HHsearch alignment for GI: 254780674 and conserved domain: PRK09783

>PRK09783 copper/silver efflux system membrane fusion protein CusB; Provisional.
Probab=96.78  E-value=0.013  Score=37.17  Aligned_cols=37  Identities=16%  Similarity=0.418  Sum_probs=30.3

Q ss_pred             CCEEEEECCCCCEEEEEEE-CCCCCEEECCCEEEEEECC
Q ss_conf             5312453687868999992-4886040358559999707
Q gi|254780674|r   44 KAIMEFESVDEGIIDEILV-PAGTENIAVNSPILNILMD   81 (423)
Q Consensus        44 Ka~~ev~S~~~G~l~~i~v-~eG~e~v~VG~~i~~i~~~   81 (423)
T Consensus       119 ~~~~~v~~r~~G~Ie~L~v~~~G-~~V~kGq~L~~lYSP  156 (407)
T PRK09783        119 YQYAIVQARAAGFIDKVYPLTVG-DKVQKGTPLLDLTIP  156 (407)
T ss_pred             CCEEEEEECCCCEEEEEEECCCC-CEECCCCEEEEEECH
T ss_conf             73289971035268898742578-787389788999388