HHsearch alignment for GI: 254780674 and conserved domain: PRK11556

>PRK11556 multidrug efflux system subunit MdtA; Provisional.
Probab=97.59  E-value=0.00043  Score=47.13  Aligned_cols=36  Identities=11%  Similarity=0.168  Sum_probs=32.3

Q ss_pred             EEEEECCCCCEEEEEEECCCCCEEECCCEEEEEECCC
Q ss_conf             1245368786899999248860403585599997075
Q gi|254780674|r   46 IMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDS   82 (423)
Q Consensus        46 ~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i~~~~   82 (423)
T Consensus        87 ~v~v~~~VsG~I~~i~v~~G-d~VkkGqvLa~iD~~~  122 (415)
T PRK11556         87 TVTVRSRVDGQLMALHFQEG-QQVKAGDLLAEIDPSQ  122 (415)
T ss_pred             EEEEEEEEEEEEEEEECCCC-CEECCCCEEEEECCHH
T ss_conf             99998785029999985898-9978999999988357