>cd07036 TPP_PYR_E1-PDHc-beta_like Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins. Thiamine pyrophosphate (TPP) family, pyrimidine (PYR) binding domain of the beta subunits of the E1 components of: human pyruvate dehydrogenase complex (E1- PDHc), the acetoin dehydrogenase complex (ADC), and the branched chain alpha-keto acid dehydrogenase/2-oxoisovalerate dehydrogenase complex (BCADC), subfamily. The PYR domain is found in many key metabolic enzymes which use TPP (also known as thiamine diphosphate) as a cofactor. TPP binds in the cleft formed by a PYR domain and a PP domain. The PYR domain, binds the aminopyrimidine ring of TPP, the PP domain binds the diphosphate residue. A polar interaction between the conserved glutamate of the PYR domain and the N1' of the TPP aminopyrimidine ring is shared by most TPP-dependent enzymes, and participates in the activation of TPP. The PYR and PP domain

Probab=100.00 E-value=0 Score=393.82 Aligned_cols=167 Identities=59% Similarity=0.992 Sum_probs=164.7 Q ss_pred HHHHHHHHHHHCCCCCEEEEECCCCCCCCCCCCCCCHHHHCCCCCEECCCCCHHHHHHHHHHHHHCCCCCHHHHHHHHHH Q ss_conf 01223554431136506999324344588665323647540811101166662789989999887188644566666789 Q gi|254780673|r 144 EALRDAIAEEMRRDKDVFIMGEEVAEYQGAYKVTQGLLQEFGCERVIDTPITEHGFAGIGIGASFAGLKPIVEFMTFNFA 223 (467) Q Consensus 144 ea~~~a~~e~m~~d~~~~~~gedv~~~~g~f~~t~gl~~~fg~~R~~d~pi~E~~~~G~a~G~A~~G~~Piv~~~~~~f~ 223 (467) T Consensus 1 eAi~~al~~~~~~d~~v~~~g~dv~~~~g~~~~t~gl~~~fgp~R~~d~gIaE~~~vg~a~GlAl~G~~Pvv~~~~~~Fl 80 (167) T cd07036 1 QAINEALDEEMERDPRVVVLGEDVGDYGGVFKVTKGLLDKFGPDRVIDTPIAEAGIVGLAVGAAMNGLRPIVEIMFADFA 80 (167) T ss_pred CHHHHHHHHHHHHCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHCCCEEEEEEEEHHHH T ss_conf 97999999999769899999578374778057747999985766323799688999999999998599379886225554 Q ss_pred HHHHHHHHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCHHHHHHHHHHHHHHCCCEEEEEECCHHCCCHHHHHHHCCCC Q ss_conf 99999999878867421177678887998302445764444332168876322031386652210001055565413783 Q gi|254780673|r 224 MQAIDQIINSAAKTRYMSGGQITTSIVFRGPNGAAARVAAQHSQCYAAWYSHVPGLKVVIPYTASDAKGLLKAAIRDPNP 303 (467) Q Consensus 224 ~~a~dqi~n~~ak~~~~~gg~~~~p~v~r~p~G~~~~~g~~Hs~~~~~~~~~iPgl~V~~P~~~~d~~~ll~~ai~~~~P 303 (467) T Consensus 81 ~~a~dQi~n~~a~~~~~s~g~~~~pvvir~~~g~~~~~g~~Hs~~~~a~~~~iPgl~V~~Ps~~~d~~~ll~~a~~~~~P 160 (167) T cd07036 81 LPAFDQIVNEAAKLRYMSGGQFKVPIVIRGPNGGGIGGGAQHSQSLEAWFAHIPGLKVVAPSTPYDAKGLLKAAIRDDDP 160 (167) T ss_pred HHHHHHHHHHHHHHEECCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHCCCCCCEEEEECCHHHHHHHHHHHHHCCCC T ss_conf 00599999775676120389405888999606677674530036879998079996899729999999999999839997 Q ss_pred EEEECCC Q ss_conf 4764021 Q gi|254780673|r 304 VIFLENE 310 (467) Q Consensus 304 vi~le~~ 310 (467) T Consensus 161 v~~~E~k 167 (167) T cd07036 161 VIFLEHK 167 (167) T ss_pred EEEEECC T ss_conf 8999339

HHsearch alignment for GI: 254780673 and conserved domain: cd07036