 bits (125), Expect = 3e-08 Identities = 23/104 (22%), Positives = 45/104 (43%), Gaps = 3/104 (2%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKE 60 T+ ++ R I ++ + F A G G L++ + ++ L +L Sbjct: 12 KATRQGERRVRRRRILTLVLLALLALFQYLAWFGKNGAADVLQLQRQIAAQQAELEKLSA 71 Query: 61 NRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIILFYSD 104 + LE ++K + DG +D ++E+AR L +S+ EI Sbjct: 72 RNTALEAEIKDLKDG---RDYIEERARSELGMSKPGEIFFRLVK 112 >gnl|CDD|147248 pfam04977, DivIC, Septum formation initiator. DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil. Length = 80 Score = 46.8 bits (112), Expect = 1e-06 Identities = 22/76 (28%), Positives = 35/76 (46%), Gaps = 3/76 (3%) Query: 24 VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLD 83 ++ F I G GL A L + + + L++LK LE +VK + D ++ Sbjct: 2 LLLFQYLLIFGVGGLSAYYQLNQEIAALQAELAKLKAENEELEAEVKDLKSD---PDYIE 58 Query: 84 EKARYSLNLSRSDEII 99 E+AR L L + E I Sbjct: 59 ERARSELGLVKPGETI 74 >gnl|CDD|38015 KOG2804, KOG2804, KOG2804, Phosphorylcholine transferase/cholinephosphate cytidylyltransferase [Lipid transport and metabolism]. Length = 348 Score = 28.1 bits (62), Expect = 0.47 Identities = 20/71 (28%), Positives = 36/71 (50%), Gaps = 3/71 (4%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKV-KLMSDGSLEKDLLDEKARYSL 90 IV DY + ++L + +E +S LKE + RL+ KV +L +++ + E +R + Sbjct: 196 IVRDYDVYVRRNLARGYSAKELNVSFLKEKKLRLQNKVDELKEKVKEQQEKVKEFSRDLI 255 Query: 91 N--LSRSDEII 99 +S E I Sbjct: 256 QKWEEKSREFI 266 >gnl|CDD|99919 cd05536, POLBc_B3, DNA polymerase type-B B3 subfamily catalytic domain. Archaeal proteins that are involved in DNA replication are similar to those from eukaryotes. Some members of the archaea also possess multiple family B DNA polymerases (B1, B2 and B3). So far there is no specific function(s) has been assigned for different members of the archaea type B DNA polymerases. Phylogenetic analyses of eubacterial, archaeal, and eukaryotic family B DNA polymerases are support independent gene duplications during the evolution of archaeal and eukaryotic family B DNA polymerases. Structural comparison of the thermostable DNA polymerase type B to its mesostable homolog suggests several adaptations to high temperature such as shorter loops, disulfide bridges, and increasing electrostatic interaction at subdomain interfaces.. Length = 371 Score = 28.1 bits (63), Expect = 0.58 Identities = 14/35 (40%), Positives = 20/35 (57%) Query: 53 RFLSELKENRSRLERKVKLMSDGSLEKDLLDEKAR 87 L +L E R R++ K+K + S E LLDE+ R Sbjct: 71 SVLEDLLEERRRIKEKMKKLDPESEEYKLLDERQR 105 >gnl|CDD|34550 COG4942, COG4942, Membrane-bound metallopeptidase [Cell division and chromosome partitioning]. Length = 420 Score = 27.6 bits (61), Expect = 0.74 Identities = 10/31 (32%), Positives = 16/31 (51%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKV 69 K L L ++ L EL+ N SRL+ ++ Sbjct: 210 KTLAQLNSELSADQKKLEELRANESRLKNEI 240 >gnl|CDD|32910 COG3096, MukB, Uncharacterized protein involved in chromosome partitioning [Cell division and chromosome partitioning]. Length = 1480 Score = 26.9 bits (59), Expect = 1.1 Identities = 19/54 (35%), Positives = 25/54 (46%), Gaps = 3/54 (5%) Query: 35 DYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARY 88 DY L N + K+ + E + L+ENR LE SD L K L+ E Y Sbjct: 219 DYLLPENSGVRKAFQDME---AALRENRMTLEAIRVTQSDRDLFKHLISEATNY 269 >gnl|CDD|35737 KOG0517, KOG0517, KOG0517, Beta-spectrin [Cytoskeleton]. Length = 2473 Score = 26.9 bits (59), Expect = 1.3 Identities = 15/61 (24%), Positives = 30/61 (49%), Gaps = 4/61 (6%) Query: 31 AIVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVK----LMSDGSLEKDLLDEKA 86 + D + ++L ++ + F +EL N+ LE+ K L+S+ K L+++K Sbjct: 1291 LMAQDESYRDARNLHSKWLKHQAFEAELAANKEWLEKIEKEGQELVSEKPELKALVEKKL 1350 Query: 87 R 87 R Sbjct: 1351 R 1351 >gnl|CDD|144619 pfam01093, Clusterin, Clusterin. Length = 460 Score = 26.6 bits (59), Expect = 1.5 Identities = 11/40 (27%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Query: 36 YGLKANKSL-EKSLIERERFLSELKENRSRLERKVKLMSD 74 G+K K+L E++ E + +S L++ + E +KL ++ Sbjct: 49 IGVKQMKTLMERTEEEHKNLMSTLEKTKKEKEEALKLANE 88 >gnl|CDD|39823 KOG4623, KOG4623, KOG4623, Uncharacterized conserved protein [Function unknown]. Length = 611 Score = 26.2 bits (57), Expect = 1.8 Identities = 15/55 (27%), Positives = 24/55 (43%), Gaps = 1/55 (1%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLE-KDLLDEKARYSLN 91 +K K + + +R+ EL+ R LE L S+ +D LDE + N Sbjct: 113 IKNRKLADFEPPDEQRYDEELEVYRKSLEEMFPLCSECYDSVQDQLDENKYEAKN 167 >gnl|CDD|177097 CHL00206, ycf2, Ycf2; Provisional. Length = 2281 Score = 25.6 bits (56), Expect = 3.1 Identities = 14/44 (31%), Positives = 21/44 (47%) Query: 57 ELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 EL +R R R +S+G + L E +Y NL S+ +L Sbjct: 2215 ELLIHRQRWLRTNSSLSNGFFRSNTLSESYQYLSNLFLSNGTLL 2258 >gnl|CDD|146312 pfam03609, EII-Sor, PTS system sorbose-specific iic component. Length = 237 Score = 25.5 bits (57), Expect = 3.4 Identities = 6/27 (22%), Positives = 8/27 (29%), Gaps = 7/27 (25%) Query: 1 MWTKYYKKNHFFRAIFLVIAFCCVVYF 27 M K Y F ++ F Y Sbjct: 200 MPKKEY-------IPFFLLGFVLAAYL 219 >gnl|CDD|35694 KOG0473, KOG0473, KOG0473, Leucine-rich repeat protein [Function unknown]. Length = 326 Score = 24.4 bits (52), Expect = 6.8 Identities = 16/50 (32%), Positives = 21/50 (42%), Gaps = 2/50 (4%) Query: 7 KKNHFFRAIFLVIAFCCVVYFT-NHAIVGDYGLKANKSLEKSLIERERFL 55 KK FFR +F + + CV Y T A + A+ S ER L Sbjct: 119 KKTEFFRKLFGFV-WSCVFYLTIVVATSSTVAIAADCKGLGSPRERTAPL 167 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.324 0.139 0.401 Gapped Lambda K H 0.267 0.0731 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,263,422 Number of extensions: 57286 Number of successful extensions: 325 Number of sequences better than 10.0: 1 Number of HSP's gapped: 323 Number of HSP's successfully gapped: 36 Length of query: 105 Length of database: 6,263,737 Length adjustment: 72 Effective length of query: 33 Effective length of database: 4,707,889 Effective search space: 155360337 Effective search space used: 155360337 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (23.4 bits)