254780674

254780674

pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase

GeneID in NCBI database:8209678Locus tag:CLIBASIA_02805
Protein GI in NCBI database:254780674Protein Accession:YP_003065087.1
Gene range:-(593175, 594446)Protein Length:423aa
Gene description:pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
COG prediction:[C] Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes
KEGG prediction:pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; K00627 pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
SEED prediction:Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (EC 2.3.1.12)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Subsystem involved in SEED:Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate;
Lipoic acid metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420---
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
cccEEEEcccccccccEEEEEEEEcccccEEccccEEEEEEcccEEEEEEcccccEEEEEEccccccccccccEEEEEEccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccHHHcccccccccEEHHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccHHHHHHHHHHHHHHcccEEEEEEEEEHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccEEEEEEcccEEEcccccEEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHcccccHHHHcccEEEEEEccccccEEEEcccccccEEEEEEcccEEEEEEEccEEEEEEEEEEEEEEEccEEEHHHHHHHHHHHHHHHHcHHHHHc
cccEEEEccccccccccccEEEEEccccccccccccEEEEcccEEEEEEcccccccHHHHEccccccEEEEcEEEEEEccccccccccccccccccccccccccccHHHHHHHccccccccccHHHHHHHHHccccHHHcccccccccEEHHHHHHHHHccccccccccccccHcccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHcccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccccEEEcccccEEEcEEEccEEEccEEccHHHccHHHHHHHHHHHHHHHHcccccHHHHccccEEEEEccccccccccccccccccEEEEEcccEEEEEEccccEEEEEEEEEEEEEEcccccHHHHHHHHHHHHHHHccHHHHcc
mmihtitmpslsptmteGKLAKWIKqegdkispgdilceietDKAIMefesvdegiideilvpagteniavnspilnilmdsteippspplskenIVEVREehshsspvvvrekhsknrpiasPLARRLAgehgidlsslsgsgphgrivKSDIETLISTktnvkdystiqsfglvdesIDANILNlfakdsyeviphdnirKTIACRLQqskqtiphfyVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQvpeanvswtTNAMIRHKHIDISVavsipggivtpiirqadqKSILDISLEVKQLAQRAKQrklkpeeyqggttsisnmgmlginsfcavinppqstilaIGAGEKKVVFQNEEIKVATIMNAtlsadhrsvDGAIASKLLAKFKEYIENPVWMLM
mmihtitmpslsptmTEGKLAKWIKqegdkispgdILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEhshsspvvvrekhsknrpiASPLARRLAGEHGidlsslsgsgphgrIVKSDIETLIstktnvkdySTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRakqrklkpeeyqggttsISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNatlsadhrsvDGAIASKLLAKFKEYIENPVWMLM
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMD*******************************************LARRLAGEHGIDLSSLSGSGPHGRIVKSDIET**************************************VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ*HREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIV*********************RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQ***************QGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
**IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILM****************************************IASPLARRLA**HGIDLSSLSGSGPHGRIVKSDIETLIST**********************************VIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
hhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNxxxxxxxxxxxxxxxxxxxxxISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM
MMIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYIENPVWMLM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

IdentityAlignment graphLength Definition E-value
Target423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
254781052436 dihydrolipoamide succinyltransferase [Candidatus L 4e-38
254780673467 pyruvate dehydrogenase subunit beta [Candidatus Li 5e-25
254780725427 response regulator receiver protein [Candidatus Li 0.033
>gi|254781052|ref|YP_003065465.1| dihydrolipoamide succinyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 436 Back     alignment 
 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 120/433 (27%), Positives = 204/433 (47%), Gaps = 28/433 (6%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M   I +PSL  ++ E  +  W+K+ G+ +  G+IL E+ETDK  +E  S   G + E+ 
Sbjct: 19  MATKILVPSLGESVNEATVGTWLKEIGESVEIGEILVELETDKVTVEVPSPVSGKLHEMS 78

Query: 62  VPAG--TENIAVNSPILNILMDSTE-IPPSPPLSKENIVEVREEHSHSSPVVVREKHSKN 118
           V  G           I+ I  D  E I  + P S  N +    +     P          
Sbjct: 79  VAKGDTVTYGGFLGYIVEIARDEDESIKQNSPNSTANGLPEITDQGFQMP---------- 128

Query: 119 RPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSF--GLV 176
               SP A +L  E G+  S + G+G  G+I+KSD+   IS   +  D ST+ S   G+ 
Sbjct: 129 ---HSPSASKLIAESGLSPSDIKGTGKRGQILKSDVMAAISRSESSVDQSTVDSHKKGVF 185

Query: 177 DESIDANILNLFAKDSYEV------IPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
              I++   N+F K S         +    +R+T+A RL+ ++ T        + N+  +
Sbjct: 186 SRIINS-ASNIFEKSSVSEELSEERVKMSRLRQTVAKRLKDAQNTAAILSTYNEVNMSRI 244

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDIS 290
           +S+R   +R      ++   K+       KA +  + ++   N     + ++   +  I 
Sbjct: 245 ISIR---SRYKDIFEKKHGIKLGFMGFFTKAASHVLQEIKGVNAEIDGDHIVYKNYCHIG 301

Query: 291 VAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLG 350
           VAV    G+V P+IR AD+ +I++I  E+ +L + A+   L   + Q GT +ISN G+ G
Sbjct: 302 VAVGTDKGLVVPVIRHADKMNIVEIEREIARLGREARAGHLSMRDLQNGTFTISNGGVYG 361

Query: 351 INSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAK 410
                 ++NPPQS IL +   +++ + ++ +I +  +M   LS DHR VDG  A   L +
Sbjct: 362 SLLSSPILNPPQSGILGMHKIQERPIVEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVR 421

Query: 411 FKEYIENPVWMLM 423
            KE +E+P   ++
Sbjct: 422 LKELLEDPERFIL 434
>gi|254780673|ref|YP_003065086.1| pyruvate dehydrogenase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 467 Back     alignment 
 Score =  107 bits (266), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 49/77 (63%), Positives = 61/77 (79%)

Query: 6  ITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAG 65
          +TMPSLSPTMTEG +AKW K EGD I  GDI+ E+ETDKA+ME ES+DEGI+ +IL P G
Sbjct: 5  VTMPSLSPTMTEGNIAKWKKNEGDLIKQGDIIYEVETDKAVMEVESIDEGILGKILCPNG 64

Query: 66 TENIAVNSPILNILMDS 82
          T+N+ VN+PI  IL + 
Sbjct: 65 TKNVKVNTPIAAILQEG 81
>gi|254780725|ref|YP_003065138.1| response regulator receiver protein [Candidatus Liberibacter asiaticus str. psy62] Length = 427 Back     alignment 
 Score = 31.2 bits (69), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 54/125 (43%), Gaps = 17/125 (13%)

Query: 173 FGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLS 232
           +G  + + D + +N  +   Y   P   I K    RL       P FY     N+ ++L+
Sbjct: 203 YGTANINFDKDPINSISDAIY---PVGRIDKAFVSRL-------PVFYAE---NL-SILT 248

Query: 233 LREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVA 292
               ++RT  F  + I   + V DI+ + F L ++ VP    SWT   +     + I+ +
Sbjct: 249 APAMLSRTYDFDEKMI---VPVLDILEQIFPLVILDVPHVWNSWTQEVLTLSDKVVITTS 305

Query: 293 VSIPG 297
           + + G
Sbjct: 306 LDLAG 310

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
315122215428 pyruvate dehydrogenase complex dihydrolipoamide acetylt 1 1e-175
222148558444 pyruvate dehydrogenase complex dihydrolipoamide acetylt 1 1e-124
325292762456 dihydrolipoamide acetyltransferase [Agrobacterium sp. H 1 1e-123
254714201420 branched-chain alpha-keto acid dehydrogenase subunit E2 1 1e-122
15965200447 dihydrolipoamide S-acetyltransferase protein [Sinorhizo 1 1e-122
110633980452 branched-chain alpha-keto acid dehydrogenase subunit E2 1 1e-121
319783390471 pyruvate dehydrogenase complex dihydrolipoamide acetylt 1 1e-121
227821849447 dihydrolipoyllysine-residue acetyltransferase component 1 1e-120
239832016444 pyruvate dehydrogenase complex dihydrolipoamide acetylt 1 1e-120
306843992447 pyruvate dehydrogenase complex dihydrolipoamide acetylt 1 1e-120
>gi|315122215|ref|YP_004062704.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 428 Back     alignment and organism information
 Score =  620 bits (1598), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 310/428 (72%), Positives = 359/428 (83%), Gaps = 6/428 (1%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           MI+TITMPSLSPTM  GKLAKW+ ++GDKI PGDI+CEIETDKAIMEFESVDEG++ EIL
Sbjct: 1   MINTITMPSLSPTMKTGKLAKWLVKKGDKIYPGDIICEIETDKAIMEFESVDEGVVHEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHS--SPVVVREKH--SK 117
              GTENI VNSPILNIL+D     P+P L ++N VE+ +E S    S     EK    +
Sbjct: 61  TSEGTENIKVNSPILNILIDCDGGAPAPILPEKNFVEIEKESSDPAISSFAPTEKKVCGQ 120

Query: 118 NRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTIQSFGL-- 175
           + P +SPLARRLA E+GIDLSS+SGSGP GRIVK+DIE LI   T VK  ST QS  +  
Sbjct: 121 DFPASSPLARRLAKENGIDLSSVSGSGPRGRIVKNDIEQLILHNTGVKHASTAQSASIES 180

Query: 176 VDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLRE 235
           ++ S+D +I+ LFA +SYE+IPHDN+RKTIA RLQQSKQTIPHFYVSIDCNIDNLLSLR+
Sbjct: 181 MNSSVDDDIMRLFAPNSYEIIPHDNMRKTIASRLQQSKQTIPHFYVSIDCNIDNLLSLRQ 240

Query: 236 QMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTNAMIRHKHIDISVAVSI 295
           QMN   Q +++E  NKISVND+ILKAF+LAM+QVPEANVSWTTNA+IRHK+IDISVAVSI
Sbjct: 241 QMNLFAQSNKKENINKISVNDVILKAFSLAMLQVPEANVSWTTNALIRHKNIDISVAVSI 300

Query: 296 PGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFC 355
           PGG+VTPI+RQ ++KSI DISLEVKQL QRAKQRKLKP+EYQGGTTS+SNMGM GI++FC
Sbjct: 301 PGGLVTPIVRQVNKKSISDISLEVKQLVQRAKQRKLKPQEYQGGTTSVSNMGMFGISNFC 360

Query: 356 AVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFKEYI 415
           AVINPPQSTILAIGAG +K +FQN  IKV TIMNATLSADHRSVDGA+ASKLLAKFKEYI
Sbjct: 361 AVINPPQSTILAIGAGVQKPIFQNGAIKVVTIMNATLSADHRSVDGAVASKLLAKFKEYI 420

Query: 416 ENPVWMLM 423
           ENP WML+
Sbjct: 421 ENPAWMLL 428



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222148558|ref|YP_002549515.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Agrobacterium vitis S4] Length = 444 Back     alignment and organism information
>gi|325292762|ref|YP_004278626.1| dihydrolipoamide acetyltransferase [Agrobacterium sp. H13-3] Length = 456 Back     alignment and organism information
>gi|254714201|ref|ZP_05176012.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Brucella ceti M644/93/1] Length = 420 Back     alignment and organism information
>gi|15965200|ref|NP_385553.1| dihydrolipoamide S-acetyltransferase protein [Sinorhizobium meliloti 1021] Length = 447 Back     alignment and organism information
>gi|110633980|ref|YP_674188.1| branched-chain alpha-keto acid dehydrogenase subunit E2 [Mesorhizobium sp. BNC1] Length = 452 Back     alignment and organism information
>gi|319783390|ref|YP_004142866.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 471 Back     alignment and organism information
>gi|227821849|ref|YP_002825819.1| dihydrolipoyllysine-residue acetyltransferase component of pyruvatedehydrogenase complex [Sinorhizobium fredii NGR234] Length = 447 Back     alignment and organism information
>gi|239832016|ref|ZP_04680345.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Ochrobactrum intermedium LMG 3301] Length = 444 Back     alignment and organism information
>gi|306843992|ref|ZP_07476587.1| pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase [Brucella sp. BO1] Length = 447 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
TIGR01349435 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase compl 1e-137
PRK11856411 PRK11856, PRK11856, branched-chain alpha-keto acid dehy 1e-133
PLN02744539 PLN02744, PLN02744, dihydrolipoyllysine-residue acetylt 1e-107
COG0508404 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase co 1e-96
PRK11855547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 1e-65
TIGR01347403 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex d 1e-56
PRK05704407 PRK05704, PRK05704, dihydrolipoamide succinyltransferas 5e-54
PRK11854633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 2e-51
PLN02528416 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 c 8e-51
PTZ00144418 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferas 3e-47
KOG0558474 KOG0558, KOG0558, KOG0558, Dihydrolipoamide transacylas 5e-47
TIGR01348546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase compl 2e-45
KOG0559457 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltra 4e-40
TIGR02927590 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E 5e-35
KOG0557470 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltrans 1e-106
pfam00198231 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acylt 7e-79
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 com 2e-22
PRK14843347 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; 7e-46
PRK11857306 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; 9e-33
PRK11892464 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta 2e-35
cd0684974 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolip 1e-21
pfam0036473 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme 2e-12
cd0666373 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domai 3e-11
PRK11855 547 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; 1e-08
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 2e-06
PLN02226463 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 com 4e-05
cd0685067 cd06850, biotinyl_domain, The biotinyl-domain or biotin 4e-04
PRK11854 633 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltra 9e-04
COG0511140 COG0511, AccB, Biotin carboxyl carrier protein [Lipid m 0.002
TIGR01348 546 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase compl 0.002
PRK14875371 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit di 8e-21
pfam0281739 pfam02817, E3_binding, e3 binding domain 4e-13
PRK12270 1228 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Revie 2e-10
TIGR02927 590 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E 5e-06
>gnl|CDD|162311 TIGR01349, PDHac_trf_mito, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|183339 PRK11856, PRK11856, branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>gnl|CDD|178345 PLN02744, PLN02744, dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex Back     alignment and domain information
>gnl|CDD|30854 COG0508, AceF, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|162309 TIGR01347, sucB, 2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (E2 component) Back     alignment and domain information
>gnl|CDD|180214 PRK05704, PRK05704, dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|178143 PLN02528, PLN02528, 2-oxoisovalerate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|185477 PTZ00144, PTZ00144, dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|35778 KOG0558, KOG0558, KOG0558, Dihydrolipoamide transacylase (alpha-keto acid dehydrogenase E2 subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|35779 KOG0559, KOG0559, KOG0559, Dihydrolipoamide succinyltransferase (2-oxoglutarate dehydrogenase, E2 subunit) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>gnl|CDD|35777 KOG0557, KOG0557, KOG0557, Dihydrolipoamide acetyltransferase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143956 pfam00198, 2-oxoacid_dh, 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|184847 PRK14843, PRK14843, dihydrolipoamide acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183340 PRK11857, PRK11857, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183363 PRK11892, PRK11892, pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|133458 cd06849, lipoyl_domain, Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>gnl|CDD|144088 pfam00364, Biotin_lipoyl, Biotin-requiring enzyme Back     alignment and domain information
>gnl|CDD|133456 cd06663, Biotinyl_lipoyl_domains, Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>gnl|CDD|183338 PRK11855, PRK11855, dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|177871 PLN02226, PLN02226, 2-oxoglutarate dehydrogenase E2 component Back     alignment and domain information
>gnl|CDD|133459 cd06850, biotinyl_domain, The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>gnl|CDD|183337 PRK11854, aceF, pyruvate dehydrogenase dihydrolipoyltransacetylase; Validated Back     alignment and domain information
>gnl|CDD|30857 COG0511, AccB, Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|162310 TIGR01348, PDHac_trf_long, pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form Back     alignment and domain information
>gnl|CDD|184875 PRK14875, PRK14875, acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|111687 pfam02817, E3_binding, e3 binding domain Back     alignment and domain information
>gnl|CDD|183391 PRK12270, kgd, alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>gnl|CDD|131973 TIGR02927, SucB_Actino, 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 100.0
PRK05704406 dihydrolipoamide succinyltransferase; Validated 100.0
TIGR01349584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 100.0
TIGR01347435 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydr 100.0
TIGR01348655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 100.0
TIGR02927607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 100.0
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 100.0
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 100.0
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 100.0
KOG0557470 consensus 100.0
KOG0558474 consensus 100.0
KOG0559457 consensus 100.0
PRK11854630 aceF dihydrolipoamide acetyltransferase; Validated 100.0
PRK11857316 dihydrolipoamide acetyltransferase; Reviewed 100.0
pfam00198231 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase ( 100.0
PRK12270 1234 kgd alpha-ketoglutarate decarboxylase; Reviewed 100.0
PRK13757219 chloramphenicol acetyltransferase; Provisional 99.38
pfam00302206 CAT Chloramphenicol acetyltransferase. 99.19
COG4845219 Chloramphenicol O-acetyltransferase [Defense mechanisms 98.65
TIGR02927 607 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, 99.94
PRK11855549 dihydrolipoamide acetyltransferase; Reviewed 99.93
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 99.93
PRK11854 630 aceF dihydrolipoamide acetyltransferase; Validated 99.92
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 99.84
TIGR01348 655 PDHac_trf_long pyruvate dehydrogenase complex dihydroli 99.83
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 99.82
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 99.78
TIGR01349584 PDHac_trf_mito pyruvate dehydrogenase complex dihydroli 99.76
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 99.39
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.22
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 99.17
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.16
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 99.1
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 99.08
PRK0705180 hypothetical protein; Validated 98.89
PRK06302155 acetyl-CoA carboxylase biotin carboxyl carrier protein 98.8
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 98.76
TIGR027121226 urea_carbox urea carboxylase; InterPro: IPR014084 Membe 98.69
TIGR012351169 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 98.46
KOG0368 2196 consensus 98.08
PRK11578347 macrolide transporter subunit MacA; Provisional 97.87
PRK03598331 hypothetical protein; Provisional 97.73
TIGR03077110 not_gcvH glycine cleavage protein H homolog, Chlamydial 97.42
PRK00624113 glycine cleavage system protein H; Provisional 97.34
cd0684896 GCS_H Glycine cleavage H-protein. Glycine cleavage H-pr 97.31
PRK09578385 periplasmic multidrug efflux lipoprotein precursor; Rev 97.15
COG0509131 GcvH Glycine cleavage system H protein (lipoate-binding 97.12
PRK13380132 glycine cleavage system protein H; Provisional 97.08
PRK01202127 glycine cleavage system protein H; Provisional 97.07
pfam01597122 GCV_H Glycine cleavage H-protein. This is a family of g 97.05
TIGR00531159 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier pr 96.78
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 96.65
pfam05896257 NQRA Na(+)-translocating NADH-quinone reductase subunit 96.56
TIGR00527132 gcvH glycine cleavage system H protein; InterPro: IPR00 95.91
TIGR03309256 matur_yqeB selenium-dependent molybdenum hydroxylase sy 94.66
PRK0674884 hypothetical protein; Validated 94.25
PRK1278484 hypothetical protein; Provisional 93.75
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 93.67
KOG3373172 consensus 92.7
COG1726447 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, s 92.2
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 91.52
TIGR01936466 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocatin 90.29
PRK05035 725 electron transport complex protein RnfC; Provisional 90.14
PRK12999 1147 pyruvate carboxylase; Reviewed 99.0
pfam0281739 E3_binding e3 binding domain. This family represents a 98.91
COG1038 1149 PycA Pyruvate carboxylase [Energy production and conver 98.27
cd06253298 M14_ASTE_ASPA_like_3 A functionally uncharacterized sub 96.41
cd06255293 M14_ASTE_ASPA_like_5 A functionally uncharacterized sub 91.86
PRK10476348 multidrug resistance protein MdtN; Provisional 97.65
PRK11556415 multidrug efflux system subunit MdtA; Provisional 97.59
PRK10559310 p-hydroxybenzoic acid efflux subunit AaeA; Provisional 97.54
PRK09859385 multidrug efflux system protein MdtE; Provisional 97.28
PRK09783407 copper/silver efflux system membrane fusion protein Cus 96.78
cd06250359 M14_PaAOTO_like An uncharacterized subgroup of the Succ 96.12
pfam00529304 HlyD HlyD family secretion protein. 95.69
cd0685067 biotinyl_domain The biotinyl-domain or biotin carboxyl 95.28
PRK11892464 pyruvate dehydrogenase subunit beta; Provisional 95.02
TIGR01843434 type_I_hlyD type I secretion membrane fusion protein, H 95.01
PRK0822570 acetyl-CoA carboxylase biotin carboxyl carrier protein 95.0
COG0511140 AccB Biotin carboxyl carrier protein [Lipid metabolism] 94.85
PRK0588971 putative acetyl-CoA carboxylase biotin carboxyl carrier 93.99
COG0508404 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dih 93.57
PRK06549132 acetyl-CoA carboxylase biotin carboxyl carrier protein 92.78
PRK05641148 putative acetyl-CoA carboxylase biotin carboxyl carrier 92.64
TIGR00998379 8a0101 efflux pump membrane protein; InterPro: IPR00569 92.47
cd0666373 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are pre 92.4
PRK12999 1147 pyruvate carboxylase; Reviewed 92.23
cd0684974 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltr 91.95
PRK09282580 pyruvate carboxylase subunit B; Validated 91.36
KOG0238670 consensus 97.36
TIGR02645499 ARCH_P_rylase putative thymidine phosphorylase; InterPr 92.24
PTZ00144430 dihydrolipoamide succinyltransferase; Provisional 95.74
PRK05704406 dihydrolipoamide succinyltransferase; Validated 95.46
PRK0705180 hypothetical protein; Validated 95.04
PRK03598331 hypothetical protein; Provisional 94.62
KOG0559457 consensus 94.2
PRK11856324 branched-chain alpha-keto acid dehydrogenase subunit E2 94.2
pfam00529304 HlyD HlyD family secretion protein. 93.89
PRK10476348 multidrug resistance protein MdtN; Provisional 92.53
PRK11556415 multidrug efflux system subunit MdtA; Provisional 92.13
PRK11578347 macrolide transporter subunit MacA; Provisional 91.45
pfam07247479 AATase Alcohol acetyltransferase. This family contains 95.16
TIGR01108616 oadA oxaloacetate decarboxylase alpha subunit; InterPro 94.07
pfam0036473 Biotin_lipoyl Biotin-requiring enzyme. This family cove 90.55
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>TIGR01347 sucB 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR006255 These sequences describe the TCA cycle 2-oxoglutarate system E2 component, dihydrolipoamide succinyltransferase Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>KOG0557 consensus Back     alignment and domain information
>KOG0558 consensus Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>PRK11857 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>pfam00198 2-oxoacid_dh 2-oxoacid dehydrogenases acyltransferase (catalytic domain) Back     alignment and domain information
>PRK12270 kgd alpha-ketoglutarate decarboxylase; Reviewed Back     alignment and domain information
>PRK13757 chloramphenicol acetyltransferase; Provisional Back     alignment and domain information
>pfam00302 CAT Chloramphenicol acetyltransferase Back     alignment and domain information
>COG4845 Chloramphenicol O-acetyltransferase [Defense mechanisms] Back     alignment and domain information
>TIGR02927 SucB_Actino 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase; InterPro: IPR014276 This entry represents the mainly actinobacterial clade of the E2 component of the 2-oxoglutarate dehydrogenase complex involved in the TCA cycle Back     alignment and domain information
>PRK11855 dihydrolipoamide acetyltransferase; Reviewed Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>PRK11854 aceF dihydrolipoamide acetyltransferase; Validated Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>TIGR01348 PDHac_trf_long pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006256 This group of sequences are a subset of pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase specifically close by both phylogenetic and percent identity (UPGMA) trees Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information
>TIGR01349 PDHac_trf_mito pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase; InterPro: IPR006257 This group of sequences represent one of several closely related clades of the dihydrolipoamide acetyltransferase subunit of the pyruvate dehydrogenase complex Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK06302 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase; InterPro: IPR014084 Members of this family are ATP-dependent urea carboxylases, including characterised members from Oleomonas sagaranensis (alpha class Proteobacterium) and yeasts such as Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase; InterPro: IPR005930 In the postabsorptive state, blood glucose concentration is kept constant by a combination of glycogenolysis and gluconeogenesis Back     alignment and domain information
>KOG0368 consensus Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03077 not_gcvH glycine cleavage protein H homolog, Chlamydial Back     alignment and domain information
>PRK00624 glycine cleavage system protein H; Provisional Back     alignment and domain information
>cd06848 GCS_H Glycine cleavage H-protein Back     alignment and domain information
>PRK09578 periplasmic multidrug efflux lipoprotein precursor; Reviewed Back     alignment and domain information
>COG0509 GcvH Glycine cleavage system H protein (lipoate-binding) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13380 glycine cleavage system protein H; Provisional Back     alignment and domain information
>PRK01202 glycine cleavage system protein H; Provisional Back     alignment and domain information
>pfam01597 GCV_H Glycine cleavage H-protein Back     alignment and domain information
>TIGR00531 BCCP acetyl-CoA carboxylase, biotin carboxyl carrier protein; InterPro: IPR001249 The proteins in this family are a component of the acetyl coenzyme A carboxylase complex (6 Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>TIGR00527 gcvH glycine cleavage system H protein; InterPro: IPR002930 This is a family of glycine cleavage H-proteins, part of the glycine cleavage multienzyme complex (GCV) found in bacteria and the mitochondria of eukaryotes Back     alignment and domain information
>TIGR03309 matur_yqeB selenium-dependent molybdenum hydroxylase system protein, YqeB family Back     alignment and domain information
>PRK06748 hypothetical protein; Validated Back     alignment and domain information
>PRK12784 hypothetical protein; Provisional Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>KOG3373 consensus Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit; InterPro: IPR008703 This family consists of several bacterial Na^+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>pfam02817 E3_binding e3 binding domain Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>cd06253 M14_ASTE_ASPA_like_3 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>cd06255 M14_ASTE_ASPA_like_5 A functionally uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the M14 family of metallocarboxypeptidases Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK10559 p-hydroxybenzoic acid efflux subunit AaeA; Provisional Back     alignment and domain information
>PRK09859 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional Back     alignment and domain information
>cd06250 M14_PaAOTO_like An uncharacterized subgroup of the Succinylglutamate desuccinylase (ASTE)/aspartoacylase (ASPA) subfamily which is part of the the M14 family of metallocarboxypeptidases Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>cd06850 biotinyl_domain The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase, oxaloacetate decarboxylase, methylmalonyl-CoA decarboxylase, transcarboxylase and urea amidolyase Back     alignment and domain information
>PRK11892 pyruvate dehydrogenase subunit beta; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family; InterPro: IPR010129 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK08225 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>COG0511 AccB Biotin carboxyl carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK05889 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Provisional Back     alignment and domain information
>COG0508 AceF Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PRK06549 acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>PRK05641 putative acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein; InterPro: IPR005694 emrA and emrB confer resistance to carbonylcyanide m-chlorophenylhydrazone, nalidixic acid, and a number of other toxic compounds Back     alignment and domain information
>cd06663 Biotinyl_lipoyl_domains Biotinyl_lipoyl_domains are present in biotin-dependent carboxylases/decarboxylases, the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases, and the H-protein of the glycine cleavage system (GCS) Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>cd06849 lipoyl_domain Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases Back     alignment and domain information
>PRK09282 pyruvate carboxylase subunit B; Validated Back     alignment and domain information
>KOG0238 consensus Back     alignment and domain information
>TIGR02645 ARCH_P_rylase putative thymidine phosphorylase; InterPro: IPR013466 Proteins in this entry are closely related to characterised examples of thymidine phosphorylase (2 Back     alignment and domain information
>PTZ00144 dihydrolipoamide succinyltransferase; Provisional Back     alignment and domain information
>PRK05704 dihydrolipoamide succinyltransferase; Validated Back     alignment and domain information
>PRK07051 hypothetical protein; Validated Back     alignment and domain information
>PRK03598 hypothetical protein; Provisional Back     alignment and domain information
>KOG0559 consensus Back     alignment and domain information
>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed Back     alignment and domain information
>pfam00529 HlyD HlyD family secretion protein Back     alignment and domain information
>PRK10476 multidrug resistance protein MdtN; Provisional Back     alignment and domain information
>PRK11556 multidrug efflux system subunit MdtA; Provisional Back     alignment and domain information
>PRK11578 macrolide transporter subunit MacA; Provisional Back     alignment and domain information
>pfam07247 AATase Alcohol acetyltransferase Back     alignment and domain information
>TIGR01108 oadA oxaloacetate decarboxylase alpha subunit; InterPro: IPR005776 This family describes the bacterial oxaloacetate decarboxylase alpha subunit and its equivalents in archaea Back     alignment and domain information
>pfam00364 Biotin_lipoyl Biotin-requiring enzyme Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

Original result of PSI-BLAST

IdentityAlignment graphLength Definition E-value
Target423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
3duf_I428 Snapshots Of Catalysis In The E1 Subunit Of The Pyr 1e-74
1c4t_A233 Catalytic Domain From Trimeric Dihydrolipoamide Suc 4e-47
1b5s_A242 Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalyt 1e-41
3b8k_A239 Structure Of The Truncated Human Dihydrolipoyl Acet 4e-40
1dpc_A243 Crystallographic And Enzymatic Investigations On Th 4e-39
1eaa_A243 Atomic Structure Of The Cubic Core Of The Pyruvate 2e-38
1dpd_A243 Crystallographic And Enzymatic Investigations On Th 7e-38
1dpb_A243 Crystallographic And Enzymatic Investigations On Th 5e-36
2ihw_A262 Crystal Structure Of A Cubic Core Of The Dihydrolip 3e-35
3mae_A256 Crystal Structure Of Probable Dihydrolipamide Acety 3e-33
3l60_A250 Crystal Structure Of Branched-Chain Alpha-Keto Acid 1e-34
1zy8_L229 The Crystal Structure Of Dihydrolipoamide Dehydroge 5e-27
2dnc_A98 Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain 2e-26
1lab_A80 Three-Dimensional Structure Of The Lipoyl Domain Fr 1e-25
1y8n_B128 Crystal Structure Of The Pdk3-L2 Complex Length = 1 8e-22
1fyc_A106 Inner Lipoyl Domain From Human Pyruvate Dehydrogena 3e-21
1pmr_A80 Lipoyl Domain From The Dihydrolipoyl Succinyltransf 4e-21
1ghj_A79 Solution Structure Of The Lipoyl Domain Of The 2- O 7e-21
2dne_A108 Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain 1e-20
1k8o_A93 Solution Structure Of The Lipoic Acid-Bearing Domai 2e-19
3crk_C87 Crystal Structure Of The Pdhk2-L2 Complex. Length = 6e-19
1qjo_A80 Innermost Lipoyl Domain Of The Pyruvate Dehydrogena 6e-18
2k7v_A85 Deletions In A Surface Loop Divert The Folding Of A 4e-16
1iyu_A79 Lipoyl Domain Of Pyruvate Dehydrogenase Complex, Nm 1e-13
1dcz_A77 Biotin Carboxyl Carrier Domain Of Transcarboxylase 2e-09
1o78_A84 Biotin Carboxyl Carrier Domain Of Transcarboxylase 3e-09
2d5d_A74 Structure Of Biotin Carboxyl Carrier Protein (74val 1e-08
1gjx_A81 Solution Structure Of The Lipoyl Domain Of The Chim 1e-08
3hbl_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 3e-06
3hb9_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 3e-06
3bg5_A1173 Crystal Structure Of Staphylococcus Aureus Pyruvate 3e-06
3ho8_A1150 Crystal Structure Of S. Aureus Pyruvate Carboxylase 3e-06
1z6h_A72 Solution Structure Of Bacillus Subtilis Blap Biotin 5e-05
2qf7_A1165 Crystal Structure Of A Complete Multifunctional Pyr 6e-05
2jku_A94 Crystal Structure Of The N-Terminal Region Of The B 2e-04
gi|219689228|pdb|3DUF|I Chain I, Snapshots Of Catalysis In The E1 Subunit Of The Pyruvate Dehydrogenase Multi-Enzyme Complex Length = 428 Back     alignment and structure 
 Score =  284 bits (727), Expect = 1e-74,   Method: Composition-based stats.
 Identities = 102/431 (23%), Positives = 182/431 (42%), Gaps = 14/431 (3%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M     +P +   + EG++ KW  + GD+++  D+LCE++ DKA++E  S  +G + EIL
Sbjct: 1   MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPI 121
           VP GT    V   ++ +     E        +E   +  +  + S    V          
Sbjct: 61  VPEGT-VATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAA 119

Query: 122 ASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETL-------ISTKTNVKDYSTIQSFG 174
            +             +   +        +              I             +  
Sbjct: 120 EAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAE 179

Query: 175 LVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLR 234
                  A       +          IR+ IA  +  SK T PH  +  + ++  L++ R
Sbjct: 180 EKAAPAAAKPATTEGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKLVAHR 239

Query: 235 EQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSWTTN--AMIRHKHIDISVA 292
           ++     +    E   K++    ++KA   A+ + P  N S       +I+  + +I +A
Sbjct: 240 KK----FKAIAAEKGIKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYNIGIA 295

Query: 293 VSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGMLGIN 352
                G++ P+I+ AD+K I  ++ E+ +LA++A+  KL P E +G + +I+N+G  G  
Sbjct: 296 ADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGSAGGQ 355

Query: 353 SFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLLAKFK 412
            F  VIN P+  IL IG   +K + ++ EI  A ++  +LS DHR +DGA A K L   K
Sbjct: 356 WFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKALNHIK 415

Query: 413 EYIENPVWMLM 423
             + +P  +LM
Sbjct: 416 RLLSDPELLLM 426
>gi|7245717|pdb|1C4T|A Chain A, Catalytic Domain From Trimeric Dihydrolipoamide Succinyltransferase Length = 233 Back     alignment and structure
>gi|4558102|pdb|1B5S|A Chain A, Dihydrolipoyl Transacetylase (E.C.2.3.1.12) Catalytic Domain (Residues 184-425) From Bacillus Stearothermophilus Length = 242 Back     alignment and structure
>gi|166007311|pdb|3B8K|A Chain A, Structure Of The Truncated Human Dihydrolipoyl Acetyltransferase (E2) Length = 239 Back     alignment and structure
>gi|157830859|pdb|1DPC|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>gi|157830909|pdb|1EAA|A Chain A, Atomic Structure Of The Cubic Core Of The Pyruvate Dehydrogenase Multienzyme Complex Length = 243 Back     alignment and structure
>gi|157830860|pdb|1DPD|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>gi|157830858|pdb|1DPB|A Chain A, Crystallographic And Enzymatic Investigations On The Role Of Ser558, His610 And Asn614 In The Catalytic Mechanism Of Azotobacter Vinelandii Dihydrolipoamide Acetyltransferase (E2p) Length = 243 Back     alignment and structure
>gi|122920622|pdb|2IHW|A Chain A, Crystal Structure Of A Cubic Core Of The Dihydrolipoamide Acyltransferase (E2b) Component In The Branched-Chain Alpha-Ketoacid Dehydrogenase Complex (Bckdc), Apo Form Length = 262 Back     alignment and structure
>gi|293652058|pdb|3MAE|A Chain A, Crystal Structure Of Probable Dihydrolipamide Acetyltransferase From Listeria Monocytogenes 4b F2365 Length = 256 Back     alignment and structure
>gi|283135430|pdb|3L60|A Chain A, Crystal Structure Of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 From Mycobacterium Tuberculosis Length = 250 Back     alignment and structure
>gi|159164247|pdb|2DNC|A Chain A, Solution Structure Of Rsgi Ruh-054, A Lipoyl Domain From Human 2-Oxoacid Dehydrogenase Length = 98 Back     alignment and structure
>gi|157831755|pdb|1LAB|A Chain A, Three-Dimensional Structure Of The Lipoyl Domain From Bacillus Stearothermophilus Pyruvate Dehydrogenase Multienzyme Complex Length = 80 Back     alignment and structure
>gi|67463894|pdb|1Y8N|B Chain B, Crystal Structure Of The Pdk3-L2 Complex Length = 128 Back     alignment and structure
>gi|159162337|pdb|1FYC|A Chain A, Inner Lipoyl Domain From Human Pyruvate Dehydrogenase (Pdh) Complex, Nmr, 1 Structure Length = 106 Back     alignment and structure
>gi|157833530|pdb|1PMR|A Chain A, Lipoyl Domain From The Dihydrolipoyl Succinyltransferase Component Of The 2-Oxoglutarate Dehydrogenase Multienzyme Complex Of Escherichia Coli, Nmr, 25 Structures Length = 80 Back     alignment and structure
>gi|159162352|pdb|1GHJ|A Chain A, Solution Structure Of The Lipoyl Domain Of The 2- Oxoglutarate Dehydrogenase Complex From Azotobacter Vineland Ii, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>gi|159164248|pdb|2DNE|A Chain A, Solution Structure Of Rsgi Ruh-058, A Lipoyl Domain Of Human 2-Oxoacid Dehydrogenase Length = 108 Back     alignment and structure
>gi|17942550|pdb|1K8O|A Chain A, Solution Structure Of The Lipoic Acid-Bearing Domain Of The E2 Component Of Human, Mitochondrial Branched-Chain Alpha- Ketoacid Dehydrogenase Length = 93 Back     alignment and structure
>gi|186973095|pdb|3CRK|C Chain C, Crystal Structure Of The Pdhk2-L2 Complex. Length = 87 Back     alignment and structure
>gi|157879777|pdb|1QJO|A Chain A, Innermost Lipoyl Domain Of The Pyruvate Dehydrogenase From Escherichia Coli Length = 80 Back     alignment and structure
>gi|258588181|pdb|2K7V|A Chain A, Deletions In A Surface Loop Divert The Folding Of A Protein Domain Into A Metastable Dimeric Form Length = 85 Back     alignment and structure
>gi|253722911|pdb|1IYU|A Chain A, Lipoyl Domain Of Pyruvate Dehydrogenase Complex, Nmr, Minimized Average Structure Length = 79 Back     alignment and structure
>gi|159162200|pdb|1DCZ|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (Tc 1.3s) Length = 77 Back     alignment and structure
>gi|159162771|pdb|1O78|A Chain A, Biotin Carboxyl Carrier Domain Of Transcarboxylase (1.3s) [10-48] Deletion Mutant Length = 84 Back     alignment and structure
>gi|99032022|pdb|2D5D|A Chain A, Structure Of Biotin Carboxyl Carrier Protein (74val Start) From Pyrococcus Horikoshi Ot3 Ligand Free Form Ii Length = 74 Back     alignment and structure
>gi|157877760|pdb|1GJX|A Chain A, Solution Structure Of The Lipoyl Domain Of The Chimeric Dihydrolipoyl Dehydrogenase P64k From Neisseria Meningitidis Length = 81 Back     alignment and structure
>gi|242556622|pdb|3HBL|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase T908a Mutant Length = 1150 Back     alignment and structure
>gi|242556615|pdb|3HB9|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase A610t Mutant Length = 1150 Back     alignment and structure
>gi|168988872|pdb|3BG5|A Chain A, Crystal Structure Of Staphylococcus Aureus Pyruvate Carboxylase Length = 1173 Back     alignment and structure
gi|242556707|pdb|3HO8|A Chain A, Crystal Structure Of S. Aureus Pyruvate Carboxylase In Complex With Coenzyme A Length = 1150 Back     alignment and structure
>gi|93278527|pdb|1Z6H|A Chain A, Solution Structure Of Bacillus Subtilis Blap Biotinylated- Form Length = 72 Back     alignment and structure
>gi|158430175|pdb|2QF7|A Chain A, Crystal Structure Of A Complete Multifunctional Pyruvate Carboxylase From Rhizobium Etli Length = 1165 Back     alignment and structure
>gi|198443038|pdb|2JKU|A Chain A, Crystal Structure Of The N-Terminal Region Of The Biotin Acceptor Domain Of Human Propionyl-Coa Carboxylase Length = 94 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

IdentityAlignment graphLength Definition E-value
Target423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 1e-102
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihydrolip 3e-58
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-dependent 1e-57
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; structura 6e-56
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, fusid 7e-46
3cla_A213 Type III chloramphenicol acetyltransferase; transferase 4e-45
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransferase; 1e-42
2i9d_A217 Chloramphenicol acetyltransferase; structural genomics, 6e-39
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltr 3e-38
2ii3_A262 Lipoamide acyltransferase component of branched- chain 5e-35
1zy8_K229 Pyruvate dehydrogenase protein X component, mitochondri 4e-28
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 2e-20
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 2e-18
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 3e-18
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 2e-17
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 2e-17
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 7e-17
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 7e-15
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 2e-13
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 2e-12
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 7e-12
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 9e-12
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 1e-09
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 2e-08
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 4e-08
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 8e-08
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 4e-07
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 5e-07
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 3e-06
1zwv_A58 Lipoamide acyltransferase component of branched- chain 6e-13
2coo_A70 Lipoamide acyltransferase component of branched- chain 5e-12
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase component 1e-11
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral-subu 7e-11
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; NMR { 2e-10
2f60_K64 Pyruvate dehydrogenase protein X component; protein-bin 2e-10
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide acetyl 5e-10
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide acetyl 5e-10
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein-prot 1e-09
>3dva_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; oxidoreductase, multienzyme complex; HET: TPW; 2.35A {Bacillus stearothermophilus} PDB: 3dv0_I* 3duf_I* 1b5s_A 1lab_A 1lac_A 1w3d_A Length = 428 Back     alignment and structure
 Score =  367 bits (943), Expect = e-102
 Identities = 116/435 (26%), Positives = 204/435 (46%), Gaps = 22/435 (5%)

Query: 2   MIHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEIL 61
           M     +P +   + EG++ KW  + GD+++  D+LCE++ DKA++E  S  +G + EIL
Sbjct: 1   MAFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEIL 60

Query: 62  VPAGTENIAVNSPILNILMDSTEIPPSPP-----------LSKENIVEVREEHSHSSPVV 110
           VP GT    V   ++ +     E                     +  E  +  + ++P  
Sbjct: 61  VPEGTV-ATVGQTLITLDAPGYENMTFKGQEQEEAKKEEKTETVSKEEKVDAVAPNAPAA 119

Query: 111 VREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKTNVKDYSTI 170
             E     R IA P  R+ A E G+D+  + G+G +GR++K DI+  ++        +  
Sbjct: 120 EAEAGPNRRVIAMPSVRKYAREKGVDIRLVQGTGKNGRVLKEDIDAFLAGGAKPAPAAAE 179

Query: 171 QSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNL 230
           +                  +          IR+ IA  +  SK T PH  +  + ++  L
Sbjct: 180 EKAAPAAAKPATT----EGEFPETREKMSGIRRAIAKAMVHSKHTAPHVTLMDEADVTKL 235

Query: 231 LSLREQMNRTLQFHREEISNKISVNDIILKAFALAMIQVPEANVSW--TTNAMIRHKHID 288
           ++ R++              K++    ++KA   A+ + P  N S    T  +I+  + +
Sbjct: 236 VAHRKKFKAIAAEKG----IKLTFLPYVVKALVSALREYPVLNTSIDDETEEIIQKHYYN 291

Query: 289 ISVAVSIPGGIVTPIIRQADQKSILDISLEVKQLAQRAKQRKLKPEEYQGGTTSISNMGM 348
           I +A     G++ P+I+ AD+K I  ++ E+ +LA++A+  KL P E +G + +I+N+G 
Sbjct: 292 IGIAADTDRGLLVPVIKHADRKPIFALAQEINELAEKARDGKLTPGEMKGASCTITNIGS 351

Query: 349 LGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDGAIASKLL 408
            G   F  VIN P+  IL IG   +K + ++ EI  A ++  +LS DHR +DGA A K L
Sbjct: 352 AGGQWFTPVINHPEVAILGIGRIAEKPIVRDGEIVAAPMLALSLSFDHRMIDGATAQKAL 411

Query: 409 AKFKEYIENPVWMLM 423
              K  + +P  +LM
Sbjct: 412 NHIKRLLSDPELLLM 426
>3mae_A 2-oxoisovalerate dehydrogenase E2 component, dihydrolipamide acetyltransferase; 2-oxoacid dehydrogenases acyltransferase; 2.50A {Listeria monocytogenes} Length = 256 Back     alignment and structure
>1scz_A E2, dihydrolipoamide succinyltransferase; COA-dependent acyltransferase, CAT-like, alpha and beta (2 layers); 2.20A {Escherichia coli K12} SCOP: c.43.1.1 PDB: 1e2o_A 1c4t_A Length = 233 Back     alignment and structure
>3l60_A Branched-chain alpha-keto acid dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.00A {Mycobacterium tuberculosis} Length = 250 Back     alignment and structure
>1q23_A Chloramphenicol acetyltransferase; CAT I, trimer, fusidic acid; HET: FUA; 2.18A {Escherichia coli} SCOP: c.43.1.1 PDB: 1noc_B 1pd5_A* Length = 219 Back     alignment and structure
>3cla_A Type III chloramphenicol acetyltransferase; transferase (acyltransferase); HET: CLM; 1.75A {Escherichia coli} SCOP: c.43.1.1 PDB: 1cla_A* 2cla_A 4cla_A* 1cia_A 1qca_A* Length = 213 Back     alignment and structure
>3b8k_A PDCE2;, dihydrolipoyllysine-residue acetyltransferase; central beta-sheet surrounded by five alpha-helices; 8.80A {Homo sapiens} Length = 239 Back     alignment and structure
>2i9d_A Chloramphenicol acetyltransferase; structural genomics, PSI- 2, protein structure initiative; 2.30A {Bacteroides thetaiotaomicron vpi-5482} Length = 217 Back     alignment and structure
>1dpb_A Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltransferase; 2.50A {Azotobacter vinelandii} SCOP: c.43.1.1 PDB: 1dpd_A 1eaa_A 1eab_A* 1eac_A* 1ead_A* 1eae_A* 1eaf_A 1dpc_A Length = 243 Back     alignment and structure
>2ii3_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; cubic core, HOMO trimer, oxidized COA-bound form; HET: CAO; 2.17A {Bos taurus} PDB: 2ihw_A* 2ii4_A* 2ii5_A* Length = 262 Back     alignment and structure
>1y8o_B Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: b.84.1.1 PDB: 1y8n_B* 1y8p_B* 2pnr_C* 2q8i_B* 1fyc_A Length = 128 Back     alignment and structure
>3crk_C Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; pyruvate dehydrogenase kinase isozyme 2, glucose metabolism; HET: LA2; 2.30A {Homo sapiens} PDB: 3crl_C* Length = 87 Back     alignment and structure
>2dne_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; lipoyl domain, lipoic acid, 2-oxoacid dehydrogenase; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1k8m_A E2 component of branched-chain ahpha-ketoacid dehydrogenase; lipoyl acid bearing, human BCKD, experimental DATA, average structure, transferase; NMR {Homo sapiens} SCOP: b.84.1.1 PDB: 1k8o_A Length = 93 Back     alignment and structure
>1pmr_A Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehydrogenase, lipoyl domain, complex, glycolysis; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>2dnc_A Pyruvate dehydrogenase protein X component; lipoic acid, lipoyl domain, 2-oxoacid dehydrogenase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 98 Back     alignment and structure
>1ghj_A E2, E2, the dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase...; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1ghk_A Length = 79 Back     alignment and structure
>1qjo_A Dihydrolipoamide acetyltransferase; lipoyl domain, pyruvate dehydrogenase; NMR {Escherichia coli} SCOP: b.84.1.1 Length = 80 Back     alignment and structure
>1iyu_A E2P, dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex; glycolysis, acyltransferase, lipoyl; NMR {Azotobacter vinelandii} SCOP: b.84.1.1 PDB: 1iyv_A Length = 79 Back     alignment and structure
>2kcc_A Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, biotinylation, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>1gjx_A Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, dihydrolipoyl dehydrogenase, multienzyme complex, post-translational modification; NMR {Neisseria meningitidis} SCOP: b.84.1.1 Length = 81 Back     alignment and structure
>2dn8_A Acetyl-COA carboxylase 2; biotin required enzyme, transcarboxylase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2k7v_A Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase...; misfolded dimer, acyltransferase, glycolysis; NMR {Escherichia coli} Length = 85 Back     alignment and structure
>2jku_A Propionyl-COA carboxylase alpha chain, mitochondrial; ligase, biotin, ATP-binding, polymorphism, disease mutation, nucleotide-binding; HET: PG4; 1.5A {Homo sapiens} Length = 94 Back     alignment and structure
>2d5d_A Methylmalonyl-COA decarboxylase gamma chain; biotin, domain, BCCP, X-RAY diffraction, structural genomics, NPPSFA; 1.55A {Pyrococcus horikoshii OT3} PDB: 2ejf_C* 2ejg_C* 2evb_A Length = 74 Back     alignment and structure
>1dcz_A Transcarboxylase 1.3S subunit; antiparallel beta sheet, hammerhead, biocytin; NMR {Propionibacterium freudenreichiisubsp} SCOP: b.84.1.1 PDB: 1dd2_A 1o78_A Length = 77 Back     alignment and structure
>1z6h_A Biotin/lipoyl attachment protein; solution structure, biosynthetic protein; HET: BTI; NMR {Bacillus subtilis} PDB: 1z7t_A 2b8f_A 2b8g_A* Length = 72 Back     alignment and structure
>2ejm_A Methylcrotonoyl-COA carboxylase subunit alpha; biotin-requiring enzyme, biotin, actyl COA carboxylase, fatty acid synthesis, structural genomics; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1zwv_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; subunit binding domain; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2coo_A Lipoamide acyltransferase component of branched- chain alpha-keto acid dehydrogenase...; E3_binding domain; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1w85_I Dihydrolipoyllysine-residue acetyltransferase component of pyruvate; dehydrogenase, multienzyme complex, oxidoreductase; HET: TDP; 2.0A {Geobacillus stearothermophilus} SCOP: a.9.1.1 PDB: 1w88_I* 1w4g_A 1w4e_A 1w4f_A 2pdd_A 2pde_A 1ebd_C* Length = 49 Back     alignment and structure
>1w4i_A Pyruvate dehydrogenase E2; transferase, peripheral-subunit binding domain, ultrafast folding, homologues,; NMR {Pyrobaculum aerophilum} PDB: 1w4j_A 1w4k_A Length = 62 Back     alignment and structure
>1bal_A Dihydrolipoamide succinyltransferase; glycolysis; NMR {Escherichia coli} SCOP: a.9.1.1 PDB: 1bbl_A 1w4h_A 2wav_A 2btg_A 2bth_A 2cyu_A Length = 51 Back     alignment and structure
>2f60_K Pyruvate dehydrogenase protein X component; protein-binding protein, E3BD, protein binding; 1.55A {Homo sapiens} PDB: 2f5z_K Length = 64 Back     alignment and structure
>2eq9_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltranferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 2.09A {Thermus thermophilus HB8} Length = 41 Back     alignment and structure
>2eq8_C Pyruvate dehydrogenase complex, dihydrolipoamide acetyltransferase E2 component; protein-protein complex, oxidoreductase; HET: FAD; 1.94A {Thermus thermophilus HB8} Length = 40 Back     alignment and structure
>2eq7_C 2-oxoglutarate dehydrogenase E2 component; protein-protein complex, oxidoreductase, structural genomics, NPPSFA; HET: FAD NAD; 1.80A {Thermus thermophilus HB8} Length = 40 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

Original result of HHsearch against PDB70 database

IdentityAlignment graphLength Definition Probability
Target423 pyruvate dehydrogenase complex dihydrolipoamide acetylt
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 100.0
1dpb_A243 Dihydrolipoyl-transacetylase; dihydrolipoamide acetyltr 100.0
1scz_A233 E2, dihydrolipoamide succinyltransferase; COA-dependent 100.0
3mae_A256 2-oxoisovalerate dehydrogenase E2 component, dihydrolip 100.0
2ii3_A262 Lipoamide acyltransferase component of branched- chain 100.0
3b8k_A239 PDCE2;, dihydrolipoyllysine-residue acetyltransferase; 100.0
3l60_A250 Branched-chain alpha-keto acid dehydrogenase; structura 100.0
3cla_A213 Type III chloramphenicol acetyltransferase; transferase 100.0
1q23_A219 Chloramphenicol acetyltransferase; CAT I, trimer, fusid 100.0
2i9d_A217 Chloramphenicol acetyltransferase; structural genomics, 100.0
1zy8_K229 Pyruvate dehydrogenase protein X component, mitochondri 100.0
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 99.92
2dne_A108 Dihydrolipoyllysine-residue acetyltransferase component 99.92
3crk_C87 Dihydrolipoyllysine-residue acetyltransferase component 99.89
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 99.89
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 99.86
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 99.83
1pmr_A80 Dihydrolipoyl succinyltransferase; 2-oxoglutarate dehyd 99.81
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 99.79
1gjx_A81 Pyruvate dehydrogenase; oxidoreductase, lipoyl domain, 99.76
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 99.7
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 99.64
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 99.58
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 99.52
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 99.49
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 99.48
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 99.45
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 99.41
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 99.39
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 99.11
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 98.04
1hpc_A131 H protein of the glycine cleavage system; transit pepti 97.33
1onl_A128 Glycine cleavage system H protein; hybrid barrel-sandwi 97.32
3mxu_A143 Glycine cleavage system H protein; seattle structural g 97.28
3hgb_A155 Glycine cleavage system H protein; ssgcid, niaid, decod 97.27
1zko_A136 Glycine cleavage system H protein; TM0212, structural g 97.25
3klr_A125 Glycine cleavage system H protein; antiparallel beta sh 97.24
3a7l_A128 H-protein, glycine cleavage system H protein; lipoic ac 97.22
3h9i_A407 Cation efflux system protein CUSB; three-helix bundle, 96.86
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, beta 94.63
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric assem 94.55
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi-funct 92.23
2coo_A70 Lipoamide acyltransferase component of branched- chain 99.25
1w4i_A62 Pyruvate dehydrogenase E2; transferase, peripheral-subu 99.18
1zwv_A58 Lipoamide acyltransferase component of branched- chain 99.12
1w85_I49 Dihydrolipoyllysine-residue acetyltransferase component 99.11
2eq9_C41 Pyruvate dehydrogenase complex, dihydrolipoamide acetyl 99.05
2f60_K64 Pyruvate dehydrogenase protein X component; protein-bin 99.03
1bal_A51 Dihydrolipoamide succinyltransferase; glycolysis; NMR { 99.03
2eq7_C40 2-oxoglutarate dehydrogenase E2 component; protein-prot 99.0
2eq8_C40 Pyruvate dehydrogenase complex, dihydrolipoamide acetyl 98.94
3cdx_A354 Succinylglutamatedesuccinylase/aspartoacylase; structur 96.88
3n6r_A681 Propionyl-COA carboxylase, alpha subunit; protein compl 99.13
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi-funct 99.0
3fpp_A341 Macrolide-specific efflux protein MACA; hexameric assem 93.17
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 92.1
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 92.08
1vf7_A369 Multidrug resistance protein MEXA; alpha hairpin, beta 90.68
3dva_I428 Dihydrolipoyllysine-residue acetyltransferase component 90.57
3bg3_A 718 Pyruvate carboxylase, mitochondrial; TIM barrel, ATP-bi 98.85
3lnn_A359 Membrane fusion protein (MFP-RND) heavy metal CAT trico 97.09
1k8m_A93 E2 component of branched-chain ahpha-ketoacid dehydroge 96.36
1dcz_A77 Transcarboxylase 1.3S subunit; antiparallel beta sheet, 95.52
2kcc_A84 Acetyl-COA carboxylase 2; biotinoyl domain, BCCP, BIRA, 95.52
2dn8_A100 Acetyl-COA carboxylase 2; biotin required enzyme, trans 95.45
2ejm_A99 Methylcrotonoyl-COA carboxylase subunit alpha; biotin-r 95.23
2f1m_A277 Acriflavine resistance protein A; helical hairpin, lipo 95.19
1bdo_A80 Acetyl-COA carboxylase; BCCPSC, carboxyl transferase, f 95.09
2d5d_A74 Methylmalonyl-COA decarboxylase gamma chain; biotin, do 94.98
1iyu_A79 E2P, dihydrolipoamide acetyltransferase component of py 94.93
1z6h_A72 Biotin/lipoyl attachment protein; solution structure, b 94.76
1qjo_A80 Dihydrolipoamide acetyltransferase; lipoyl domain, pyru 94.69
2k7v_A85 Dihydrolipoyllysine-residue acetyltransferase component 94.41
1ghj_A79 E2, E2, the dihydrolipoamide succinyltransferase compon 93.8
2jku_A94 Propionyl-COA carboxylase alpha chain, mitochondrial; l 93.56
3hbl_A1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 92.55
2k32_A116 A; NMR {Campylobacter jejuni} PDB: 2k33_A* 92.5
2dnc_A98 Pyruvate dehydrogenase protein X component; lipoic acid 92.39
1y8o_B128 Dihydrolipoyllysine-residue acetyltransferase component 92.18
2dne_A