HHsearch alignment for GI: 254780674 and conserved domain: PRK11856

>PRK11856 branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed.
Probab=100.00  E-value=0  Score=744.45  Aligned_cols=323  Identities=43%  Similarity=0.727  Sum_probs=312.7

Q ss_pred             CEEEECCCCCCCEEEEEEEEEEECCCCEECCCCEEEEEECCCCEEEEECCCCCEEEEEEECCCCCEEECCCEEEEEECCC
Q ss_conf             34786788788721799999981689785279859999526531245368786899999248860403585599997075
Q gi|254780674|r    3 IHTITMPSLSPTMTEGKLAKWIKQEGDKISPGDILCEIETDKAIMEFESVDEGIIDEILVPAGTENIAVNSPILNILMDS   82 (423)
Q Consensus         3 ~~~i~mP~lGe~m~egtI~~Wl~k~GD~V~~gd~l~eVETDKa~~ev~S~~~G~l~~i~v~eG~e~v~VG~~i~~i~~~~   82 (423)
T Consensus         1 i~~i~mP~lge~m~eg~i~~W~~~~Gd~V~~g~~l~eVeTDKa~~ei~a~~~G~l~~i~~~~G-~~v~VG~~ia~i----   75 (324)
T PRK11856          1 IHEIKMPDLGEGMTEGEIVEWLVKEGDTVKKGDPLAEVETDKATVEVESPVAGTLRKILVEEG-DVVPVGAPIAVI----   75 (324)
T ss_pred             CEEEECCCCCCCCCEEEEEEEEECCCCEECCCCEEEEEECCCEEEEEECCCCEEEEEEECCCC-CEECCCCEEEEE----
T ss_conf             928878999999517999999908999978999499998076668980688839989960897-995799989994----


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             42111112221000111112222233322222222222234322101111000001101234433222100244432000
Q gi|254780674|r   83 TEIPPSPPLSKENIVEVREEHSHSSPVVVREKHSKNRPIASPLARRLAGEHGIDLSSLSGSGPHGRIVKSDIETLISTKT  162 (423)
Q Consensus        83 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~aSP~aRklA~e~giDl~~V~GTG~~GRItk~DV~~~~~~~~  162 (423)
T Consensus        76 -------------------------------------~~asP~ar~lA~e~gidl~~i~gtG~~gr--------------  104 (324)
T PRK11856         76 -------------------------------------VRASPLARKLARELGVDLATVRGTGPGGR--------------  104 (324)
T ss_pred             -------------------------------------CCCCCHHHHHHHHCCCCHHHCCCCCCCCC--------------
T ss_conf             -------------------------------------46782445568772999766778999986--------------


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCHHHCCCCCCCCCCHHHHHHHHHHHHH
Q ss_conf             10001112211124444455546543456624655111221101110001232100000122233204678777566555
Q gi|254780674|r  163 NVKDYSTIQSFGLVDESIDANILNLFAKDSYEVIPHDNIRKTIACRLQQSKQTIPHFYVSIDCNIDNLLSLREQMNRTLQ  242 (423)
Q Consensus       163 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vp~s~irk~ia~~m~~S~~~iPh~~~~~evd~t~l~~~R~~l~~~~~  242 (423)
T Consensus       105 -------------------------------------~~r~~ia~~m~~s~~~ip~~~~~~~vd~~~l~~~r~~~~~~--  145 (324)
T PRK11856        105 -------------------------------------GLRKAIAKRMVNSKFNIPHFTLTDEVDATDLLALRKSLKKA--  145 (324)
T ss_pred             -------------------------------------CHHHHHHHHHHHHHCCCCEEEEEEEEEHHHHHHHHHHHHHH--
T ss_conf             -------------------------------------25899999988773039829999987579999999997654--


Q ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC-CCCCEECCCCCCCEEEEECCCCCCEEEECCCCCCHHHHHHHHHH
Q ss_conf             43201466554322210111001100000000112-34410125566541565146420203414554798999998766
Q gi|254780674|r  243 FHREEISNKISVNDIILKAFALAMIQVPEANVSWT-TNAMIRHKHIDISVAVSIPGGIVTPIIRQADQKSILDISLEVKQ  321 (423)
Q Consensus       243 ~~~~~~~~kit~~~~l~kA~a~AL~~~P~~Na~~~-~~~i~~~~~vnIgiAv~~~~GL~vPvIk~ad~~~l~~i~~~~~~  321 (423)
T Consensus       146 ---~~~~~klt~~~~~ikA~~~AL~~~P~~Ns~~~~~~~i~~~~~vnIGiAV~~~~GLvvPvir~a~~~sl~~ia~~~~~  222 (324)
T PRK11856        146 ---AVEGGKLTVLAFLVKAVADALKEFPLLNASFDDEGEIVLHKSVNLGIAVATDDGLVVPVIRNADKKSLAELAAEIKD  222 (324)
T ss_pred             ---HHCCCCCCHHHHHHHHHHHHHHHCHHHHEEECCCCEEEECCCCCEEEEEECCCCEEEEEECCCCCCCHHHHHHHHHH
T ss_conf             ---30488768679999999999742837506997899499935765689998278637005887000899999998999


Q ss_pred             HHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCCCEEEEEECCCEEEEEEECCEEEEEEEEEEEEEEEECEEEH
Q ss_conf             65431023346100377238985153214221013115887168984463123587789378954889898520011402
Q gi|254780674|r  322 LAQRAKQRKLKPEEYQGGTTSISNMGMLGINSFCAVINPPQSTILAIGAGEKKVVFQNEEIKVATIMNATLSADHRSVDG  401 (423)
Q Consensus       322 l~~~ar~~~l~~~d~~ggtftiSNlG~~g~~~~~pii~~pq~aILgvG~~~~~~~~~~~~i~~~~~~~ltls~DHRvidG  401 (423)
T Consensus       223 l~~~Ar~~~L~~~dl~ggtftISNlG~~g~~~~tpii~ppq~aIl~vG~i~~~pv~~~~~i~~~~~~~ltls~DHRvidG  302 (324)
T PRK11856        223 LARKAREGKLKPEELSGGTFTISNLGMFGGDYFTPIINPPEVAILGVGRIEDRPVVKDGEIVVRKVMPLSLSFDHRVVDG  302 (324)
T ss_pred             HHHHHHHCCCCHHHHCCCCEEEECCCCCCCEEEECCCCCCCEEEEECCCCEEEEEEECCEEEEEEEEEEEEEEECCCCCC
T ss_conf             99999828999899479708997677755434663546885599985744588899899788965899999855401270


Q ss_pred             HHHHHHHHHHHHHHCCHHHHHC
Q ss_conf             8899999999998719889719
Q gi|254780674|r  402 AIASKLLAKFKEYIENPVWMLM  423 (423)
Q Consensus       402 a~aa~Fl~~~~~~le~P~~ll~  423 (423)
T Consensus       303 a~aa~Fl~~l~~~le~P~~lll  324 (324)
T PRK11856        303 ADAARFLKALKELLENPALLLL  324 (324)
T ss_pred             HHHHHHHHHHHHHHCCHHHHHC
T ss_conf             9999999999998619887659