RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780671|ref|YP_003065084.1| putative cell division protein [Candidatus Liberibacter asiaticus str. psy62] (105 letters) >gnl|CDD|183249 PRK11637, PRK11637, AmiB activator; Provisional. Length = 428 Score = 29.7 bits (67), Expect = 0.18 Identities = 12/27 (44%), Positives = 17/27 (62%) Query: 43 SLEKSLIERERFLSELKENRSRLERKV 69 LE SL + ++ LSEL+ N SRL + Sbjct: 223 GLESSLQKDQQQLSELRANESRLRDSI 249 >gnl|CDD|150799 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone. This is a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion. The C-terminus is a PDZ-binding motif that binds directly to RIM (a small G protein Rab-3A effector). The family also contains four coiled-coil domains. Length = 774 Score = 27.7 bits (61), Expect = 0.65 Identities = 15/28 (53%), Positives = 19/28 (67%) Query: 40 ANKSLEKSLIERERFLSELKENRSRLER 67 A + LEK+L E+ER + LKE R R ER Sbjct: 434 ALEKLEKALAEKERIIERLKEQRDRDER 461 >gnl|CDD|163395 TIGR03683, A-tRNA_syn_arch, alanyl-tRNA synthetase. This family of alanyl-tRNA synthetases is limited to the archaea, and is a subset of those sequences identified by the model pfam07973 covering the second additional domain (SAD) of alanyl and threonyl tRNA synthetases. Length = 902 Score = 26.1 bits (58), Expect = 2.3 Identities = 12/36 (33%), Positives = 16/36 (44%), Gaps = 9/36 (25%) Query: 52 ERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKAR 87 +RF E KE R +ER L+K L + K Sbjct: 768 KRFFEEWKEQRKEIER---------LKKKLAELKIY 794 >gnl|CDD|162092 TIGR00891, 2A0112, putative sialic acid transporter. Length = 405 Score = 26.0 bits (57), Expect = 2.4 Identities = 9/55 (16%), Positives = 13/55 (23%), Gaps = 11/55 (20%) Query: 15 IFLVIAFCC-----------VVYFTNHAIVGDYGLKANKSLEKSLIERERFLSEL 58 +F C + G+YG A +E S L Sbjct: 86 LFSAGTLACGFAPGYITMFIARLVIGIGMGGEYGSSAAYVIESWPKHLRNKASGL 140 >gnl|CDD|152563 pfam12128, DUF3584, Protein of unknown function (DUF3584). This protein is found in bacteria and eukaryotes. Proteins in this family are typically between 943 to 1234 amino acids in length. There are two conserved sequence motifs: GKT and YLP. Length = 1192 Score = 25.8 bits (57), Expect = 2.9 Identities = 10/28 (35%), Positives = 12/28 (42%) Query: 43 SLEKSLIERERFLSELKENRSRLERKVK 70 E S+ ER L E R RL +K Sbjct: 884 QAEGSISERLSQLEEFLRKRERLSGDLK 911 >gnl|CDD|184120 PRK13533, PRK13533, 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional. Length = 487 Score = 24.8 bits (55), Expect = 5.5 Identities = 15/47 (31%), Positives = 19/47 (40%), Gaps = 10/47 (21%) Query: 51 RERFLSELKENRSRLERKVKLMSD----------GSLEKDLLDEKAR 87 E EL+E RLE +L+ D G DL +E AR Sbjct: 132 YEEAEEELEETLERLEEAAELIQDGDMLWVAPVQGGTYPDLREESAR 178 >gnl|CDD|163179 TIGR03185, DNA_S_dndD, DNA sulfur modification protein DndD. This model describes the DndB protein encoded by an operon associated with a sulfur-containing modification to DNA. The operon is sporadically distributed in bacteria, much like some restriction enzyme operons. DndD is described as a putative ATPase. The small number of examples known so far include species from among the Firmicutes, Actinomycetes, Proteobacteria, and Cyanobacteria. Length = 650 Score = 24.6 bits (54), Expect = 6.2 Identities = 11/35 (31%), Positives = 19/35 (54%) Query: 39 KANKSLEKSLIERERFLSELKENRSRLERKVKLMS 73 +A +SLE + +L E R +LER++K + Sbjct: 241 EAQRSLESLEKKFRSEGGDLFEEREQLERQLKEIE 275 >gnl|CDD|173093 PRK14630, PRK14630, hypothetical protein; Provisional. Length = 143 Score = 24.4 bits (53), Expect = 6.3 Identities = 23/68 (33%), Positives = 34/68 (50%), Gaps = 1/68 (1%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDL-LDEKARYSLNLSRSD 96 LK N SLE S R + +E + +K+KLM D E+ L+ KA + + S Sbjct: 69 LKYNFSLEISTPGINRKIKSDREFKIFEGKKIKLMLDNDFEEGFILEAKADSFIFKTDSK 128 Query: 97 EIILFYSD 104 E+ + YSD Sbjct: 129 EVNVLYSD 136 >gnl|CDD|162629 TIGR01967, DEAH_box_HrpA, ATP-dependent helicase HrpA. This model represents HrpA, one of two related but uncharacterized DEAH-box ATP-dependent helicases in many Proteobacteria and a few high-GC Gram-positive bacteria. HrpA is about 1300 amino acids long, while its paralog HrpB, also uncharacterized, is about 800 amino acids long. Related characterized eukarotic proteins are RNA helicases associated with pre-mRNA processing. Length = 1283 Score = 24.3 bits (53), Expect = 6.4 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 10/48 (20%) Query: 53 RFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYSLNLSRSDEIIL 100 RF ++ N VKLM+DG L + ++ R+ LSR D II+ Sbjct: 148 RFHDQVSSNTL-----VKLMTDGILLAET--QQDRF---LSRYDTIII 185 >gnl|CDD|183703 PRK12724, PRK12724, flagellar biosynthesis regulator FlhF; Provisional. Length = 432 Score = 24.2 bits (52), Expect = 7.2 Identities = 15/58 (25%), Positives = 31/58 (53%), Gaps = 6/58 (10%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKDLLDEKARYS 89 +V + G+ L K +IE + + E + +R ++ERK++ + K+LL +K+ Sbjct: 33 VVTEGGVMGTGLLAKKMIEIQIGIPEKQASREKIERKLQDL------KELLKQKSYTE 84 >gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional. Length = 880 Score = 24.3 bits (53), Expect = 7.3 Identities = 13/43 (30%), Positives = 26/43 (60%) Query: 38 LKANKSLEKSLIERERFLSELKENRSRLERKVKLMSDGSLEKD 80 L+ + L+K L E E+ L EL+E + L ++++ + S+E+ Sbjct: 548 LEKLEELKKKLAELEKKLDELEEELAELLKELEELGFESVEEL 590 >gnl|CDD|182127 PRK09874, PRK09874, drug efflux system protein MdtG; Provisional. Length = 408 Score = 24.1 bits (52), Expect = 7.9 Identities = 11/19 (57%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Query: 9 NHFFRAIFLVIAFCCVVYF 27 N+ FRA+FLV A VV F Sbjct: 373 NYGFRAVFLVTA--GVVLF 389 >gnl|CDD|185395 PTZ00009, PTZ00009, heat shock 70 kDa protein; Provisional. Length = 653 Score = 24.0 bits (52), Expect = 9.0 Identities = 12/40 (30%), Positives = 22/40 (55%) Query: 32 IVGDYGLKANKSLEKSLIERERFLSELKENRSRLERKVKL 71 I D G + +++ + E E++ +E + NR R+E K L Sbjct: 505 ITNDKGRLSKADIDRMVNEAEKYKAEDEANRERVEAKNGL 544 >gnl|CDD|184382 PRK13902, alaS, alanyl-tRNA synthetase; Provisional. Length = 900 Score = 24.0 bits (53), Expect = 9.2 Identities = 9/33 (27%), Positives = 16/33 (48%) Query: 52 ERFLSELKENRSRLERKVKLMSDGSLEKDLLDE 84 ERF E KE + +E+ K +++ + L Sbjct: 764 ERFFEEWKEQKKEIEKLRKELAELLASELLSKA 796 >gnl|CDD|151413 pfam10966, DUF2768, Protein of unknown function (DUF2768). This family of proteins with unknown function appear to be restricted to Bacillus spp. Length = 58 Score = 23.8 bits (52), Expect = 9.7 Identities = 6/23 (26%), Positives = 14/23 (60%) Query: 3 TKYYKKNHFFRAIFLVIAFCCVV 25 ++Y KN F + I ++A+ ++ Sbjct: 22 SRYKLKNKFLKFIVALVAYILML 44 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.324 0.139 0.401 Gapped Lambda K H 0.267 0.0734 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,689,913 Number of extensions: 94221 Number of successful extensions: 395 Number of sequences better than 10.0: 1 Number of HSP's gapped: 392 Number of HSP's successfully gapped: 62 Length of query: 105 Length of database: 5,994,473 Length adjustment: 72 Effective length of query: 33 Effective length of database: 4,438,697 Effective search space: 146477001 Effective search space used: 146477001 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 50 (23.0 bits)